dd2-0.2.2/src/data/Makefile.in0000644000175000017500000001304210661102505015531 0ustar reidracreidrac# Makefile.in generated automatically by automake 1.4-p6 from Makefile.am # Copyright (C) 1994, 1995-8, 1999, 2001 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. SHELL = @SHELL@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ prefix = @prefix@ exec_prefix = @exec_prefix@ bindir = @bindir@ sbindir = @sbindir@ libexecdir = @libexecdir@ datadir = @datadir@ sysconfdir = @sysconfdir@ sharedstatedir = @sharedstatedir@ localstatedir = @localstatedir@ libdir = @libdir@ infodir = @infodir@ mandir = @mandir@ includedir = @includedir@ oldincludedir = /usr/include DESTDIR = pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = ../.. ACLOCAL = @ACLOCAL@ AUTOCONF = @AUTOCONF@ AUTOMAKE = @AUTOMAKE@ AUTOHEADER = @AUTOHEADER@ INSTALL = @INSTALL@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ $(AM_INSTALL_PROGRAM_FLAGS) INSTALL_DATA = @INSTALL_DATA@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ transform = @program_transform_name@ NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : CC = @CC@ MAKEINFO = @MAKEINFO@ PACKAGE = @PACKAGE@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ VERSION = @VERSION@ pkgdata_DATA = bgm1.xm bgm2.xm efx1.wav efx2.wav efx3.wav efx4.wav efx5.wav efx6.wav efx7.wav efx8.wav gfx.bmp dd2.cfg game.act dd2-hiscore EXTRA_DIST = bgm1.xm bgm2.xm efx1.wav efx2.wav efx3.wav efx4.wav efx5.wav efx6.wav efx7.wav efx8.wav gfx.bmp dd2.cfg game.act dd2-hiscore mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = DATA = $(pkgdata_DATA) DIST_COMMON = Makefile.am Makefile.in DISTFILES = $(DIST_COMMON) $(SOURCES) $(HEADERS) $(TEXINFOS) $(EXTRA_DIST) TAR = tar GZIP_ENV = --best all: all-redirect .SUFFIXES: $(srcdir)/Makefile.in: Makefile.am $(top_srcdir)/configure.in $(ACLOCAL_M4) cd $(top_srcdir) && $(AUTOMAKE) --gnu src/data/Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status $(BUILT_SOURCES) cd $(top_builddir) \ && CONFIG_FILES=$(subdir)/$@ CONFIG_HEADERS= $(SHELL) ./config.status install-pkgdataDATA: $(pkgdata_DATA) @$(NORMAL_INSTALL) $(mkinstalldirs) $(DESTDIR)$(pkgdatadir) @list='$(pkgdata_DATA)'; for p in $$list; do \ if test -f $(srcdir)/$$p; then \ echo " $(INSTALL_DATA) $(srcdir)/$$p $(DESTDIR)$(pkgdatadir)/$$p"; \ $(INSTALL_DATA) $(srcdir)/$$p $(DESTDIR)$(pkgdatadir)/$$p; \ else if test -f $$p; then \ echo " $(INSTALL_DATA) $$p $(DESTDIR)$(pkgdatadir)/$$p"; \ $(INSTALL_DATA) $$p $(DESTDIR)$(pkgdatadir)/$$p; \ fi; fi; \ done uninstall-pkgdataDATA: @$(NORMAL_UNINSTALL) list='$(pkgdata_DATA)'; for p in $$list; do \ rm -f $(DESTDIR)$(pkgdatadir)/$$p; \ done tags: TAGS TAGS: distdir = $(top_builddir)/$(PACKAGE)-$(VERSION)/$(subdir) subdir = src/data distdir: $(DISTFILES) here=`cd $(top_builddir) && pwd`; \ top_distdir=`cd $(top_distdir) && pwd`; \ distdir=`cd $(distdir) && pwd`; \ cd $(top_srcdir) \ && $(AUTOMAKE) --include-deps --build-dir=$$here --srcdir-name=$(top_srcdir) --output-dir=$$top_distdir --gnu src/data/Makefile @for file in $(DISTFILES); do \ d=$(srcdir); \ if test -d $$d/$$file; then \ cp -pr $$d/$$file $(distdir)/$$file; \ else \ test -f $(distdir)/$$file \ || ln $$d/$$file $(distdir)/$$file 2> /dev/null \ || cp -p $$d/$$file $(distdir)/$$file || :; \ fi; \ done info-am: info: info-am dvi-am: dvi: dvi-am check-am: all-am check: check-am installcheck-am: installcheck: installcheck-am install-exec-am: install-exec: install-exec-am install-data-am: install-pkgdataDATA @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-data-hook install-data: install-data-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am install: install-am uninstall-am: uninstall-pkgdataDATA uninstall: uninstall-am all-am: Makefile $(DATA) all-redirect: all-am install-strip: $(MAKE) $(AM_MAKEFLAGS) AM_INSTALL_PROGRAM_FLAGS=-s install installdirs: $(mkinstalldirs) $(DESTDIR)$(pkgdatadir) mostlyclean-generic: clean-generic: distclean-generic: -rm -f Makefile $(CONFIG_CLEAN_FILES) -rm -f config.cache config.log stamp-h stamp-h[0-9]* maintainer-clean-generic: mostlyclean-am: mostlyclean-generic mostlyclean: mostlyclean-am clean-am: clean-generic mostlyclean-am clean: clean-am distclean-am: distclean-generic clean-am distclean: distclean-am maintainer-clean-am: maintainer-clean-generic distclean-am @echo "This command is intended for maintainers to use;" @echo "it deletes files that may require special tools to rebuild." maintainer-clean: maintainer-clean-am .PHONY: uninstall-pkgdataDATA install-pkgdataDATA tags distdir info-am \ info dvi-am dvi check check-am installcheck-am installcheck \ install-exec-am install-exec install-data-am install-data install-am \ install uninstall-am uninstall all-redirect all-am all installdirs \ mostlyclean-generic distclean-generic clean-generic \ maintainer-clean-generic clean mostlyclean distclean maintainer-clean install-data-hook: chmod a+rw $(pkgdatadir)/dd2-hiscore # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: dd2-0.2.2/src/data/Makefile.am0000644000175000017500000000052610052147374015532 0ustar reidracreidrac pkgdata_DATA = bgm1.xm bgm2.xm efx1.wav efx2.wav efx3.wav efx4.wav efx5.wav \ efx6.wav efx7.wav efx8.wav gfx.bmp dd2.cfg game.act dd2-hiscore EXTRA_DIST = bgm1.xm bgm2.xm efx1.wav efx2.wav efx3.wav efx4.wav efx5.wav \ efx6.wav efx7.wav efx8.wav gfx.bmp dd2.cfg game.act dd2-hiscore install-data-hook: chmod a+rw $(pkgdatadir)/dd2-hiscore dd2-0.2.2/src/data/bgm1.xm0000644000175000017500000036534207636076510014713 0ustar reidracreidracExtended Module: The Levelrst's SoundTracker } @=@==@@==@=I@==@=@==@@===@@=I@==@==@?@==@=@==@@==@=I@==@=@==@@===@@=I@==@==@?@==@=@==@@==@=I@==@=@==@@===@@=I@==@==@?@==@=@==@@==@=I@==@=@==@@===@=@==I@==@==@=?@==@= @4=@==U=0N0@U0M0@=I0=@=I0I@===0@=@==I0@@==P=0=@NP0@=N0I0I@=M=@==NM0=0I0@N0?@==MI0K0@M0=@==I=0I0@I0@=I0=@=I@===0@=@==I0I0@@==I=0K0=@KI0@=IK0I0I0I@=KI0=@==MK0=0K0@NM0?@==MN0I0M0@NM0=@==UN0=0I0@U0@=I0=@=I@===0@=@==I0@@==P=0N0=@NP0M0@=N0I0I@=MI0=@==NM0=0@N0?@==MI0@M0=@==I=0@I0@=I0=@=I@===0I0@=@==I0K0@@==I=0I0=@KI0@=IK0I0K0I@=KI0=@==MK0=0M0@=NM0?@==MN0I0N0@NM0 @d=@==II01@3 =I01 ==0=@==U==U0I00@=0 =@===01@=1 ?@==TK03@=T03 =?0?@====PK01@=P01 ?@==?03@=3 @@==IL04@=I04 =@0@@====IL03@=I03 @@==K@04@=K04 B@==IN06@=I06 =B0B@====N06@B@=6 @@==B04@?@=3@4 =@==II01@3 =I01 ==0=@==U==U0I00@=0 =@===01@=1 ?@==TK03@=T03 =?0?@====PK01@=P01 ?@==?03@=3 @@==IL04@=I04 =@0@@====IL03@=I03 @@==K@04@=K04 B@==IN06@=I06 =B0B@====IN06@=I06 N@==KB04@=K03@4 @8=@==U=0N0@U0M0@=I0=@=I0I@===0@=@==I0@@==P=0=@NP0@=N0I0I@=M=@==NM0=0I0@N0?@==MI0K0@M0=@==I=0I0@I0@=I0=@=I@===0@=@==I0I0@@==I=0K0=@KI0@=IK0I0I0I@=KI0=@==MK0=0K0@NM0?@==MN0I0M0@NM0=@==UN0=0I0@U0@=I0=@=I@===0@=@==I0@@==P=0N0=@NP0M0@=N0I0I@=MI0=@==NM0=0@N0?@==MI0@M0=@==I=0@I0@=I0=@=I@===0I0@=@==I0K0@@==I=0I0=@=KI0@=IK0I0K0I@=KI0=@==MK0=0M0@=NM0?@==MN0I0N0@=NM0 @=@==II0 =I0==0=@==U==U0I0==@===0=?@==TK0=T0=?0?@====PK0=P0?@==?0=@@==IL0=I0=@0@@====IL0=I0@@==K@0=K0B@==IN0=I0=B0B@====N0B@=@@==B0?@==@==II0=I0==0=@==U==U0I0==@===0=?@==TK0=T0=?0?@====PK0=P0?@==?0=@@==IL0=I0=@0@@====IL0=I0@@==K@0=K0B@==IN0=I0=B0B@====IN0=I0N@==KB0=K0 @ == ========0=============0=============0============================0=============0=============0=================== @1====I I01====II0= 1=== =1========N==PNQP==?SQ=TS1====UTU01====UU0= 1=== =1============ ='The Level'(0@, <FPZdn (2 < F P Z d n x 0@ Synth Bass f?\ ZO      J? !?* %%        by Juan J. Martinez(0@, <FPZdn (2 < F P Z d n x :@Kick Drum )     &9!    ) %(     )    #2       $                                        Check COPYING for(0@, <FPZdn (2 < F P Z d n x `@Snare Drum NE9$ Dپ)"Ϟ;bO}^L6VhG|ɨXeD[AtvH#)71w ^8;C FވMᲦK`w&)b@j&5ݨ P&H%.COX' .%15]ܨ89)1F5 sD2,FHg>- `K-Y-X0k,R@(2!EM+_$8?@ӁF]IC-*/+cqHRG(='$5S4o8B@7Z$   0싑D/$&:_ zO=<V{(7FL{Q*/[{-!-  JN*3V+!G-G.)Z[=@B(WP/Y4-V%< PJ\Ҫu.,E] \>5$992W)* <+.4A I b^V %7! 5&8D%/H( Hb" ?8[9K_p&5'$(~> 0 $^&+%n2իZD٧NU&9\K%9&2> "#5O| '&WbC C@ 2 .6YI*bH8Q-S%?73F H <9P -B  Op6&*9 (%%DI)6:S<9"5% Mϴ=#1>L  0H* %-H"&&& #-#,Q'$1&1&.E*2 !7$?R4 %N145 6-1 % ! ?- %#  *   6&  B!1, " ,&$   % ))+ @  +$!*&  ,=   "  " "     "(9 (  $  , 7  &#   "! &  !&!  .  " !                    +                                     "  )                                                                                                                                                                                                                 distribution details.(0@, <FPZdn (2 < F P Z d n x -SC Pedal Hi-Hat ' % -#IK;6#3V160 57" E@*Kȵ|gIX[P( 3A05 "# *  ^?<7z&N/)&3G .e& (*# "* 'L.A u$"  +^-J.-!4EN9 .&BPV O LA !!  F,!  %). '  4  ",2&  6:( .%#3"7#2  ERO2& % $<,#):   - '=!+$  %R>0) ?M)/?-+ &/(  $%  &B'  '    2  1 5%61 %81           4  #         '$>0   (  /    $          (0@, <FPZdn (2 < F P Z d n x  -SC Closed Hi-Hat -L 'Y*W]ui3mxV PO8V%F&* !AA)#R~pI.@3>#"%n1)Q<'R,'Ft=5?S"5%7D% -}n29A%D#=@ ,@@0," &\]h&% &:*> (=#WPE  %"  #! ` AZ XU < 43+ XJAW&aNqd#"+%!WL# &H9 6/3Ei%6( &7"+>'K&$~iϲ/*"X&- (N3#)+.M${f20 <:4+&\ aEX_\*l|M2I3. G$ & +'L$x3Cf,C;.1%#1% I!9"ojy $FH *MJ)$! B4=4%89A6'Yi/$]Ő)KB*39 4gر[0 '`8[$H)X ?!K[ەנr( ;5dcT)2F %*-  MH @MPmFR{1jiѷ?$1"))" =+20G&g/(@iY7*uM/;* %OL G&TF%Cu<%E Vtg'2KY 00I 5'0C!GZF-'HЫ8 "! @?@_ 1;b4',,    =>%I",! CYS7  # NA^ K'"%g: &"! S$ # % (.,"F/0#   #3"& dI%(.2R6%0  " %$% eӶF& 1 7.$dG*    H !RI$;6%9#/   ;+ % '&  -  * 3D$ 23Y1       9 #   &        *!    +   -                     This track is part of(@rrrrrFPZdn (2 < F P Z d n x UT@Acoustic Piano #    &'#.   #         (%  .$4        $&     !$  !(     &     "   (   )+              /  #!       *(         &                   !                            %                                                                                                                                                                                                                                                                                                                                                                                                        Dodgin' Diamond II.(0@, <FPZdn (2 < F P Z d n x gIh.@Wave             !   !      !       &        ! ) $  &  &, % #  #  - $ ۻ"   . & ׾#  /! & "# !. ! &  #  -  &  " +  %   * % (  #  &  "   %   " $# # %   !   $    $"" #    #  "        ! !       )  ٗ1 & #                                                                                                                                          ڼ!ȷ"                                                                                                                                                                                                                                                                                                                                        dd2-0.2.2/src/data/bgm2.xm0000644000175000017500000035232710052147205014675 0ustar reidracreidracExtended Module: The Levelrst's SoundTracker  } @ @ @ @ @ @ @ @))??)??)3)3)????)3)3)????)3)3''??'??'3'3%%??%??%3%3%????%3%3%????%3%3%????%3%3 @))??)??)3)3)????)3)3)????)3)3''??'??'3'3%%??%??%3%3%????%3%3%????%3%3%?????%3?%3?? @2))?A?5<?)?5?)3H?)3A)?5???H?)3A?)35?)?H???A?)35?)3H''???<?'?3?='3H?'3???%%?=?8??%?1?%3D?%3=8?%?1?8??D?%3=?%31?%?D???=?%31?%3D?%?=?8??1??%3D?=%3=?? @.))?A?5<?)?5?)3H?)3A)?5???H?)3A?)35?)?H???A?)35?)3H''???<?'?3?='3H?'3???%%?=?8??%?1?%3D?%3=8?%?1?8??D?%3=?%31?%?D???=?%31?%3D?%?=?8??1?%3D?=%3=? @2))?A?5<?)?5?)3H?)3A)?5???H?)3A?)35?)?H???A?)35?)3H''???<?'?3?='3H?'3???%%?=?8??%?1?%3D?%3=8?%?1?8??D?%3=?%31?%?D???=?%31?%3D?%?=?8??1??%3D?=%3=??'The Boss'(0@, <FPZdn (2 < F P Z d n x 0@ Synth Bass f?\ ZO      J? !?* %%        by Juan J. Martinez(0@, <FPZdn (2 < F P Z d n x :@Kick Drum )     &9!    ) %(     )    #2       $                                        Check COPYING for(0@, <FPZdn (2 < F P Z d n x `@Snare Drum NE9$ Dپ)"Ϟ;bO}^L6VhG|ɨXeD[AtvH#)71w ^8;C FވMᲦK`w&)b@j&5ݨ P&H%.COX' .%15]ܨ89)1F5 sD2,FHg>- `K-Y-X0k,R@(2!EM+_$8?@ӁF]IC-*/+cqHRG(='$5S4o8B@7Z$   0싑D/$&:_ zO=<V{(7FL{Q*/[{-!-  JN*3V+!G-G.)Z[=@B(WP/Y4-V%< PJ\Ҫu.,E] \>5$992W)* <+.4A I b^V %7! 5&8D%/H( Hb" ?8[9K_p&5'$(~> 0 $^&+%n2իZD٧NU&9\K%9&2> "#5O| '&WbC C@ 2 .6YI*bH8Q-S%?73F H <9P -B  Op6&*9 (%%DI)6:S<9"5% Mϴ=#1>L  0H* %-H"&&& #-#,Q'$1&1&.E*2 !7$?R4 %N145 6-1 % ! ?- %#  *   6&  B!1, " ,&$   % ))+ @  +$!*&  ,=   "  " "     "(9 (  $  , 7  &#   "! &  !&!  .  " !                    +                                     "  )                                                                                                                                                                                                                 distribution details.(0@, <FPZdn (2 < F P Z d n x -SC Pedal Hi-Hat ' % -#IK;6#3V160 57" E@*Kȵ|gIX[P( 3A05 "# *  ^?<7z&N/)&3G .e& (*# "* 'L.A u$"  +^-J.-!4EN9 .&BPV O LA !!  F,!  %). '  4  ",2&  6:( .%#3"7#2  ERO2& % $<,#):   - '=!+$  %R>0) ?M)/?-+ &/(  $%  &B'  '    2  1 5%61 %81           4  #         '$>0   (  /    $          !(This track is part of(@rrrrrFPZdn (2 < F P Z d n x UT@Acoustic Piano #    &'#.   #         (%  .$4        $&     !$  !(     &     "   (   )+              /  #!       *(         &                   !                            %                                                                                                                                                                                                                                                                                                                                                                                                        Dodgin' Diamond II.(0@, <FPZdn (2 < F P Z d n x gIh.@Wave             !   !      !       &        ! ) $  &  &, % #  #  - $ ۻ"   . & ׾#  /! & "# !. ! &  #  -  &  " +  %   * % (  #  &  "   %   " $# # %   !   $    $"" #    #  "        ! !       )  ٗ1 & #                                                                                                                                          ڼ!ȷ"                                                                                                                                                                                                                                                                                                                                        dd2-0.2.2/src/data/efx1.wav0000644000175000017500000001105207636076510015063 0ustar reidracreidracRIFF"WAVEfmt "V"Vfactdata~~}~~~}}}}~}}}}|~}~~~~~}}|}}{|}|{~}{|~~}{{}}{z}}}~{}||~~{||y}~{}~~}}~}|}}|~~}~|~~|}|}~}~~~~~}}~}~}}}~~~~~~~~~~~}~}}~}~~}~~~}~~~}}~~}~}~~~||{}}|||~}~}z|y|~}~{{~z|}y~{|x}z}||v||z|z{}{x~{|~z|~zwz|~yx{{~yx{{{z{}{~y~|~z~x}|||x~z|~~{}~y~{}~z~~|z~|~zy~|z}|{|xy~|{}}z{~~~|y{|}yz}zxz}~||~}|}}{|}~~}~{z~|{|}~}{||y}~}}|~~xyx}~~|{xy}~}~{|~}{|}~z}xz}|~|}xy{z{z{x}}~|}~zvy{{~~zy}}|}~yx{|}||yx{~~~|{||}}{yxx{~}{{~~|zzzz||zxyz{}~~{zz|~}|||~~}{{}~}}}}}~~}zwvwy}}|zyyz{~~zxwxz}~}|||}~~|zz{|~}}}|{|~~~~}}}}}}}~~}|||~~~~}}~~~}||{{|||~~~~~~}~~~~~~~}~~|zyyyz||zyz{}~{yxxz~{ywwwy{~~}|||}}~~~~~}}}~~|{yyyz|~~{zyz{}~|zyyz|~~}|{{{||}}~|zyxy{}~|{|}}{yyz|~}|{zzz|~~}}~~{yxxy{}~|zxwvwy|~{yyz|~}|{|}~}zwuuux|~}}}}}}}|{{|}~}}~|ywwxz|~~zwvvx{~}}~~}{zyxy|~{zz|}~~~~~~~}~}zwwy{~~|z{}|ywxy{}~~~~~{z{}|zxxyyzzz||z{}~|{{|~{xwyz|}}}~~}~||||||||~~zy{|xwx{}xutv{~}zz{}~~}}{yxwz}}~~zwx|||~{vuvvvz{{{{|~}wwxuyuy|z{w~{|xy{yz}z}vzvv}s}|z{{}rp~|v}{~x|xzy}}}|}z}xyww|xwzxrxzwpsw{zkrssuuw}n|sqmo|t{wyw}zp{gyo|yvvgvypqzuy~vmmz|zsmowxqy|xyuoq|spsv}zyw|wvy}xtv}r|wl|}twytuvunyvoyzv{qyys}}tyr}zvz{swyztzs}ym}q~{mq}y|ssz}zk}z~t}pw}|w{tt|l|uv~|}r|zz||}uzkz|{~|u~{nqwrs~ww~mnu{uv{qr{vvyx}zxpoty|yf~hxnk~zq~q}wq~{y~|{fu|wky}yxykzsxmtzqpvgxw}}x{}s{l{zzvo~s}w{rz|trz{yu|w|wz}vhuoq}~z|v{}~{~qzmx}vyknys{}}s{py|~~ztzpz~{xwzmu}zz|~zz{yyzpt{{}|vyz|~{x|xol}}{uvzt{yww{{ox}zx|ut|}}z|uu|}vzyz~z|rxtz|w|zuyx{w||yxxjvzwzw}~v~{}v}|x{{}wlu~xz~xvz}|ywnx~{|~{~u{ryy|z{vzy~}{}po{}|vw~~u{}sry{rv~zts~vj~z}{xsvxwtt||{}|y|}|~uv}{xx{}ypszu~||~yy|wz|vx|}{{|~}yx{uu}{|~~}{xw|~x~yzt|xuzwy~}tzyy~|yw|y|v}z}yzzwx~|}}}{|}{x~~~}}~|w}~~}~}~}~|~|}|}{{zyz}~~~~~y{{yot|~{}}x~||yz~~xyvw}zy||~~{yusuwvxquw{{z}}|~~||}}~~|wwwsompsvwz~~~{z~~~}~~}zuuxuty~{~~~|vuvtmvyyt}}zzzxroqutu{}~~~yxulknquss{y~}}{tuuqrorz|wvuywrwz~~|xwwxxt||{vtxxuszyz}|vwrqpwwz{~}~}{vvuzu{vuy{~{{{zwvmr{}x{wwvspnrrt}wwvppvz{~}|x{|pmklrydd2-0.2.2/src/data/efx2.wav0000644000175000017500000001537607636076510015101 0ustar reidracreidracRIFFWAVEfmt "V"Vfactdata}|ywtpppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppsx{}}ywu}tw~~}~p|zwts}~|y}s||yxqpppppppppppppppppppppvsvy~{~||~v|wvvspppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppsyw}yxwztywvpwtprppppppppppppppppppvswy|yppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppqtwtv{z|qtppppppppptvw}|}~~vtppppppppppppppppppppppppppppppppppppppppppppw{vrppppppppppppppppppppppppppppppppppppppppppppppppppppsvz~xwppppppppppppppppppppt~|xppppppppppppppppppppppppppppppppppu|~yxspppppppppppppppppppppppppppppppppppppppppppppppppptw|~}~~}}|~||}zwtqpppppppppppppppppppppppppppppppppppppppppppppppppppppppppppprtwy|~}{xvsppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppsw{~|wtpppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppptwy{|~~{ywtqppppppppppppppppppppppppppppppppppptwz|~~}|zwtqppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppptwz|~}{ywtsqppppppppppppppppppppppppppppppppppppppppppppppppppsvx{~~}|{yywwwvtttsssssssssttvwwxyy{||}~~}|{zywwvtttttuvwwwwxyy{|}~~}}}||||}}~}zwtspppppppppppppppppppppppppppppppstvwxyz{||}}~~}{yyxwwvvttssqqqqssttvwy{|}~~~}||{zywwvtttttssssttttttuvwwyy{|}~~~~~}|{zxwtsqpppppqtvx{}~~~~~~~}||{{zyyxwwvvtttttssssrqqqqrssssssttttttttttttttttttttttttuvvvvwwwwwwxxyyyyz{{||||}}~~~~~}}}|||{{{zzyyyyxxxwwwwwwvvvutttuvvwwwwwxxxyyyyyyyyyyxxxxxxxxxxxxxwwwxxxxyyyyyyyyyyyyyyyxxxxxxxwwwwwwwwwwwxxxxxyyyyyzz{{|||}}}~~~~~~}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||{{{{{{{{zzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{|||||||||}}}}}~~~~~~~~~~~~}}}}}}}}}}|||||||||||{{{{{{{{{{{{zzzzzzzzyyyyyyyyyyyxxxxxxxxxxyyyyyyyzzz{{{{|||||}}}}~~~~~~~~~}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}||||||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{zzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{||||||||||||||{{{{{{{{{{{{zzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{|||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~dd2-0.2.2/src/data/efx3.wav0000644000175000017500000000553207636076510015073 0ustar reidracreidracRIFFR WAVEfmt "V"Vfact" data" |trzrtq{}}|{zxzwtop|uy~|z~r|uurswuutuvtxwt|u|rkru~xtint}qwnm{}vq}y}|uxx{tchmxxy~{}z|yzy~wqit}{{zozyuz}|}}~|tzzufbmx~vmpoyzmmz}{~|pxlnpt{~ztxwtqn}twstz{|ru~vxt~voxs}qv~~qqdk{pzt}tpyzwynzz~swowxu|u{nv}~zvlst{{ykqvzu{u}~w~muouq{qpedx|y|{zx~tt{u{youz{unquqq{xzyx|wopv{}zwwy}}yxuwxxtpqsz~|zttxyliq|{xrquspqpqur~xwxvxsuu}urvvpmnomor}~}|wuvrlhkuzy}snqz}{wmkmrvyzz||xwwurnmq{~ww}zndagq|~ynhipzxqpvyvwxyyyxz}{|zyxurnmr}~}}}{wsrtx~|vrsyysppoommot||tqrx}{{zyvrmlns{wsty~xrlknv{|~||}}zwtty|snnptx|}~|zz~yqkhioxytnjjlr{~zyz}}yvtuxyyzzz{||qieeiov~~zwvwy}|wrqsy}tnkjmpuzwrnmnry{yz~zvsstvy}~xsoorw}wttw}}upllotz|ywvuuttuvy}}wrpoptx}{vrppsx~xsonoquy~|zyyz{}}|{zzyxyz|xrnkjmrzvoklqw}wsposy{tpnnpsx|zyzzz|~~~||~~}|}}|{zz{|{{~~zwwvuvwy|~~}|{{~}}zxxy{~~{zzzzz}~~|{wwz~|y{|~~~}ztqpsx}yvuuvy|}umjinv~uqnnorwz|slghmu~}{zxxxyz~{vtvzywwy|ytsty{wtpnpv}ytrrruzytvz~zolnru}{vvuux}~|}{|xonswzwuqlu~z{vztow~~{ssklyz}}x|spvp|{rujs{x{uzlswzu|s}|~{q{xw{kuq~{pomx}||{t|}ywzrt~|v|y||}xvzxxv}xss~wx}yuty~}ts{}wuy|vnmu~ysrs~u||os{~}}~|qs}vtzvmq}zu|us}tnxy}{xq|zvuvytrt{|wry}|zmq|xp{wxt{py~|r~k}y{xtrt~pxxott|vr}wzsqxydd2-0.2.2/src/data/efx4.wav0000644000175000017500000005336607636076510015104 0ustar reidracreidracRIFFVWAVEfmt "V"VfactVdataV~wju}}z}mp~mfm|z_QWkqZWbt~}r_We|znr~uksz~mn~jd{xisz{~m[b{{_[s~b[tq]_t~uqqvsqx|w|}qmt}wpnnt|zmagxtb_lnhovv{}tkpyjou|nlxzm_[aeefcUECTifNEEN_dc^TINfjS^z~voqsqlgb\XYYUQUVICCMc_IEFGZkn\IINj}hV\t|wxcj}|riWEATosZBBDXdZJFHTdpn[KL`~mdo{|}}qptesurvxwuqlggs|pZObpUOctncixwd[luryztr|~}ognvm][hl\JL\c^WWYWT^qzrd]bp~sx|}|{w|ohqrrp}qSL`}dGFWYELd{q`]kwvz{zx}n]ZowRHYv~gTQ_rumgebZ\modo~vqx|rkgda]^hus]HKcxyjXLJXynQOfsej|q||y~}wkel~}dQN]p{w_KFOduraVXdkllswtx~vkp{kfslY^vcWbtticafxhU]ytecn{gi|x|x~{}|k^rlbqa\laQasYQ\utXLXmdMNdqZViolq|z}wlgfs|ZBBRaZICCDEEIGGGGHI[bVKL]mwywuwy}i[[cpkNAHirPDGZfhegje`ixwny}phtyaZi{VI[gZl|ow{~~ufnhTTijPPh|pXO[otaS`{yhes~zxdNNmc@@Oee\TLGGKSad\PHPgvwslgly{tsrk`[YVXabVHDDQ\YSQLJOWcjga[`uyot}|w{tlqtmoqopsuoc[[fpme^ajoh_`hoqkfjtwu{~|v{|b_nufQJRZREBCHIIHJMMJHJQ_hhdags|xzylfeedb[VYa`SIQbk`ON[jnf]\dnporusoq}xr|~|wmcfwuaSU\bcd_TP]ptgWVcqtpmrw{~{zoq{idv}gclstyse^gzm_amxwphfjmsvmc`j~vfdq}su{qlpx|uaLDPfqcICDM_bTGGHVbc^[^bjqy~zww||onyxmdaelqmd[Y^bbb^WRT^ieZW\a_bmneaht{wpuz|ldgiiif`TEBH]f\KDEJUaihb\Zbq|or~gcuylddqmZ]m{~vmkr}~{zws{rytmmtp`an|nkv}y|xuq|gdz{dbsw]Ys~jkvys}zv~zmjtw`exzggt~xuxxssu|~w{}|sx{xu~ih}f]qpdk~tbf{{ux}||fqhcyvtvpefw}iURbxuebqsci~p{ztcoolw}|zwplms~rhmiPccWoyci~{mlvzpmsmsytiytmxzfbt~]Tntcclvz~slr|zwv}{mqlev~p~fbzy[axkvps~~xynwunomn|}cUbrpf]]a^Z`mwlRLcnNXo_ywps{ag|ycQMWehe^NCEZusWDEUef]]ekoiY\xyo}q{tvrb_dmnf^WTST^mhNEESrrXFGHWquYO]pvx||xs|]Uboj[UVQEEMTURRLFLZdg\RZjrppuuzuvm\czu\\lwlWQ]hjfca`eiork]Wd{|maftw{z~{n|yilz|lckpnjfaaruYKY|fY`qyddrqowwx}wuy|{s`ez|lgjljffffeeiopj__qyhhwpox|xognx{zjOXYHRdrwytg[_rxrv}{{xznuxkfp{g`mytnnu|ztrzxrz{|||yx~njzsjy}gg{}vwz~uvxw{jnuerzmq~|qq~v~{|ykrv`f]Vm\N_xl]hsWXu\Jhscv~x|qrcS`w~p]VXTKFIRVOKW_TIPaf`]gx|{{fckhXPZkiSDDJ\]OFGUa`_bhnoprv~~y|qyfelP\uyprwkZWhwiSTizs[Qd}cb{w{yy~~zockyb_gikqmXK[kg_crwh]bovtqvro{igeYkw]]q|m\\kywmd_cmusq{mnktyjqxsv~}xnhmzv_]ougi}rq}zvwu{yqezdnli{ynmvp_iwin}|sz}x~hj{jiuvmhgkvqch{p]c~bsyq}ftxp~{u}gblXqsinttroow|fUea^txz|zjpxdi{|qo}lX_{cQYkw`Ui}{}iix\`wziaioe[W\jyyi[]kigxtpsqnkr~pYN_z}fVeviV^{y\aksnxrxtiaaiu|rXEJjqKIf}r_ftd}~x{vk{{hcn}u^S]zgR`~o`ay{nqyrn{sfmyfxmsvxbf|mjpw|}oacnnhjto[PZrfU_xvjmxz~yzyw{hQ^{xeixwf]dqrjhqzxkbo~gfs{}p|rmsqjltzxqnvz}xqu{|s{qvxbv^dri{yaXpz[Yuwrsw}ey~s|vv~o]geUembf|fUq}[bnb|xvuwv}~ptow{twjlqp}|~nxy_`txi_arqdjux|zpozynzwupvyppppyvsvzyvwzvlhnzrjl|ya_{sm~~yxr{{qyszmxseypV`ythktskjjsvpkhm{yrzy}priOY{gWc{o]^yZMmulttlv~u|{~~|udOoPIqmX]fur^\srct{tvxnu~z{wryva[n{dZno^s{r}xqise{\]m]]am~hR\dX}kT|Rigy{zoe|texyhdt~_L\qV]u|obfv|vtvpott|xrotriablnjbZWbqxpUFRnwh`ixifxz{x|xxxnch}r__kutmeiqpeftzry|vxyxp}~vvzxoo|thm|vrm|fou}|hloq{b^ulYe|ztomtw~{~z}nrge}y``q~}qjo}o^fy}spu}{w~|ucyuyyh]ht`colTRz~OIir[joopSwbb|m}pcybQcywng`\_eooffkpttzyrzzskspwupz~ttw{ymk`Qhnjhfuqdftz|s[`~cuyz~try~hleXjxYMc}|g]gvxpls{yyv{luca{wcfvr[Vox[Uessfcr|jewttx~x|fWqtM[sYn]Ic}PMnolt|z{}wwaeWMm\Nlvai|wflvdrwxwivjdttjotrnqwytpqpnseVmdlqvut{q}wrz|ih|rhny{|li{phzyrmkxhy|||ryouzk`xjpr^_ovpkmt{sgteazsu}zosk~z``wuWOfiOUirijz}nn~}g[py[`{kV`x{l_eztbe{tp~yxhvw}xkt~}ukqjYdspf`as}c\ypn}~{nl~oW_}ibggjwteizvnijuvxwoq_jx~vbmWVkpyww}puzoxqtrtlqbzrlvdg|jnvsllsrpyqlyi|huim_tnbcni]stf~aOq]\{}vwitggr}qwfl}v~}baj`q~mglxcokh{uyvx~t}lxknmmop~yodft}ladt{toij}xk~~vpp{xbfj_cbhry~q^Y]ntX[zn|xz{tur}jsnaoqW`{n\ijbx|ins{~xu~i]ixcdq~wgnzXZg]mzmxu{|omvtnuyx^ek`|}vmm}p{~jusu|w_jzcrswh\~~pxpn{}nfmoglrv}ub_q^Trfquz}|yw|z_lg[{|WW{cSg~{nrwU[qXuyt{}ufmrhxfL_qKZ{{kmjd|{r|km|vqky{r{wtust{ujizwkm}~qmiv|vyvukyxu}tl~xyyjf|znrvuqj_p|psyy{kl~n}xjsdaxk]noUcmj}pqpjzzx|tjtsqzy{yoqpdtinu~fmlnzj}{l|skspajn^fe^cbwpwvz~sxgpbd|nathSj_j|k|yyujqo^fbd|zikxwqwlgwxp||u~u{|~stpt}kfzumo\pw`f}{z~kjuqzvxmysy|kkaawzjoqZeyqwtnwg{zarrlp|v}||ygkm^h|pwwkgzzksy^fl_xwu~}ktW_bRcrUj[SzcKdlxxwl~xyqsqx}}eWj_Uoag~ds|arri|ronfiYy|_que|ooxqnizul{zt{vk{zftsWzeS~yYu}_pl^yf]qm_waQwfWpvhrzp}urtinkqpowp{lZr{RRaQpebh`wlxvyunru`_iv{vrtpb_tne|}}~tz~~tv}~xpnvxtuwwmy~sftnursec{virutwqrlawz`b~pmwzyz{|||yv~x~}~~{~zfri_|o]tzfn|msx{w}rrzgofgl`ggfampz|\Zz`i|}vuserzjitufpwvytxixegyq~|y{~sposk{c^tesqy|ptrw~|pcrvk|[iycz}dxu`{suw]pgb~|w}{vp}qiykl~wtvlp{qgl^uguchqykkvtgnt\fzW\wusyzn}|dijanxlisxnwkkve|mlrvbq|mtvvwrz{uyzrjtrmx~v~r|~~uv~{~{fc}|TRYP}rpyqtn~lnyt{ur{t}~lqbad_kZzop{u}v{i`strvpmt{xs~vmv}wxi|godxywzaXiyuefy}hWjzjow{yv~yllwthits`lvu|wyzzwqypryovl`g|j^o|mip~}}qqqn{i[okZi~kn{{wppsx}}zsglvag}shj|qp{~vt|~|v}|ysptdz~||pwylii\|pf|rtwq}~z~u{sf{ycxsqx~yy~p}rly{rmzpbk}}jfu|vww{z{y}{~wkwq]c}xakh[jzxkdqgly|trz|ohxscmr[_|lZ`r{zplr}wslcaXxxYY|zVTkp_`rxu{rxez}blbYu|bezk\smPdzR_\mvgx|v~ptzgf}_PjiVb~\[y[ndkliyaypi}vkm}udgzqbk{v}}~}x|ig^`osufrbcikjayoPbqnw|{{ry|um{nm{}usvvv|ov|lrpvu{pzu]y}dtjugfii}|{{}~{xrxvs~~wzyr|zb^ugbmuwuojn{yjlwq|{zyvywsuslq|bZn~lfuuyv{|sorl}gb}q^i{|vnw~lsmjqq|qxyuyyyw}ooeejm~uv~{~|y~}spzumx|x{ylwiu}kznr|}suvduuZe[Yxsbqz[ei`pnys~tyuqtvttwy||vkbi}p\czwmgr{dlui|i{vl~j~~gvnr{slt{zxvrmqveg}qg{um|y{|zivuxylxhimbws||tw|x~~}~yy~|{vszsr}tt~~stryly}|xzdq~mp{}xxzxurz{imv[ppUxodvzuuxztwr{~~yrp~ujs|qqxtumy|uhzwbnrmx}qll_vkdq_vvesuh|yfu_dhY{\Yjdk{qfnrq~t{zz~mpthmvwutoozfnruwxtr~uuzwt~}qppqw~swhymncd~ljr~|pozwtxz}tkl}dlqcnrfl||vvy|yx~~wz}qtmizjbzhVg}bfomvsvu~{{zpuuqt}nqu`mt_spn}ur|pz~vxs|m{qssjx|afla|k^gj~u}|z|orlyizyzt~~{wx|ncvxa`zg_usduswuvnm}|ij{xkgo}repwko~yu~|vz|vw~tpoovxl`h|xgivxst|uyuloun\]ntfYZbdbgopgjqsvxw{vslzopkijfa\[ahcZ[clpkdht{~~tkpvrhejqm_WWekbUXly^\wjoy}~{yqmuzo`hviUVhtlb]`nythj|o||}sqxuccy~m`isskdgvyjp}}xtx|tkwycZevwi]ctyokqx~z{ut}}rgl~qdiv|ldqviz~p{|sshifcynhtypz{uzytrtsso~{x~|su~nfpwwz{wwyppztvxryvssdvkapzhclzegehwtz~vtrotvh`irpg`eu~man{jxq~rzbopYc~fQaspc^blmilu~ot~}u~swl_laZt_NgiTrogjuxnwzyzvyq`kzbYkdPXs{ghszsx~w{~rv~yrxzojn}~mtcwkutl~skzz}~xxrfjmouvsqqtqomqrsyhp{fix|naask_nxlx}yrnv{ussv}whjx}pem{ok{z{~tr~fg|uccmtztmjp}lfq}s}}|}vzhmzyvtkdm}zik}{x{zyw~yvtu{kpyjlx}zoerqar}uusyolkn}xxutvzuqxvp~||ztz|~fj{nq|zohlqoolu|wry~nsxpyzzxphn|~vh[`{m[e}{dqqf|qsugfygdpyvohn}yjis}~xuz|{|zw{z\VstTMd~|dWg{wlhm}}nwwbhyzl]bqrj\Wk{a[ukby{zo}ks|mxss~}}~vjjzneqsem|wqrsw{}|y~~}opprham{~riks|}rlkuol{xrutgnptzt^Vn~o\Zhx`i||z|{mjws`]k|mX^t|nknzpuzx}sqwdi~vb^ouYZw}olq}p}}}sl}sm~vokgnxww{y{~zqwxnt|wzylq~znlz}f`{mcx{nwy~{{pqyigptnjjpxyppvurt{{~y}yuzzg_q{h\cq}wd`uin|~~}urx}uho}nqwnqwzwosw{|}|y~unzp~zxyv~sxqq|~np~xjmrrrqps~{}{}~{~|s_reh|ohy{cc{|oozw{}o{z{y||wpztryty}kvqq|pz{{~~~}wx||wqzpnqes}uwtwv~~}tyunv~~ujq~wjtrahtr~|kvoxwosxhetnl{}rtz|zv{yzxjalwqnty{kpxt~~y|s`myhmq]j~idx{evyrylqy}swxlutq|wxtuyo{{z}mu{xyx~|}z{yr|zjhpvwrhlsxvzt}|qsvnq||odlrqlqvst~ytuupelw~ymivxjfrzox~|z}wjcoztkkoleerxwxx{tetqcjwwmjrzzrs~|uuuv{v~~ywxvrlosq{~w|yt{{joogxu{|u|z{ytnyq_gyxmntzy{xpw}vy}yy}~j]oxioyqpsx{{}zw~~njymbti_n|tijt~}w}~{s}rry{rdjsunio~ul{zvzvx|sv~}njxrilw{qwzqtztvuxlvjiqfy|quqpnptnztmsgoclipttztwrwqzujv}vtrty{}~||}|qtr\kmi}skv}t|xu~rupylnlfwnfqphqzmtun~p{{|pyzsru~khsvspqtx|xrpx~~|utgjnpiacu~kbxx{z~}|suufivwoo}rkm|{ly~w}{|s{w{|zszw{v}|txom}cl~nmmq|v}v}tsvpqsx{phpxunu~qp~y}vt|rtuu}|stzqgs{tu|}z|~om{{ppv{}zojzkdoz}xw~r{{pp||ii||wxyuvqxn~z|}v}}x|v{z|~w~{~uyvxw{}wywyxwvz}tw}~xpw{xt|s~}rwzyvy}x{{{}{t}}|xwz~xv}}y}~z|ut~~yz~|}y}|zv|~xn{or}w{wqywlwxu}z}{~vu~~{vmowzvrwz|~|zz{z}pnz}vppy}ztpzyvztr|ux|~{jjnavqpwpvt}}}yvyu{ywsi{zty}t|~z~wuzsxxsqqv~zpy~u~yxqmwpoom|}w~z~zyxpo~qvyv~|tx}~|}sxml~}kouowtwv~{r}un}vutx{}vqzvx~}~|~}}}zuz|tyztswtv~}xx|}xrzyovxsvtsxp}t}y|wqy}}umwvlxqs|y|}}y~wozzy{~|qr|u|}}{v}vuysw~|{~sr~x|mx~vxxx~{~}}}wvxqvrrtixy{}|y|utts~upu|n~xq~~{z|zxt{vvpyxx~}uqr|y}vunvqx}||zuy||vyvxzrvuwv~}~~x}||}w{~~~ws{zz|{~swy|ptwrvz}|}z{}w}zsvrszs}zv{yz{z|~||~z}w~y|{yv}{z|wzyr|vv|xu{~ry{z~yy}{~~~}y}{{{wu~ruxt{vy{|x~uvp{to|}}x}|~{}~}{}}zx}z|vx~x~y~xu}v{|}z~{xzx|w~{}x}~{~}}y{yu}~zy}~t{{{yrxy{zy{|}zz}{}z{~~}z||{~|{}z||~{zt~~{xy~w|w|{{|~|~||xz}y|{}vu}|vwuy|{|wtxxw~~|}|y||~y{{wvw}}yw~s~zroyyzzz}u~~|}{||~{v}}zw{~y|zywus~}||v|~z~}~zzzz|u}||{}~}}u{xz~|~pzx{|w}{z~ywy~zy|xzxw~|urrz~|u}u}xwwyxyx}~{u}~v~nq{t~szly~}~}|~|~{}vqwo{twv|zpy~qszx~{}}yx|{tq}y}~y~qyuu|y~{y~}uw|w~z}~ux{||}}|z|~~z{~u~t|vwxt}}y~vy|zz|}x{|{oxyw{uy}}}zw}{~}x~}w|zzv}yyv||vxwv}}v~y~{y|xx|}}{zvt|~}x}y|~x{}vz}}z~yx{uvx|y~{zxt{}z}yz~~r|x~~z}ts~}{q|{}|{x{|ww~~|y{~u{t}x~zw|{}ryy|stz{}w~|||z~}~|xwyx}}~yzx~~|zw~~{yw~y~~}yz{~}{|~~}~~}~~|{zyz{||}~{~|~~s~z{}~{}||{|~z|y|~y~}z}|~||~|~~{u~x{{~}~}wyw}yz~{{{|w}x||~~po~~|zww}}wq~{}vxw}z|{x|}}}y{~y{}u}}zu~|~||z{y}{yxx|}{{|~{~}}~u{z}t{{y||~}}z{~}~{{~{vyu~z|zy~~{x~|}||}}}|zv|}~{{~~v~z~}x{yyz}}~z}|~~u}||vxx|uyy{z}xt{~|~zz|w{}t|{w~~zoyyz||xz~~~~yuy~x~vwy|wy~ox~ty|x|w{||w|~}|zs~}yyvys{zx{{~y~x}y~y||v~}}~zx|y}v~|}|}}zz}v{y{|}y|}~rz|{ryu}~~~~|x||yy|~tyzotxyuyxxu{ru|u}owxpryn}vx|{~y}px~v}}||u}w|{~~sy{z~{~xx~~|{z~|~~}w{}|z}~u}vy}zqxp~}yt{u}~}~{~|{~{uy|vwu|ntuyp}wsvx}}w~y~}~upz~zryn}}ntxo}rpwszv~yxvvzxyy~suvt~yy{uz{|{t}~|v}|~q{}z~~tyx}{wxw}v}zv~szzyvzy|}{~}~~}|{|~~~{}~y|~~|}~~~}}~~~z~}{yz}}}}}{z~{|yz~z~xz~}z{}}~|y~}~zz}z{||}|~wz}wz{q}zqwu{tty|r|w}|v~|~|}{}yv~vv{}v~}y~y|~|~{}~~|}|~wu}~}~~|xz~}}}}~~xw{||~|w|{z{y|~{~zyv~x~z~~{w~uz{|{w}}|{w|y~~{}~wy}{s{~}|s|{|~z||z{|z}}z~{|zx~}yy|yz}z~~y~~x}|z|}zxz~y|}yz~{}{|yv{~~y{z~{y|{|{}{~}}~~}z|~|~|z~|zwz}z|~}wy|u{{||xzx{}~}~}~}{}{~~zu~{|}}|~wy}}||z|}~z}|{~y~zx|z~|x~z}{|}||~~x~~}}yw|uvyz{{~{z~zzyywyzx~vzx}v|y{~}xz~~|{|wwvx~{~~v~zww{{y|}}~~~{}{zz~|~{zwz}{~{z}}~{~||y}}{}}}|~|}z~|{~||~~}||~~||{|}|y|}}~zz{z{y|{y|{}|yz|~{}||~z}z|{~v|}zxx{~w~|~~z~yz|||xz|{~{uuww{xy{}}vx{~~vx~v~{|~|z~|}~~~{|}y}~}|yz}}x|zv|{~zu}|~vw{}zs~x|t~|z{~z{v~{~~w|{}{zsz~|}}}~|yy}~{{|{~}zy}yu}|y|}~}~~~z|{~}|||~|wt||}{y}{~zz{y~z|~~z}}x~}~}x}|~~~|}zy|~|}|~~~z}~}|~||~}~~z{~~~}}||||~|z~{{}~{{|~w{z}z|z||{~x~vv}{}~ut}|t{w~|z~y|}~x{{yz~zw{yvu|{tz}{u~}{yw|}{|y{}}~yw{~~{||xzxywy{zv~y~~zz~~~~{vz{{}zy|~||~}~{z}}}}}|}||~|~~~|}}}z}~~}yz{{|z}|z{}~}z|z~~~{~~~~~w|~{}xz}{}zz|xyz}|}~}}{~vv|xz~{~~||~~|y|{z{xx|{~z|~}~~|z|~}~~~|y|~}x{~zx~yy|~}wv{|z~~~z|~{z~vw~{~}{|{}z~~y}~|}~|}|ut}wz}y}}~w}|w~tqv}}xv}utz||~xwx~z|wux}~{~{zwsz|zz|zx{y||~yv|}|yz{z~}~}{xuy~{zv|~|~~{z{}~}}}y{}||{{x~}z|}x|||~}|zz~||~}|~}|wv|~~~{~z{}xx~~~~|{}}|~|~{}{~~}}}}}x|~~~|y{~}{}|z{{~yz~~|z}{z}~{w}~|}|{~~}z{~}yyz{|y{|~}}{|z}~z{~~|{|zy}~}~|~}~~~}~}~~}~~~~~~{~{x{}}~||~{z{{}}~~~{{|||~~~~}{zz{}|}{zyxz~~~}z{~{{z||}|yw{|}{~~xx{~xru}~{}|{}zwz}{{zxx{{wy~yz}}{yvz}}{z}}{~~~{{}~~|x{~~{{}~~{y|~zy{}~}z{~~~zx~|yz}|{z~}}}zdd2-0.2.2/src/data/efx5.wav0000644000175000017500000007753407636076510015110 0ustar reidracreidracRIFFTWAVEfmt DDdata0tﴙ|TB+' !!!!""$"6MCEDQ`qorZ6(=eڦnvʿ~\;7EC(   +:HLAShtdscZg}wjN7K{z|ndbzsgn~rb~zhzolnjWDRd]Rcfk~lipdclxi]Rbck~saaqg]SSVOOgugzvoUPNLHE>ICds|_h}XMgyjq{qvwrv~v`k}vFFF>3eg\LM`rsL-1A_kY80MkvuTWWunbV^wytN27>UZH<*1AHRM=GI[qqhrenVFNVV9)'(7=?BFWdl~wzorx``\cg]^SACC>+(#,!%&'%$#)/"$$+-6;433413;2668DHGEIO]YUGKLNMJ=0)#(&   #(!#*-6#&%13323( &0(%%333/.94FD1*%9%%'( &0&99E>;9CE]WOL@VYPQC6599P-5!A7I0 +2ILE@AIK^Ze^ZZVhl`cX^`WSJ9?HJG9@K<:+ /'07BNWdȽ|nZ^LFKBFFN\qƴz|oX^m|uicvulsy~dZKRXSK/%).81'3+/    ,.226;JZQVFQNSYF<1384'$  (0BC1IOE>9DPPHA5863/"   !!!!"""####$$$$%%%%&&&&''''((+SXgl{ȷµwuzwusv{r~ŷwgYVQ]\UUO[jo|uyxuϽ|ս}klprr{{ȼԸrcgaZ\XQMOX[XNA49<6' !-+16DMOYPIHGG9.+ "*<8@GWhp~rhabKA/  2FSeqx˾kd\gjb]QVYepilkrxtvǿþɿ¼tƹɽ»÷{gnwzrmtzȿ{xtokbZXY`dficddlsje^ZYTNG:830/',%!#"$" !   !$'#&'&.-)#  +3479>B@95-*'  ",>IVet}rq{tqc]_YgY[SP[YdYWTVihtpr}{tqlmlnoqv~wvu}{pmkuzzzuvurpjb[WSXZ\UPQT\a`[[ajmqnkorzzvpkkpsssmlmnwsrfejlrfc[[gfdXQQOZRPIHOLPJ@BEMSZ_^fmtº½¿ÿzzusxv}}||pxmmiaa[aYUURQDLABI=A=CGDJ?JMQVQYT\_Z_Z^Y_`Y\U]^bebggotvrmmlpqea[]^_ZRNHJOOQNRW_fhhiou{}yywywsjfhfdc]_bhpuz~}ypjaOH<94,"  #"&"  "'38;KQb`jlixx|~{z|xztrwoqiigfmhkkimhmfjiff_d]__[[Ybacf^b`cgggd`d`YWVZVURS[[]YWYa__YV[W\\U[Y[[XXRNJKNHB81752/))-/042..06<>6' !-0563,+.*,,'#(-((&'+%% "%)&-//1.'&*/0446>EOU\bgqzżwuvsn`]USQD;,"%(/38ENXXXWNOHB7'  &#,+8=?LN^elwx²r^H7 (5;==ABEGEHKQX`hov¶ͻƾüĿľĺzxrtpvyzÿþľ}}|{}xxsqkb^[_a`ddmsz|tpnpj`XRVY_]Z^blswv|zo\QD;1'"%2>DP]n{yria]VJFCDIGJKPTVZ[]_ce`^WTQJE;9/,&$# %)(.2;?=?:???963+*$#$     '%*&)+(+))*)'#%%%& !"$&%#$"% (1:EKUZfox~»}sie^YPJ>6,!  !!$$"   '+4=FLT\ekopquvyyyyz{|~|~||~~}xtuvwwyystnroiifovľztnmoonmorz{~uokhabaaekpu|ļ~|zx||º|uric[VPI>5,&)2:DMSZX[[^]][XTOQMOKFEAB@=97:;=>?@EKNUY_eltx~||}}|tqknlib[VPI>71+)&%$&$&),39>DNXaiow~}vsuvyüwsple]YYWXTUVY\airx{}~|}zxtssuy}{tspja][_fhkpuĽü}wtruy{¿~zxwx{~~~~|zxricacaYQLORSOLMQUVWV[aejpvzyqhbZQH<61+( &+-+.7=CEHNU[`fgjikkkjebbdfdbabeiknsw{yuqpqppnmpppnkjjjkigecdc`^[WVSRRMLKLOKIGJNVWY\ainqtvz~wqjaZTQKD<7863,'+25894+"%,7DO[bkqy~~~yvrpojjkllru|}wpjb[TOJFB@?@>;>=@>=@EINPSY]bdfjmqswz~xqhc^WOKGFE@>==AGLOUZahknruy~|yuuvttqoopmlhghijklllmmmjhjloqrux{vlgggifgiloqru{wodZXUQMC@BDFHHQW_fkqv{xpkgfb^]]bdginqx{~~|{wttuw{}}sle]WNJEDFIIMMSZ`efipw}~|yvsolkjljgeeijjiknsuxy{~~zxsljgd_WQPOMHCECHIKORV\`fjlpty}}~}yvtnib\WPHA<761-+,-///48ACGKQX[agkqtvy|yvspmic\YUSLGEDDEEGJMQWZ\beggddfeca`]ZYWSPPSTTW\]]ckkjlrtrprxzxy}~}{~~wtusomliea``^XTSSTTUVY\addeimpqtvwxxxwtrqppnllkklkihjklkllooomjgge`\XWVUQONNNOOQSUY\^behlnopopqomllmmigfffecbcdffddfghhhijknpprtvwvwz{}~}{|{wttrswvtstwz{}toklro\XZZ_YMNXZ^ZO[_\b`alomuut{z|yy{uz}wu|xuw}uuuwyrpstvvqrxwvwsx{uvyxzywzxvywsusrutttrruuspnqxvrrsx|zxz{~|~|ywy{yxxwyyyxxvxxyzyxz|}}{y{}}{yyz|{yxxz{{yyz||{yywutrsssrqqpomlkhhfffecbbbc__abddcdghfeffiiiiimoooopqruwwwyz~}z{{ywtpoomjhfeb``^]\]^`a``bfghhjlquuuvz|xrmiea^YWUTTTTTTUX[\]_djnoprvzzzz{|}|}~}}{{{zxwwxxwvvvvusqrrppoopnlkkjieddcccdghhhikmlkklnpnnnprrrrtuwz{}~~~{xussrpnjjkliggfghgecdfgfdcehjjknrvy{~{vrqpmfdccdcacfinqtx}~{zzxvusrqopqrrtux|}~~}yusqokdba_\WSQPMIHGHIHKNPSTW\_abfjmllkljica_^]ZVUTPMIGFEBBABB??A@A@@CEFGHIJJIIHFGFEFGGFEFIIJKJMSVWY[^bcdfhlkiilnnkilmlkhhhfghefgeeddda`aa_^^^_]\\\]^^`dfjnoottsrnmliiidcddda]]]ZXWVXYWYXY\\Z\]_^^_aa^]]]\[Z[[\[\^_abbfijnpswyy{~~zwusolkllkkmpstruy{~~}|zwusrrnllnoonoqsrrrqrpnnnnmihhjiifehjijkknrstvwz{}}zyywvtppnljihhgfghfb`^]\VTRTTSPNPPPONPSUXZ[^`acdefghklkkjkjfccbccaabbcbabaaa`````bcehjmoorutrokmje`ZXYTMF@=:3-+'()&)+*/04<>AJQX^`dknmpprusttqrrpnmmnmmnoqstvz{~~}|wvtsqmklmopprw{~zuqomhfcbcccfhjnrvz}{yvtttuvy|~}}~|zwuqnmmmmnortuwy|}zvtsqommlmnnpruwy|~}~~}}||z{{||}}~}|{zwvvtrpqqrqqssvwww{}~{|ysqmllhc`__b_]]_`a_]]_bcbbeghgefhjjjlosvxxz|~~~{{zwsnkigeb`^^\[ZVVWWVVUWXXWUSSRONMKKLKJHFGIHFFHKLMMNQSUUUWWYZYXZ[ZYYXZZXWWWVTTTTTUWXXYZ[[[XXXWVURQQPOLJKKKJIIKMKJJKKKKMMOPRSTVUWXXYZ[\_aaaabcddddegfedca`^\[YXXXXWUVXXXUUWWWUPQRPLJHJHFEDDFC@A>=>:76420+)(%&&&&'')-//26;>?AFILLLMONKKJHGGFC@AA><<<>??ACCDHJKKLOQOPPNONLJKLKKIHIIIIKJMOPSSTWYZ\`bcbfkkijjlllmpnosuvwz}~{vtsuqmnppqonquvwyz~|yyvusomljjkjklotvxz}~~{xtuvuvwz~}}|||zxwvtqonlkigedbb`_a`_aa__^_a_\[[\ZVUTSQNKJKIFEGGHFEDFGGGGGHIIJIIJJKJHGHGGFEEHIHGGHHGFDFHIIKLNPRRRSVYZ[\^`bbbbcdefffhiihgghijjjkmnnmmlnonnnpqrqponnmkjjjklkjjjlmllmnooppqrsstuvvvuvwvvvutttuussttsrssrrrqqpoonnlllllmmllmmmnoqstuvwxzz|}~||{{{yyxxyyxy|~~}{yxxxwvvuwwvvwyz{||}}}}|}}}~~~~~}}||||{zz|}|||}}}|||{{z{{{zzzzzzzyyyyzyyxxxxwvvwwxxxyzzzzz{|{{|{{{yxyxxxvvwwyyxxz{{{{|~~~~~~~~~}|~}}|{{~|~~}zwtrqpnmkkkigfgghiknoqssuuvwwyz{||}~}}}~~}}|}~~||||}}|{|}~~}|}}zxtqnkkjfca_^][\]`ceiloqsvxz|~|{{yvtssrqqqqqpoopoooopppppprrrrsuutsssrqrttttwyyz{{|~~~}}{yywvtuuuvvuvxyzyyz{{}}|}}~~~~~|}~}|}~}}|}~~~}~}}}|||{||}~~}{yyyyyyyyyyyyz{|~~}||||{||}}}~|{{{{zxwvvuttuvwyyz{{||}~}|{zywvuutsssttstttttttuuuvwvvvuuvwwwwxyzzyyz||{{{{|}}}|{{{zyzyz{zz||{||}~~~~}}|||{{~~}{yxvusqpnlkjihihihiikklllmoooppqrpoonnmllkkkkkkkkllmmnopqqqrsrqppqponnonnnnnnnnmnnnonoppprssssttuvxy{}~~|{xtrpomiecaa__^`bcccdeghhilnqrrrsssrppqrrqqqqpnlkklllllnnmkkkllkklmnmkkkkjjjkllllllllmmmnooopoopoopqrrqqstsstttsstvutuvuuvxyxyy{{zz|}|zzzyzywvxzzz{|}~~}}}|zzz{{{z{||{zzzyyyyyyxxwvusssrqqrrsrrrrssstuuvvwxwwwxvvuvwuttsssqqrqrqopoonnnopopprrssttuuuxy}}|||{wnkjigc_^^\XUQQPPQRTW[^_abcfhikmpssrrrrqpnnpppnmmmlkjjklmmmmmnnnnmnoppqppqpnllnnmkkkllkklmnopqrsuvvvwz{zz|~~{|}||||||~~||}~~}~~~~}}~~}}}~~~~~}}|{z{zzzzzzzz{{||||}||||||{{zzyxwvuutssstsrsuvvvxzz|||||}}|{{||{z{|{zyyzzz{{|||{yy{zxxxwwwutssssrpqqponllkjjhghfeedcccaabbbbaabbaaaa``_^]]\[ZYXXWWVUSSSRQQQQPOONMLLLKJKLLKJKLKJJIJJKJIHHIIHHHJKJJJLMMNOOPRSTTUVWWWXXYZ[\]^^`babcdffffgghgghhhijjklmnnnoprrsstuutvvvwwwxxyyzzzz{{{{{{{{{{z{{zzyxxwvvtttsrqqqponmmmmmmmmmmlklllkkklllmmmnnoppqrsstuuvvwwxwxxxxxyzzyyzzzyyzzz{||}~~}~~~~|||{zyyy{{|~~~~}||{z{{{{{|}~~~~~~~~~~~~}|{zzxwxwvvuuvuuvvvxxxyxxyzyzzz{{zzzyyyxxyyxxxyzyyzzzzz{{zz{{{{{|}|{{{{{{zyzzzzzyzzzz{{{|}~~~~~~}}}}}||}}}}}}}~~~~}|||||||}}~~~~~}}}}}}~~~~~~~~~}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~}{{{xwvuuuttuvvwwxz{||}~~}~~~~}~~~}{{zyxvwwwvvvwxwxyz{}~~~}||{zzzzyyyyyxxxxxxxxyyyzzz{{|||}}~~~~~~~~~}}|}|||||{{||||{||||{{{{{{{|||||||}||}~~~~~~~~~~~~~~~}}~~~~}}|||{{{{{{zz{zzzz{||||}~~~~~~~~}}}}||||||||}}}}}~~~}||zzyxwwvvuvvvvvwxyyz{||}~~~~||||||{{{{zzzzyzzz{{{z{{{{{{{{{{{{{{{yxyzzzzz{||||}}~~~~~~}||||{{{{{{{{{{{{|||}}}}~~~~~~~~~}}}||}||||{|||}}|}}}~~}~~~~~~~~~~~~~~~~}}}}}|||{{{zzzyyyxxxxwwwwxxwwxxxxxyyzzz{{z{{{||||||||||{{{{{z{zzzzzzyyyzzzyyzzyyyyzzyyzzzzzzzzzzzzzzzzyyzyyyyyyyyyyzyyyyyxxxxxxxxxyyyxxxxxxxxyyyzzz{{{{{{||}~}}}}}}~~~~~~}|||{{|{{{{zzzzzzz{{{zzzzzzyzzzz{zz{{{{||}}}}}}}||}}}|||{{{zzzzzzyyyyyyyyzyzzzzzzzzzzzzzzzzzzzzzz{zzzzz{{{{{zzzzzzzzyyzzzzzz{{{||}}}}}}}}|||{{|{{zz{{{{{||}||}~~~~~~~}|}}}}}||}}}~~~~~||{zzzxyxwvvvvvuvvwwwwwwwvwvvwwvvvwwwvvwxxxxxyzyyyzz{zzz{{{zzzzzzyyyyyyxxyyyxxyzyyyzzzyyz{{{{||||||}~~~}}|{{yxwxwwwvwxxxyyz{|}~~~~}}|{{zzzyyyyyyyyyyyyyyyyzyyyyz{zz{{{{{{|||}}||}}|{{||{{zzzyxxxwwxxwxxyyxyzzzzzz{{{{{z{{{{zz{{yyzzzzzz{{{||{||||||}}||}}}}|||{{{{{{{{{{z{{{{{z|||}}}}}}}}}}~~~}}|||||{{{{{zzzzzyyxxwvvvuututtttttttuutuuvvvvwwwwxxxxxxxwwwwvuvwwvuwwwvvwxwwxxxxxxyzyz{zzz{zyyyz{|{|}~}}~~||}}~~}}}}||||||}~~}}}~~}}}~~~}}~~~~~~~|||}|{zz{{{zz{|||{{|}|{{{}~}}}|~~}}}}~~~~~~~~~~}}}|{{z{{zzzzzzzzzz{{{{{{|||||||||{||{{{zzzzzzzzzzzzz{{{zz{{{{{{||||{z{{{{{|}}|{{|||{|}}}}}}}}}|{{zzzyzzzzz{{{zzyyzzyzz{|||||}}|}}}|}}}}|}}}|}}||}~}}|~~~~~~~~~~~~~}~~~~~~~~~~~~~~~}~~~~~~~~}~}}~}}~~~~~~~~~~}}|}}||||{|{||||||}}|}}}}}}}}}}}||}}||||}}||}}}|||}}}}}}}}}|||}}||}|}|||||||{|||}}|}}}}}}}}}~}}~~~}~}}}}}}}}}}~}}~~~}}}}||{zzyyxxwvvvuuuuvvvwwwxxxyyyyzzzzzzyyyyyyyyyyyyyyxxxxxxxxxwwxxxxxxxxxxxxyxxyyxxyyyyyzyyyz{{{{{{{{{{{|{{{zzzzyzz{{{{{||||}~}}}~~~~~~}}}~~~~~~~}}}~~}}~~}}~~}}~~~~~~~~~~~~~~}||{{zzzyyyyxyyyyzzzz|||}}~~~~~~~~~}}}~~~~~~~~~~~~~~~~~~~~~~}}~}}}}}}~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}||||||||{||{{|||||||}}}}}}}}}}}}}}}}}}}}}||}}}}|}}}}}|}}|}}}}}}}}}~}}}~}}}}~~~~~~~~~~~~~~}}}}}}||}}}}}}}}}}}}~~~~~~~}}}}}}}}|||||||||||||||}}}}}~~~~~~~~~~}}}}||||{||{{{{{{|||||||}|}}}}}}}~~~}}}}}}}}}~}}}}~}}}}}}}~}}}}}}}}|||||}}}}}}}~~}}}~~~~~~~~~~~~~~~~~~~~~~~}}}}|{zz{zzyyyzzyyyzzzzz{|||||}~~}~~~~~~~~~~~}}~~}}}}}~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~}}}}}}|||||}}|||}|||}|||||||||||||}}}}}}~~~~~~~~~~~~~~~}}}~~~~~~~~~~~~~~~~~}~}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}~~~~}}~~~~~~~~}~~~~~}~~}}}}}~}}}}}~~~}~~~~~~~~~~~~~~~~~~~~~}}~}}}}}}|||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{||||||||||||||||}}}||}~~~}}~~~~~~~~~~~~}}}}}}}}}}}}}}}}}||||||{||{{{||||||}}}}}}~~~~}}}}}}}}}||||||||||||||||||}}}}}}}}}}}}}}~~}}}}}}}}}}}}~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}|||}|||||}}}}}}}}}}}~~}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~}}}}}|||||||||||||}}}}}~~}~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}~~~}}}}}}}}}}}}}~~}}}}~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dd2-0.2.2/src/data/efx6.wav0000644000175000017500000000553207636076510015076 0ustar reidracreidracRIFFR WAVEfmt "V"Vfact" data" yxqszw}rv|ttoxxp~trtx{y}k~r|~yp{txw{px|qmz|}yrw|{trtyvuvz|qx{}yxnt}su|uz}qmvztv}sq|~}}~{so||u~srsy~umnv|yuw}{st}~ytuy}xw~ssx}vxxzvx}||y|v|~trzwy}|t{||}xmop{~quk{wx{q{~|}s|uzwslzu{x{sjur{|pvps|x}}zylkss{~~wotzv{z~ulquwzwsnox|{}|~}xuuvv{}urnloz~zvtyzurrrty}vpnptw{ytsty|ywwyzvtv{~zyxxxz{}~umhgls|zwronnqu~vnijmu}|yvuuvy}xspqtz}~~~|{y|~zww{|~~}zzzzz{~~{yxxz}}~{{|}~~|ywvuvwwz~~{{|{zz{|}}|}~~||~~~|zzzyz|xspnnpt{ysopsw}wqlkovzrmjknrx|zyxyzz{|}}{zyyz|~yuqonosx~xspprv{}xtpoprw}}yvuttuuvwy|ztollpu}}wttw}wroosx~}yvtssvz~zy{yrnmnrwzupmjknt}ysqrw|}ywvwz~~voieeiq||{zzzyyxutvy}}zyz~{rljjntyxoihkqy~zz|~}|xtpnns|yttwz}}||~|{vnklrx~ytsw{snlmrvyz{{}xrqt||tommooppsyysrv|~xtrsw{}}}~}rmnruxyz|{}zxyyyxwvyvpqxzpihny~|qgadnz}ww~{qmnruwwx||zzyvrmkmw{}zqns}yzukhlrvuw|}~}romonmpvvru}uusxvxwx~ruqpqpsuqrx{|qilyxttz|~zsqptxxwuxy}}ywwz}{vpow|xyzx{qquqnu{zuoy{u{tt~xz{|y|xdepq{quoum~w~}u{uzvqky{{tslvz~}vn{u|uxwows~zznywzypt}tzp{kdqq~~vq}sxov~txv~ur|{ztswt}nqtwxtz~{tpnlxp|~{}zmmzyopmv~xmbfuzzt|~}}|}zuyzoz{{}tiqw~yzy|z}{~yxxmhct{xxu|}y}qv}{mnwq}tnitx~urkr|u|twxtvutuuwsruu|r~z|~yu|potwzxz{|}}{qtrzrt|dd2-0.2.2/src/data/efx7.wav0000644000175000017500000007755207636076510015112 0ustar reidracreidracRIFFbWAVEfmt "V"Vfact0data0tﴙ|TB+' !!!!""$"6MCEDQ`qorZ6(=eڦnvʿ~\;7EC(   +:HLAShtdscZg}wjN7K{z|ndbzsgn~rb~zhzolnjWDRd]Rcfk~lipdclxi]Rbck~saaqg]SSVOOgugzvoUPNLHE>ICds|_h}XMgyjq{qvwrv~v`k}vFFF>3eg\LM`rsL-1A_kY80MkvuTWWunbV^wytN27>UZH<*1AHRM=GI[qqhrenVFNVV9)'(7=?BFWdl~wzorx``\cg]^SACC>+(#,!%&'%$#)/"$$+-6;433413;2668DHGEIO]YUGKLNMJ=0)#(&   #(!#*-6#&%13323( &0(%%333/.94FD1*%9%%'( &0&99E>;9CE]WOL@VYPQC6599P-5!A7I0 +2ILE@AIK^Ze^ZZVhl`cX^`WSJ9?HJG9@K<:+ /'07BNWdȽ|nZ^LFKBFFN\qƴz|oX^m|uicvulsy~dZKRXSK/%).81'3+/    ,.226;JZQVFQNSYF<1384'$  (0BC1IOE>9DPPHA5863/"   !!!!"""####$$$$%%%%&&&&''''((+SXgl{ȷµwuzwusv{r~ŷwgYVQ]\UUO[jo|uyxuϽ|ս}klprr{{ȼԸrcgaZ\XQMOX[XNA49<6' !-+16DMOYPIHGG9.+ "*<8@GWhp~rhabKA/  2FSeqx˾kd\gjb]QVYepilkrxtvǿþɿ¼tƹɽ»÷{gnwzrmtzȿ{xtokbZXY`dficddlsje^ZYTNG:830/',%!#"$" !   !$'#&'&.-)#  +3479>B@95-*'  ",>IVet}rq{tqc]_YgY[SP[YdYWTVihtpr}{tqlmlnoqv~wvu}{pmkuzzzuvurpjb[WSXZ\UPQT\a`[[ajmqnkorzzvpkkpsssmlmnwsrfejlrfc[[gfdXQQOZRPIHOLPJ@BEMSZ_^fmtº½¿ÿzzusxv}}||pxmmiaa[aYUURQDLABI=A=CGDJ?JMQVQYT\_Z_Z^Y_`Y\U]^bebggotvrmmlpqea[]^_ZRNHJOOQNRW_fhhiou{}yywywsjfhfdc]_bhpuz~}ypjaOH<94,"  #"&"  "'38;KQb`jlixx|~{z|xztrwoqiigfmhkkimhmfjiff_d]__[[Ybacf^b`cgggd`d`YWVZVURS[[]YWYa__YV[W\\U[Y[[XXRNJKNHB81752/))-/042..06<>6' !-0563,+.*,,'#(-((&'+%% "%)&-//1.'&*/0446>EOU\bgqzżwuvsn`]USQD;,"%(/38ENXXXWNOHB7'  &#,+8=?LN^elwx²r^H7 (5;==ABEGEHKQX`hov¶ͻƾüĿľĺzxrtpvyzÿþľ}}|{}xxsqkb^[_a`ddmsz|tpnpj`XRVY_]Z^blswv|zo\QD;1'"%2>DP]n{yria]VJFCDIGJKPTVZ[]_ce`^WTQJE;9/,&$# %)(.2;?=?:???963+*$#$     '%*&)+(+))*)'#%%%& !"$&%#$"% (1:EKUZfox~»}sie^YPJ>6,!  !!$$"   '+4=FLT\ekopquvyyyyz{|~|~||~~}xtuvwwyystnroiifovľztnmoonmorz{~uokhabaaekpu|ļ~|zx||º|uric[VPI>5,&)2:DMSZX[[^]][XTOQMOKFEAB@=97:;=>?@EKNUY_eltx~||}}|tqknlib[VPI>71+)&%$&$&),39>DNXaiow~}vsuvyüwsple]YYWXTUVY\airx{}~|}zxtssuy}{tspja][_fhkpuĽü}wtruy{¿~zxwx{~~~~|zxricacaYQLORSOLMQUVWV[aejpvzyqhbZQH<61+( &+-+.7=CEHNU[`fgjikkkjebbdfdbabeiknsw{yuqpqppnmpppnkjjjkigecdc`^[WVSRRMLKLOKIGJNVWY\ainqtvz~wqjaZTQKD<7863,'+25894+"%,7DO[bkqy~~~yvrpojjkllru|}wpjb[TOJFB@?@>;>=@>=@EINPSY]bdfjmqswz~xqhc^WOKGFE@>==AGLOUZahknruy~|yuuvttqoopmlhghijklllmmmjhjloqrux{vlgggifgiloqru{wodZXUQMC@BDFHHQW_fkqv{xpkgfb^]]bdginqx{~~|{wttuw{}}sle]WNJEDFIIMMSZ`efipw}~|yvsolkjljgeeijjiknsuxy{~~zxsljgd_WQPOMHCECHIKORV\`fjlpty}}~}yvtnib\WPHA<761-+,-///48ACGKQX[agkqtvy|yvspmic\YUSLGEDDEEGJMQWZ\beggddfeca`]ZYWSPPSTTW\]]ckkjlrtrprxzxy}~}{~~wtusomliea``^XTSSTTUVY\addeimpqtvwxxxwtrqppnllkklkihjklkllooomjgge`\XWVUQONNNOOQSUY\^behlnopopqomllmmigfffecbcdffddfghhhijknpprtvwvwz{}~}{|{wttrswvtstwz{}toklro\XZZ_YMNXZ^ZO[_\b`alomuut{z|yy{uz}wu|xuw}uuuwyrpstvvqrxwvwsx{uvyxzywzxvywsusrutttrruuspnqxvrrsx|zxz{~|~|ywy{yxxwyyyxxvxxyzyxz|}}{y{}}{yyz|{yxxz{{yyz||{yywutrsssrqqpomlkhhfffecbbbc__abddcdghfeffiiiiimoooopqruwwwyz~}z{{ywtpoomjhfeb``^]\]^`a``bfghhjlquuuvz|xrmiea^YWUTTTTTTUX[\]_djnoprvzzzz{|}|}~}}{{{zxwwxxwvvvvusqrrppoopnlkkjieddcccdghhhikmlkklnpnnnprrrrtuwz{}~~~{xussrpnjjkliggfghgecdfgfdcehjjknrvy{~{vrqpmfdccdcacfinqtx}~{zzxvusrqopqrrtux|}~~}yusqokdba_\WSQPMIHGHIHKNPSTW\_abfjmllkljica_^]ZVUTPMIGFEBBABB??A@A@@CEFGHIJJIIHFGFEFGGFEFIIJKJMSVWY[^bcdfhlkiilnnkilmlkhhhfghefgeeddda`aa_^^^_]\\\]^^`dfjnoottsrnmliiidcddda]]]ZXWVXYWYXY\\Z\]_^^_aa^]]]\[Z[[\[\^_abbfijnpswyy{~~zwusolkllkkmpstruy{~~}|zwusrrnllnoonoqsrrrqrpnnnnmihhjiifehjijkknrstvwz{}}zyywvtppnljihhgfghfb`^]\VTRTTSPNPPPONPSUXZ[^`acdefghklkkjkjfccbccaabbcbabaaa`````bcehjmoorutrokmje`ZXYTMF@=:3-+'()&)+*/04<>AJQX^`dknmpprusttqrrpnmmnmmnoqstvz{~~}|wvtsqmklmopprw{~zuqomhfcbcccfhjnrvz}{yvtttuvy|~}}~|zwuqnmmmmnortuwy|}zvtsqommlmnnpruwy|~}~~}}||z{{||}}~}|{zwvvtrpqqrqqssvwww{}~{|ysqmllhc`__b_]]_`a_]]_bcbbeghgefhjjjlosvxxz|~~~{{zwsnkigeb`^^\[ZVVWWVVUWXXWUSSRONMKKLKJHFGIHFFHKLMMNQSUUUWWYZYXZ[ZYYXZZXWWWVTTTTTUWXXYZ[[[XXXWVURQQPOLJKKKJIIKMKJJKKKKMMOPRSTVUWXXYZ[\_aaaabcddddegfedca`^\[YXXXXWUVXXXUUWWWUPQRPLJHJHFEDDFC@A>=>:76420+)(%&&&&'')-//26;>?AFILLLMONKKJHGGFC@AA><<<>??ACCDHJKKLOQOPPNONLJKLKKIHIIIIKJMOPSSTWYZ\`bcbfkkijjlllmpnosuvwz}~{vtsuqmnppqonquvwyz~|yyvusomljjkjklotvxz}~~{xtuvuvwz~}}|||zxwvtqonlkigedbb`_a`_aa__^_a_\[[\ZVUTSQNKJKIFEGGHFEDFGGGGGHIIJIIJJKJHGHGGFEEHIHGGHHGFDFHIIKLNPRRRSVYZ[\^`bbbbcdefffhiihgghijjjkmnnmmlnonnnpqrqponnmkjjjklkjjjlmllmnooppqrsstuvvvuvwvvvutttuussttsrssrrrqqpoonnlllllmmllmmmnoqstuvwxzz|}~||{{{yyxxyyxy|~~}{yxxxwvvuwwvvwyz{||}}}}|}}}~~~~~}}||||{zz|}|||}}}|||{{z{{{zzzzzzzyyyyzyyxxxxwvvwwxxxyzzzzz{|{{|{{{yxyxxxvvwwyyxxz{{{{|~~~~~~~~~}|~}}|{{~|~~}zwtrqpnmkkkigfgghiknoqssuuvwwyz{||}~}}}~~}}|}~~||||}}|{|}~~}|}}zxtqnkkjfca_^][\]`ceiloqsvxz|~|{{yvtssrqqqqqpoopoooopppppprrrrsuutsssrqrttttwyyz{{|~~~}}{yywvtuuuvvuvxyzyyz{{}}|}}~~~~~|}~}|}~}}|}~~~}~}}}|||{||}~~}{yyyyyyyyyyyyz{|~~}||||{||}}}~|{{{{zxwvvuttuvwyyz{{||}~}|{zywvuutsssttstttttttuuuvwvvvuuvwwwwxyzzyyz||{{{{|}}}|{{{zyzyz{zz||{||}~~~~}}|||{{~~}{yxvusqpnlkjihihihiikklllmoooppqrpoonnmllkkkkkkkkllmmnopqqqrsrqppqponnonnnnnnnnmnnnonoppprssssttuvxy{}~~|{xtrpomiecaa__^`bcccdeghhilnqrrrsssrppqrrqqqqpnlkklllllnnmkkkllkklmnmkkkkjjjkllllllllmmmnooopoopoopqrrqqstsstttsstvutuvuuvxyxyy{{zz|}|zzzyzywvxzzz{|}~~}}}|zzz{{{z{||{zzzyyyyyyxxwvusssrqqrrsrrrrssstuuvvwxwwwxvvuvwuttsssqqrqrqopoonnnopopprrssttuuuxy}}|||{wnkjigc_^^\XUQQPPQRTW[^_abcfhikmpssrrrrqpnnpppnmmmlkjjklmmmmmnnnnmnoppqppqpnllnnmkkkllkklmnopqrsuvvvwz{zz|~~{|}||||||~~||}~~}~~~~}}~~}}}~~~~~}}|{z{zzzzzzzz{{||||}||||||{{zzyxwvuutssstsrsuvvvxzz|||||}}|{{||{z{|{zyyzzz{{|||{yy{zxxxwwwutssssrpqqponllkjjhghfeedcccaabbbbaabbaaaa``_^]]\[ZYXXWWVUSSSRQQQQPOONMLLLKJKLLKJKLKJJIJJKJIHHIIHHHJKJJJLMMNOOPRSTTUVWWWXXYZ[\]^^`babcdffffgghgghhhijjklmnnnoprrsstuutvvvwwwxxyyzzzz{{{{{{{{{{z{{zzyxxwvvtttsrqqqponmmmmmmmmmmlklllkkklllmmmnnoppqrsstuuvvwwxwxxxxxyzzyyzzzyyzzz{||}~~}~~~~|||{zyyy{{|~~~~}||{z{{{{{|}~~~~~~~~~~~~}|{zzxwxwvvuuvuuvvvxxxyxxyzyzzz{{zzzyyyxxyyxxxyzyyzzzzz{{zz{{{{{|}|{{{{{{zyzzzzzyzzzz{{{|}~~~~~~}}}}}||}}}}}}}~~~~}|||||||}}~~~~~}}}}}}~~~~~~~~~}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~}{{{xwvuuuttuvvwwxz{||}~~}~~~~}~~~}{{zyxvwwwvvvwxwxyz{}~~~}||{zzzzyyyyyxxxxxxxxyyyzzz{{|||}}~~~~~~~~~}}|}|||||{{||||{||||{{{{{{{|||||||}||}~~~~~~~~~~~~~~~}}~~~~}}|||{{{{{{zz{zzzz{||||}~~~~~~~~}}}}||||||||}}}}}~~~}||zzyxwwvvuvvvvvwxyyz{||}~~~~||||||{{{{zzzzyzzz{{{z{{{{{{{{{{{{{{{yxyzzzzz{||||}}~~~~~~}||||{{{{{{{{{{{{|||}}}}~~~~~~~~~}}}||}||||{|||}}|}}}~~}~~~~~~~~~~~~~~~~}}}}}|||{{{zzzyyyxxxxwwwwxxwwxxxxxyyzzz{{z{{{||||||||||{{{{{z{zzzzzzyyyzzzyyzzyyyyzzyyzzzzzzzzzzzzzzzzyyzyyyyyyyyyyzyyyyyxxxxxxxxxyyyxxxxxxxxyyyzzz{{{{{{||}~}}}}}}~~~~~~}|||{{|{{{{zzzzzzz{{{zzzzzzyzzzz{zz{{{{||}}}}}}}||}}}|||{{{zzzzzzyyyyyyyyzyzzzzzzzzzzzzzzzzzzzzzz{zzzzz{{{{{zzzzzzzzyyzzzzzz{{{||}}}}}}}}|||{{|{{zz{{{{{||}||}~~~~~~~}|}}}}}||}}}~~~~~||{zzzxyxwvvvvvuvvwwwwwwwvwvvwwvvvwwwvvwxxxxxyzyyyzz{zzz{{{zzzzzzyyyyyyxxyyyxxyzyyyzzzyyz{{{{||||||}~~~}}|{{yxwxwwwvwxxxyyz{|}~~~~}}|{{zzzyyyyyyyyyyyyyyyyzyyyyz{zz{{{{{{|||}}||}}|{{||{{zzzyxxxwwxxwxxyyxyzzzzzz{{{{{z{{{{zz{{yyzzzzzz{{{||{||||||}}||}}}}|||{{{{{{{{{{z{{{{{z|||}}}}}}}}}}~~~}}|||||{{{{{zzzzzyyxxwvvvuututtttttttuutuuvvvvwwwwxxxxxxxwwwwvuvwwvuwwwvvwxwwxxxxxxyzyz{zzz{zyyyz{|{|}~}}~~||}}~~}}}}||||||}~~}}}~~}}}~~~}}~~~~~~~|||}|{zz{{{zz{|||{{|}|{{{}~}}}|~~}}}}~~~~~~~~~~}}}|{{z{{zzzzzzzzzz{{{{{{|||||||||{||{{{zzzzzzzzzzzzz{{{zz{{{{{{||||{z{{{{{|}}|{{|||{|}}}}}}}}}|{{zzzyzzzzz{{{zzyyzzyzz{|||||}}|}}}|}}}}|}}}|}}||}~}}|~~~~~~~~~~~~~}~~~~~~~~~~~~~~~}~~~~~~~~}~}}~}}~~~~~~~~~~}}|}}||||{|{||||||}}|}}}}}}}}}}}||}}||||}}||}}}|||}}}}}}}}}|||}}||}|}|||||||{|||}}|}}}}}}}}}~}}~~~}~}}}}}}}}}}~}}~~~}}}}||{zzyyxxwvvvuuuuvvvwwwxxxyyyyzzzzzzyyyyyyyyyyyyyyxxxxxxxxxwwxxxxxxxxxxxxyxxyyxxyyyyyzyyyz{{{{{{{{{{{|{{{zzzzyzz{{{{{||||}~}}}~~~~~~}}}~~~~~~~}}}~~}}~~}}~~}}~~~~~~~~~~~~~~}||{{zzzyyyyxyyyyzzzz|||}}~~~~~~~~~}}}~~~~~~~~~~~~~~~~~~~~~~}}~}}}}}}~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}||||||||{||{{|||||||}}}}}}}}}}}}}}}}}}}}}||}}}}|}}}}}|}}|}}}}}}}}}~}}}~}}}}~~~~~~~~~~~~~~}}}}}}||}}}}}}}}}}}}~~~~~~~}}}}}}}}|||||||||||||||}}}}}~~~~~~~~~~}}}}||||{||{{{{{{|||||||}|}}}}}}}~~~}}}}}}}}}~}}}}~}}}}}}}~}}}}}}}}|||||}}}}}}}~~}}}~~~~~~~~~~~~~~~~~~~~~~~}}}}|{zz{zzyyyzzyyyzzzzz{|||||}~~}~~~~~~~~~~~}}~~}}}}}~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~}}}}}}|||||}}|||}|||}|||||||||||||}}}}}}~~~~~~~~~~~~~~~}}}~~~~~~~~~~~~~~~~~}~}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}~~~~}}~~~~~~~~}~~~~~}~~}}}}}~}}}}}~~~}~~~~~~~~~~~~~~~~~~~~~}}~}}}}}}|||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{||||||||||||||||}}}||}~~~}}~~~~~~~~~~~~}}}}}}}}}}}}}}}}}||||||{||{{{||||||}}}}}}~~~~}}}}}}}}}||||||||||||||||||}}}}}}}}}}}}}}~~}}}}}}}}}}}}~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}|||}|||||}}}}}}}}}}}~~}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~}}}}}|||||||||||||}}}}}~~}~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}~~~}}}}}}}}}}}}}~~}}}}~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dd2-0.2.2/src/data/efx8.wav0000644000175000017500000015510207636076510015077 0ustar reidracreidracRIFF:WAVEfmt DXdata}S'VVUu$DBG`::Zz.Jkjt:z K=|' /Mli7;X>kA K GfI+ rh} C ] Y"{ 1 o2_?]}Vh@ ;kN u$h WQs c g[B9p;P?b,FNRX 6 m -k J(' 5 bf|T:Xw*z<@f0&WAz \ "4! J 8 - s3I*+B%Zo]!N> )2$H!B ? 6 . PrL"b+ ]% 9$!B1": ~=uH-0~gE0?l %"N.k1 ( Ac.vq^]3 V$g!%lJ,%$ -@mG F6&T5yv0v\'U |V{ 9%"`P+R J Pff{`Fg"R(ZD]7"+*($ ~-#=#  C+D} H@ f V@c)'"j 3 [HtBuy'e@C%Tv O :$(2%S!P"L H O*]*,Y2`N%C?gh(Z J &N'a#sOF   \c &)e*PisC ai C '%!H9 N ($Q[ ^Dw_,;W]^kmP=(2JxIZ  *P(# : AVij:URGTfr  Y [)Q&! Ym 2t |roy@Gw = H($] c+@T W):j)~),TbTB?H\sx{Em  :!+'7#f Go{GYS'QR=l $% % p ( ' l7i}V9wH5H  jSA y#L |G._|\I% *=2 Gje r  dY! @ m E=|T?3; K  (t!P!b cMycJ;8ETKA#> iC=0= i! # Br\;xUD, &1%! p !<r[@:: 'w  Z%T9&vEU5$  $WV8fQ> 3K4(;2tyH OsyV.9 H y$!R/7l ]  &DZua1nZy yDO6hB}}ngh OA-AP tL`s^[S(GD2)' A*\ fm eKqY   6bw6,8 - 6[n)hy@ HATr!>+% x`KJk>d 3  Cf;MTjWZ y > GJBWI?& km54xm 1C} <k j f G aa R < /o ;o3DG ^j;`&O 0KDx% MRv_uFYZIlux C * s4c{bM   +<c`&Eh@MOzj &T!TCO  l vTI\c#  ^~p]uDlLhi /n3Hp-Ux>Y{^!uy g R ;8^;Q(]Uha { XDfs3  |y 0gG! )rjhF WUcBn9 :o}dBS @ ZC AMb,k q Ac]k@- ,lx^-'U v Nk/2h9M>  j.5zYhWu . } > D^P hzBx)  J5QO8 ge\MCwM 2 %;  _K1* ( Z &?})` GV;y#Q +J\ x /z} 3s* }$6  >BoO $AS  j::%}i)VBHdSM n{ K$`Yxo 7 ( 79x[ b]P"! 2o$ rqsE k~E_;3I4c~x?$gJf {emNH{mDF_;6J5cy7$[P; uh'QI{sDIa;8H]c Yl$]S? c)bL|nwXtnq$p {|NrxZqz2. ?$A Y& ||N "" 7 $h}G0  jU8 + m9Gj' nK bK%SWt & O1\ oO:zD`P nx~U+ + &3!6= MU|FaI79 9 #!Q/ Lt(=r76e  S ;C"o 'o<i8 p  "bvP t1x ]@K xj=  }"^o & ]bK<8t >!2 v\ opCegc(%5  /E"2R4d +(5kcF2 eP f#vj~ ]&r-_=A%=w B"= l- KC;4) #9L hh%o/b') rUC & %t}-pq'@i'y v,D 9 j[;sz(D(${, xm &?L`s.: /p oA|NLJf *^=IR5w6$ ct /  }{+X>d)[$- ( A  kWy(VtO k|fZSS f 3|iY 7S&}% :KvL)fY.Vx]W ;K`( |8; }MeLOR uQK Z^D @]I9hb) Zm$ ^/e3[4y #gX 6M v [k[ `)Qi0` qPJA+LSV JrI0 =4G W?fZ \nW cG\qk'9Agl r$* :*xz&F%! u28 `@5 `~,' Nx4 o!T>X7gaj' !>|  Tgv0`  K.Pl q a 9sDh V0RoP :<b)PGy  GPa5 JPeU7T)U  C L ISyN'  P  Z@iA;X> gS7j  bkJc}+[* T, q _OcH^}5lX o nQ4H F4D(!)Xq}]|?LK F30ek 0=Ifxdj t%M% } ckcHKiC%% +d D'')?F% n Z#7Vd@% 9*i q<G;7Poo% lV& _X*Er~KV,gM] $!}js T3bh /{O\H4=/! >? d s7b&wEcWn  !Uk zY4tIz@;&jzy?Y +}# [c  D6I|-6#8 Lu!+U/ x+TXczWK7, BR_" JWeVSOnc'5 9i 'Nh  Nmm4r\. Vu Z0F? HIS{pZH%$ I) 4rqU(5 &'ex `<-RPu| |) N  T\"N  -C4(Pz ?0zZoS!2 R J y le yvR0+pC)?W T ?O@ @$I'UEu'z E h& b ) c08uVCZL,g & c?Gv EFl8@ (+KbJ  6{ldEl  8 n| "S  ,SRFL( ad>FIEZHZPI "C.OaO [ h8? <;[=Mul? u  Wd'  hk:vir p o, ,o;/ 0!t Y 2U> $;HHf;4 g|p R5T>0CVJhhm j0 2IR''Hs"3 6me// K >qp1S7 li X B]D$d', ?p s%H"JR 1h_N3$ %4"I>\ s)WH3%h %"N _ u/\xJ2D S f$"SHa sigK3DFE F!j"7d fh PN"GF m"[  <o{"L> Dpm f"L , R []Q6' ( 7OI'V& "c\} /X>niG  %[#nU : :.R)F ?;   7 f$y{ h ymT,L7KEJ I$. H p c3U294J T - ^$Lg >+E!f30x y"8 N.* I5r~t^@ " `2\ b)cw~ ko@ : 7 e:? ;s@R L!s ZS2K  l " Pb Nx oSw$ *ct z p?p!R  ` ~Odjwn`~ 1 U !"/o  w5 mn"Y0f78;  M! yfoyX;Ar% x_;0QV 5zUs'O w #!hY P$/L#4J^=S | &`.A f;DN`.q6E8}m d YbS$ 0 (`ypC 0 91 -K{A$P $\o  =` C @I6VMpw ):7 Y+ t z 5$CT o)6-8z Q-9b i wi%w jlu%jTd\S  o RnS*7; S ='ag4E B =rh+ RJ,/4` =G  6us '!ib w kOt ;3 o Rxexo 1Kuh5 rB-<k THb9q 3F~$ &I`o@+@x G 7 hYA ,! L :$( ?|(6 ) x.b 5oXk  {1rpAR }gca6'z8 \N`o? [KW Ku#kV `oQ,1[Z 3N* $ s"_T 9 IZ}h#s # 4 s6cMTB^ &9LM 49t$=RQ 96 Em6W <6yi "H_ Si86 >x]#/W J )syD}<0B VlX'Y  J6rQ&c Yox,sb ~ WtY(tP <x;t 3G *Np#(i C| v% sh9 S 7$^!<  |g AQc =gA tm 2A_C M:!yu Jcn ]YiT!Oy |+W5! HPaoF a ] `|:Ub* <WNQM } f d~#U d= h  ,2 H c h?V g)< oZ!1_ 1 h k@Xb% D~& 6 k n"QZd(p CLV`!I VA o r!]d, }u Uk i)U#_7~C wn(+ So {' ] u`, m~\ G ;=2h, I p4 4 A `=?5j.(=(ay! Q #n@K4!l>)H! ,#L"Y I k#AN7+gB+ R##^ N o#DA;%uD! BVd$e. {)FTuG!qjk[$tLW r,EV(vK&+1 [';%F xP?nh$ ?3}a"s (s A Yn^]@zqG:b 6u{#1 $]F)$rI=cQ  x'  g ^K(%Rd : k  w  e{i2b2Zl@ Q ~ g F|E% i $ .p'3 b[An` " \0zZH R m7fhCba#4 B0u D -  I U]>i  HEP E *3 vY{NJ un_ g63ru=pQ :S7 dn:J_v  Z  (-.oT3  n 3 R ^opIo _B (wzFd^ Up47|A ; o8" eP;8/5PW85 rGHxJ$X( <B%`[1, %* KK@~hpr) r$6i _ *7R k5t1"xw (nG_R ?!/  ?}6j|igy1 a#  zb$2})}>-Oc- /j< |#} U]/ + XR x(`aM  >2O 3ZQ1}$z$O2 { @WBx?c  ~5OU1VO x)!E=M 2$ayww"  20!xp Z &_Keb>*, J _-h vIgFO&t\q q*' psi sZr 3 %7  y"(,Z)?  >F By|4i}z M L:xG4FB P t <4FxUP>Q $Qy &1 &g7 LK?LXJNf c 9 6/c< ` Wr( bi4Ty /6 {9oD vm6 [b*Cut Z[]I(p rfy a/FI  :<X 3Mx3_J' 5r3} Y b@%NO #3 (H? [   yhG1x21L< RZ  [2-|N == , .}+u} G' B  O|k Xt |&zz}\ 7 { /EYq>Z{ Q*1 b-cBc ;$_f` >lUe ] @)V p<\ ( p0Di ".BK i cxw e/c ;:{8`: 4Yhpk< R_ [[A u~#>  xo.d +@"?zlQ s?sz i|X, TN  GT/!Wp |crB A!2/1 B9~XHJ vBs {+WAu  YA U v! UMu m?Wc1 (m> 0o;FKmr v=LA A 8">  d[n-o Q4%{ _g P'U,?J1* @hz N/ fYk"XR  NvIAC O!,1 W w -#I)_ Ci*(. 1X5Ux#CH3O"\ H l48"tq .`Hqj./ M  s6E8e V4o<1 X j% L%;R H]}# fwmHmZD50  +Jg#WJX'(l D",NP+T$]]y |6 ]x _ |YF?;/L XlH&;U [%%rT . $ *< g &31: ?9"6f { 1 4[(!p X9: #'L  a"\3h 5QP 3%xt, 1d tO wj*d# H+Qm4=UY %&-  ]^1l=6a " %|> NNM  N$z >B.kU; nB# R3u5 DwM ? B!R )(cmI H "pZ- R A{q/gGyR Bl  MX3+tF  iZ =\g 2)\F  d [ g8_=Lk ZN3u A.`yF T| $ 2 G  )6(& ? |  9~(tH gl$| oLlc m t PO`( p)B9 Oz )p  ,]# ~  JB zSc.c q^osD v3[D.`y;Ql L?  EQ Xw I ;*{qM#T  j)Zc j+8xn, 7 ,:]* $#$&zlGm D l 8[\  D4z0CR  H.0AlX Hv!E uiu j9a M K<k*?Mc8 rR H tNUeIa %eS# ,o 1['Z\ (J30Z KBnw_ Q    T xaG&ViE 2 P !Mf !=Ca. /'mV9G & v[lwb1J 9UD 'K~c,  TE hI"8nqt E~0Z04 J(0 N fDL]@z s@iG " |N= ,PNc7Z} !2 ^YX v C)z*N  y ?8%1G j,l'##t 5Sd#CFV^m 5 i\KXt}; Yf=0xr ' Bhd =9" +U h X]h gQ#\P_P s"!x  VoFQh F }1Ho}~fL %^CMt9[ %  #~#fr8w cP ,\vT)r1y U{RXrJTT(/ iO|hS 0t"l cIRe YB+u u/K6T C<%*\?{P* -w r5N>#F<g`  W o$y=2e ,=jS+h [RX z ^M ACfQ 'i5C&zvJ Z~5f 3 `_C;  q[ ei%]#k?[U I T~LH(dn +K] 0 Bi-C 0 =c z-%3,]f B(SF ~ q-hM /n"x CM6K# M u 1XU t;{i3 RHLP0] MD*+En0DV 4cn ~X1S- ~ Lvc  opAy0S g . x_n]{ x|\F d] #, s$w S~ZVW{eo vYD '2N r gx]6VbOC . M U} F%h^ _DLB% f $uYv~xg A M~ w/i69JOP ] 6v\} ~, TJl \Uxq*= H W1y;[  z=f%vwM sTk qgCp< vZz8  Kg  zz|teWz F19? W]/FjN D9LCA a VDv2 T nNx V@ T|4  kbZ$D 5|LVm 1_5 d[O8S >5_ O TCUq, Xz@D 8%oeA m90b% UE$%} 81F.qo O<\Nt C,r)  Ed )8& oH>%8 nmj 7[e ~+3[ \ \* d6{* 0 ?EME | e<<}- fBt G)Yuc}DV Y}Z4."d - /4<~B81 F rhW@QdFBul0  buZ? .&lTK8=ulbm \K Wfn4) $ w>5\qaOE !\@^  .L: pS r!YKX t`l GGaApP8EQ"%_ Gy  313S<0- n}t-M} x !*g9:q+Ka}X#b dn_o3.+'$H UN|Lp6I@ IK"(t47|#,h X pA26e l[MC$ t6-3>OX"  5S A`oj k) kXihG_7q Z'  -7~|5/ k!7 ]!17<vr| We i ]a|jQ7H vG +MG)^;  ob(C)n 8G>H P G S;H0 #t [c^cGc O RJ z n+K}F L$y- ]>BP/Ay'>! t{a h/I " %quX{,Ff S *5;SoN V_8 G/3;j > < r ^d^"7 (b"(B# 0c #AAXr ..3 lkjsSU b Mf9z O "tSTBd,: ZYI9;4 i^rA`  7B1G }!=eA( nOS w H~ lN;qu ?&0 }.|X t-1I G~ Eyh ` ?>- y<>ArU M ]h(- a\O3jEx <9t;Wn  o& OgtI U>,-}EP*] j%&v 2 1=(yI Ps XaRsY&) }e & ohm!c  |2# `%(,y\4 4G!# ?8z .bo0Q y  !D.c 6adh4h igT7 z 'd&ZQ uyg :<Jek*9 kf1 T`l  V4b&1aYblG`nG $*^R?*0 3GO8i 7ry 02nn ?6@NI4Q9"g SkNZ Q b?P s[Wm9}7 ,GEu x AY ^@>I TL`JP YUfB #>rU EXG W*>j]dy? 4l"; (Ho[dWG _{11^ `0 phTlC 6j q$mOcwl2`7 &_ic&;*x2%6fKJ i Xy_h6`9 _ S]bufvh`, pD|Qex0d29@SgE E=tnP6 Z iCXJ9qs6nc U)HD<49v.U R)6t< t 9`U kZu@{KoX A%'S F@ b:aT :GK'Fbh## 2m!b I  t  mE#1:RJ -|& S9\Z<~W  c gD]b?]H   B zh$K"5 ?  ]E3@qy  s  hDVXE5p| *1 5 }tNh++EQ V< i ~5F)p1@ 2 M`Y [*?BF D lTF  Ox(#d P )_yELn __^/ m3%8Lr  vWB  a@U0 {? !k\" ScJ`j \ nq>s] ? !v-!  ?)2l,8q Q   qFd_>p! F\( U2yEu0 3k 5@w() a+K4 >W@ 6JX-! [qT" _]I4  PAD g =I"{$]<  H:NdC StO S!H@ ,f -K`(3e 5 g t' #3\ 0Wh 9sFs ll  @A6 lAb5{n HqqT ;N z*Ea)p ;_0 N G2BhV\3 zPo= #Pb2 ?Y6 NHx,1 #Hfg5 dEj9N  %II )[ -vh;d { ;aH] [[>z ^}W  }NgJ  s P.Ss?  O0P"<\$ 80~  *F .bwo q)J4fc z:Z#6XL !g]+c(c Hz%aSXw :K"T!_ =!=2HAb Q\5g!k v|5qn  ]Hf:i@6(Y , 1&J.iA $:2Z0@ QY )0;g\ E8b(soL'I"tE LMx(d`  tK~ 9^vL]7O` tq `q@] b8\y=T! #|X*b]S N BH SO,Q& h/QFYLL!;; };P p1 ,,EVa,Vc ? q 2e#$hJGq3 8J#7lC  0' w_[~3SwF}.  ^_v<%l~q VUw[]|Uw) #;g0 ;4V g.O&p3Ljq1d Zg5r:r@e5,$ R'\bC VV -AwL!fYE6_ ii^&u \ X k-Y"p63 ^ j42  V ]wI], hw? ZO*C Y; f p? [#Q@SO m wAS -t9? sA Z> ddu { <u=.V[.BT~ D' #sU(! J( :l 3vO'c |& ]2Pz^!2 3 6 !  x>C OKa n udC9  !cP ,$ ^.cI :[p JT=g\Fya LSS fi|X%P#: .9  p$AjF! meZ me>  Xa .@y4p5ZV >!V }%/M$Q &{(%yK 5`z_ U Cnp `\N b2B ^2 <T[kN%K dA:z=O j g%:s @o ~aac? 4 >Dl zB,(1h9  nM( W lv9 6] {vK! HT])  U#>TmIv 8"v FA[hQ $r - .5UiW- Z ;Yb"1_ [#R"j=B f,0 E+k  o*)'AI #i$z ;~ %`d9 PBI BP^1 ,s[xm> uT} iH;== IKj' p_f J $CF G8<C%lJ  Vj$zJ kn \ )vP@ f^o#Ou %xB*" 7Yx.M:wG `Q -x 5'w ZYp`3Y @jUr !n>MA d'0eN/DJO u $>K'8EJO9k W*I9mP}CN jy|(iH4%Lx|S$  bj2 R*XC{% oI'EP#y [ <~wOsG   . 7TrZ::k% 7k=qS45X( y$ob@0"u Xw^O@@ MB  8 - t]D1$*Z4p !yM>1_bV Sk4H; zCI/OzP ~v7qaQp~65% eY=' "!#-&E gjA'VW F"+iDV 7 n R^LS{{bE_[00I A\UF5+L5^B ]AkF/" %I 74 5 -ad|]}zdp0 Ia ON (hP?)!` 4 T7 s{ ./h+#  Kr =`Qa8 U  ,[3. 2 a(@ ` D}xp($ Kt;( 9 G1yqg`B _dr| 6?zieYJ==g T .#] tdD<70+$! qZq'  . 5g> i cn t Z<  W Q9vIue i'cx' 6 tV `w2#g  a?  ? WGq_ \!mA( ]} -W t&Gh0`+ 5 o 3}0X#  :~ [\Ov O}`)m -j( L<-stx l 1@FY Wx|fgIbn \hqy6zT#X #8a^C9,zjGV}H ` ?>=<2> 6Y]K>  }|  |v c30' d  &s>  <qY } yQTW'` &Fg  %Z%8?  n<*9ZSY 0rf`\#- a _<qB$+[d~ol?* /X{s;Az\]gQ br. eQ[6D L D!ol^^y:.+yu  aSHzS.'kI] D %_!ZHX @ e ^`fC<Wsxn .2 5k)c(T%K ; G98X x t"c,kU e"RnMWc MY5 ^6 ? I+6L6|L2U Y kjB$N$ggS 'q;g*LW ||D*ngD - _Bw.r P l7  gZtfN PV5N W9PQ8U~PIRr97@mD>m"}0-F $R5zF'TK!U8tbWQriTn`naao5-Qv`[a[!u&pB~I{luASf+v:;!S)AV,C$K]+ J+'Qk 0aW.  w-Q&R=CL)YCMeEL6,3c`I-rn{, A0Bvhn[|XUYYsX4RqSsh\!Y*7V &_ \%d <~&|uEky+WP$gwqAFkY3#  N !o' 1|%z5[Sk,]y_lo"cBk'W xEEQw 9RE a^*hP-7i`-+t* jiSUj{>0QXh ^kb&)Apdb9 b =b8"q;9j\7'yxq \ GMkT9>Q<Tu bS;x=6-;]U!jE |!ESa qsi}e{m 5Z #E$ bdNX t[E4qJAD_ $R( KI Nv@C cZNdTju~76Dfl j#iLM[ow+M| YxP&;Nc 5f%\4Hx$ %TQ 6M>G{x\U BnRlL=& V`cK3B_8 M9 p&4j"6Pi*q } <~%5[+Ytg Zzpr!ZO}B[q 'pM`s31Kkf r^0?b~IH2g= s&1 ~/XzeFzw'IoTQFd`b8dG?.J5F=MPz6g`o(@x03]#f*GI[$@z^$~ 5CoMDfnrHy:e$e4Lm} hq-`$]?D?,W\p8p<?o{z)61wLc,{e2zVe 5aLaOmV@g:pv40Np02Y8-C'U<Iv$K9Bo^xJ%S?|~E>id2q1"W29gLR{`$uE-e3},[RjXYu'vJTuvIWu(2j Y~:7iUD LLWk+<[e_36((K.`_a>@v{&,"U$'Q _aV xF!}xNZ:ajFJx}OY5CAQ\X=08o&;w*9oBO/9]s&`3HksSeK%FeDPATAY"))JO6{/L ,!n!?w yilSlS |0g%a*:m1OLq%Yt > 22^Kgrp*U ^<ZNHaUe^B;=/W"Y'JP : /!G/ /Fx,r\wf{r-c!H:w>a i&^2rHFaKewS y4Se$ x:M 89R`rw3Hi{#?I^h(C;]k+u.K^|E=DX>Un9p#D2Mq5Cf}>q!E h=HIe!Ro~= g.u/V:_}?bIjD&Tl.`I"Op4Bd(Zy5^!7\ +OvKo)\!T.Wv;^Vs O;d16dF._$Z#h W G^6c I N}= (Et; Au<!m0c/|R4n6gFlT$rk},g/1M}KpZm e1Sd9uBgBa_*,a?q i4 ^*VY$*ZZ-~qNS"oB~Mw@N$5hK{)rBt5O4'bi6 gj},|J|NZ.gl$vH&wY3~N"_E`p<B4q#pF|[XjVh=yXP jkDZ1 oTJdQGz-}P'kW D$%fvHhS6 wS i>_Oz0bZ>\4\Pp+12s&V- }Y^f&5 ^wK)tP}^rcGiAqNVDD7e;nL"N["l Y3eIG "sVvS- cE@2VUEjA!zY9,T%m(e=rW@**x ^Y9oR8 ua]O ~X6oT0O_q@CAyR. lZ'$J ,z5uN.nas7l+qJ$h'KY'k\eD n(%J#USa>{m59Ca>I]! &~9~Z9 Iwm+zW3n4`a#tR5E\"JUnM+-I4F iH* q6^{<dC% VA^#s n0`?!DGZb%^;vo69EXvW9A]$]1LvS6GKq~? qR6qo9u s8mM1A\(fi,iN-0LV]%fJ*ru; APdI*Ab-+J`F'  Py={^B$ xu>}n8w[A"Ge0td,vW= !T!o/Z'rU9|xDiuOpQ7Fe2yb}FtW?,P!}dn=rU?3iv@t`d5oS=8d2rY^+lS="T&jQR%jP=gxE|cHM hO<i7w]FxC~eR$X*oXJm>~cKf~IlR]d8{a?l:}fP_/ xf [.ycMW*vZbM"r]IO%s@r@mYE4xJ!u$a3 iVCgoAl` P&|gO@g<DuCuaN>_7&f8s\H<[. dW,mZG8R*G{J~kXE6L%+j=zdR?<G"jZ/ vbOvdP@1<H&W[2p`N=0]D"1<O'p^M<-n@s#pC}kZL:,s<'\a6ziYG7)n6;CU+ xgXG6'g3t+vI#udSE4*^/Ebi=rbRB10S* ?I\2qaQA1LL' y1~Q* zjYI;--~V3Rh?xhXH9,odd2-0.2.2/src/data/gfx.bmp0000644000175000017500000165210210066400740014760 0ustar reidracreidracBMBTB( XS  CCPP h``X8( @H@3f3` 833Pp0f333E _~+*z_Dh6pVZI @@@jjjCCC```<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<>>>>>>>>BBBBB:;BBB99:99:99999:999999::::::::<<<<::::::::999999:99999:99:9:::B9:::::;;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:99::B9:::;;;;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:9:::B9:::::;;;;;;;;;<<<<;;;;;;;;:;:::9B:::99:99:9:::B9::::;;;;;;;;;;<<<<;;;;;;;;;;:::9B:::99:99:9:::B9:::::;;;;;;;;;<<?<<;;;;;;;;;;;::9B::999:99:99::B9:::::;;;;;;;;;<<<<;;;;;;;;;::::9B:::99:99:9:::B9:::::;;;;;;;;;<<?<<;;;;;;;;:::::9B:::99:99:9:::B9::;;;;;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:99::B9::::;;;;;;;;;;<<<<;;;;;;;;:::::9B::999:99:9:::B9:::::;;;;;;;;;<<<<;;;;;;;;;;;::9B:::99:99:9BBB;:BBBBB>>>>>>>>><<<<;;;;;;;;;::::9B:::99:99:99999:999999::::::::<<@<<;;;;;;;;:::::9B:::99:99:99BBB;:BBBBB>>>>>>>><<==<<;;;;;;;;:::::9B:::99:99:99999:999999::::::::<<<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<<@=<<>>>>>>>>BBBBB:;BBB99:99:99:::B9:::::;;;;;;;;<<<<::::::::999999:99999:99:999::B9:::::;;;;;;;;<<<<>>>>>>>>BBBBB:;BBB99:99:99:::B9::::;;;;;;;;;<<>=<<::::::::999999:99999:99:99:::B9:::;;;;;;;;;;<<<<;;;;;;;;;:::::9B:::9:99:999::B9:::::;;;;;;;;<<@<<;;;;;;;;;;::::9B:::9:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;;:::::9B::99:99:999::B9:::::;;;;;;;;<<<<;;;;;;;;;:::::9B:::9:99:999::B9:::;;;;;;;;;;<<<<;;;;;;;;;;::::9B:::9:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;;;::::9B:::9:99:99BBB;:BBBBB>>>>>>>><<<<;;;;;;;;;;;:::9B:::9:99:99999:999999::::::::<<<<;;;;;;;;;:::::9B::99:99:99BBB;:BBBBB>>>>>>>><<=<<;;;;;;;;;:::::9B:::9:99:99999:999999::::::::<<<<;;;;;;;;;:::::9B:::9:99:99:::B9:::::;;;;;;;;<<<<>>>>>>>>>BBBBB:;BBB9:99:99:::B9:::::;;;;;;;;<<><<::::::::999999:99999:99:999::B9:::;;;;;;;;;;<<<<>>>>>>>>BBBBB:;BBB99:99:99:::B9::::;;;;;;;;;<<<<::::::::999999:99999:99:999::B9:::::;;;;;;;;<<<<;;;;;;;;:::::9B::999:99:99:::B9::::;;;;;;;;;<<<<;;;;;;;;;::::9B:::99:99:99:::B9:::::;;;;;;;;<<=<<;;;;;;;;:::::9B:::99:99:999::B9:::;:;;;;;;;;<<<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;;::::9B:::99:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:99BBB;:BBBBB>>>>>>>><<=<<;;;;;;;;;;:::9B:::99:99:99999:999999::::::::<<=A<<;;;;;;;;;::::9B:::99:99:99BBB;:BBBBB>>>>>>>><<=?<<;;;;;;;;:::::9B::999:99:99999:999999::::::::<<<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<<<<>>>>>>>>BBBBB:;BBB99:99:999::B9:::::;;;;;;;;<<<<::::::::999999:99999:99:99:::B9::;;;;;;;;;;;<<<<>>>>>>>>BBBBB:;BBB99:99:99:::B9::::;;;;;;;;;<<<<::::::::999999:99999:99:999::B9:::::;;;;;;;;<<@<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<<?<<;;;;;;;;:::::9B::999:99:99:::B9::;;;;;;;;;;;<<<<;;;;;;;;;;:;:9B:::99:99:99:::B9::::;;;;;;;;;<<><<;;;;;;;;:::::9B::999:99:999::B9:::::;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<<?<<;;;;;;;;;;;::9B:::99:99:99BBB;:BBBBB>>>>>>>><<A<<;;;;;;;;;::::9B:::99:99:99999:999999::::::::<<@<<;;;;;;;;;::::9B:::99:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<<<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<<<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><<<<::::::::999999:99999:99:99999:999999::::::::<<<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><  <=<<::::::::999999:99999:99:99999:999999::::::::<    <><<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<    <<<;;;;;;;;:::::9B:::99:99:99:::B9::;;;;;;;;;;;<        <<<;;;;;;;;;;:::9B::999:99:999::B9:;;;;;;;;;;;;<        <=<<;;;;;;;;;::::9B::999:99:99:::B9:::;;;;;;;;;;<        <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<        <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<        <@<<;;;;;;;;;;:::9B::999:99:999::B9:::::;;;;;;;;<      <@<<;;;;;;;;;::::9B:::99:99:99:::B9::;:;;;;;;;;;<                <<<;;;;;;;;;::::9B:::99:99:99:::B9:::::;;;;;;;;<                  <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<             <<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><                    <@<<::::::::999999:99999:99:99999:999999::::::::<                      <?<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><                          <@@?>?@<<::::::::999999:99999:99:99999:999999::::::::<                      <?<<;;;;;;;;;:::::9B:::9:99:999::B9:::::;;;;;;;;<              <@=<<;;;;;;;;;;::::9B:::9:99:99:::B9:::::;;;;;;;;<            <<<;;;;;;;;;:::::9B:::9:99:99:::B9::;:;;;;;;;;;<                <><<;;;;;;;;;:::::9B::99:99:999::B9:::::;;;;;;;;<                <<<;;;;;;;;;;;:::9B:::9:99:99:::B9:::::;;;;;;;;<                <==<<;;;;;;;;;;::::9B:::9:99:99:::B9::::;;;;;;;;;<            <<<;;;;;;;;;:::::9B:::9:99:99:::B9::;;;;;;;;;;;<        <<<>>>>>>>>>BBBBB:;BBB9:99:999::B9::::;;;;;;;;;<        <<<::::::::999999:99999:99:99:::B9::::;;;;;;;;;<        <<<>>>>>>>>BBBBB:;BBB99:99:99:::B9:::::;;;;;;;;<    <<<::::::::999999:99999:99:99BBB;:BBBBB>>>>>>>><    <><<;;;;;;;;:::::9B::999:99:99999:999999::::::::<    <<<;;;;;;;;;::::9B:::99:99:99BBB;:BBBBB>>>>>>>><<<<;;;;;;;;:::::9B:::99:99:99999:999999::::::::<<?<<;;;;;;;;:::::9B:::99:99:9:::B9::::;;;;;;;;;;<<?<<;;;;;;;;;::::9B::999:99:99::B9::::;;;;;;;;;;<<<<;;;;;;;;;;;::9B:::99:99:9:::B9:::::;;;;;;;;;<<@A<<;;;;;;;;:::::9B:::99:99:999:B9:::::;;;;;;;;;<<<<;;;;;;;;:::::9B::999:99:9:::B9::::;;;;;;;;;;<<=<<;;;;;;;;;;:::9B:::99:99:9:::B9:::::;;;;;;;;;<<=<<;;;;;;;;;::::9B:::99:99:9BBB;:BBBBB>>>>>>>>><<<<;;;;;;;;:::::9B::999:99:99999:999999::::::::<  <<<;;;;;;;;:::::9B::999:99:99BBB;:BBBBB>>>>>>>><    <><<;;;;;;;;;::::9B:::99:99:99999:999999::::::::<    <<<>>>>>>>>BBBBB:;BBB99:99:99:::B9:::::;;;;;;;;<      <@<<::::::::999999:99999:99:999::B9:::::;;;;;;;;<      <=<<>>>>>>>>BBBBB:;BBB99:99:99:::B9::::;;;;;;;;;<        <<<::::::::999999:99999:99:99:::B9:::::;;;;;;;;<          <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<          <?<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<          <@?<<;;;;;;;;;::::9B:::99:99:99:::B9::;:;;;;;;;;;<          <<<;;;;;;;;;:;::9B:::99:99:999::B9:::::;;;;;;;;<          <=<<;;;;;;;;;;;::9B:::99:99:99:::B9:::::;;;;;;;;<          <<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<          <<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<          <=<<;;;;;;;;;:;::9B:::99:99:999::B9::;;;;;;;;;;;<      <=<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<          <<<;;;;;;;;:::::9B::999:99:99:::B9::::;;;;;;;;;<            <<<;;;;;;;;;::::9B:::99:99:99BBB;:BBBBB>>>>>>>><           <<<;;;;;;;;;;:::9B:::99:99:99999:999999::::::::<          <<<;;;;;;;;;::::9B:::99:99:99BBB;:BBBBB>>>>>>>><          <<<;;;;;;;;:::::9B:::99:99:99999:999999::::::::<              <<<>>>>>>>>BBBBB:;BBB99:99:99:::B9:::::;;;;;;;;<                <<<::::::::999999:99999:99:99:::B9:::::;;;;;;;;<                          <=<<>>>>>>>>BBBBB:;BBB99:99:99:::B9:::;;;;;;;;;;<                                <A<<::::::::999999:99999:99:99:::B9:::::;;;;;;;;<                      <><<;;;;;;;;;:::::9B:::9:99:99:::B9:::::;;;;;;;;<                      <<<;;;;;;;;;;::::9B:::9:99:999::B9:::::;;;;;;;;<                                <@<<;;;;;;;;;:::::9B::99:99:99:::B9::;;;;;;;;;;;<                 <@<<;;;;;;;;;;;;;:9B:::9:99:99:::B9::::;;;;;;;;;<                       <<<;;;;;;;;;;;:::9B:::9:99:99:::B9:::::;;;;;;;;<                                                <=<<;;;;;;;;;:::::9B:::9:99:99:::B9:::::;;;;;;;;<                                           <<<>>>>>>>>>BBBBB:;BBB9:99:99BBB;:BBBBB>>>>>>>><                                     <<<:::::::::999999:9999:99:99999:999999::::::::<                                       <<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><                       <<<::::::::999999:99999:99:99999:999999::::::::<                            <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                        <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                    <<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<              <<<;;;;;;;;;::::9B:::99:99:99:::B9::::;;;;;;;;;<            <@<<;;;;;;;;;;:::9B::999:99:99:::B9:::::;;;;;;;;<              <=<<;;;;;;;;:::::9B:::99:99:999::B9:::::;;;;;;;;<                    <?<<;;;;;;;;:::::9B::999:99:999::B9::::;;;;;;;;;<                    <@<<;;;;;;;;;::::9B:::99:99:99:::B9::;;;;;;;;;;;<          <<<;;;;;;;;:::::9B:::99:99:999::B9:::::;;;;;;;;<                      <@=<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<              <=<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><            <<<::::::::999999:99999:99:99999:999999::::::::<                    <<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><        <<<::::::::999999:99999:99:99999:999999::::::::<            <<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                <><<;;;;;;;;:::;:9B::999:99:99:::B9:::::;;;;;;;;<        <<<;;;;;;;;;;;;:9B:::99:99:99:::B9::::;;;;;;;;;<            <<<;;;;;;;;;::::9B:::99:99:999::B9::;;;;;;;;;;;<                <=<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<    <<<;;;;;;;;:::::9B:::99:99:999::B9:::::;;;;;;;;<  <=<<;;;;;;;;;;:::9B:::99:99:99:::B9:::::;;;;;;;;<            <<<;;;;;;;;;::::9B::999:99:99:::B9::;;;;;;;;;;;<            <@<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<      <?<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<      <@??@<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><        <?>A<<::::::::999999:99999:99:99999:999999::::::::<          <@<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><          <<<::::::::999999:99999:99:99999:999999::::::::<          <>=<<;;;;;;;;;:::::9B:::9:99:9:::B9:::::;;;;;;;;;<          <<<;;;;;;;;;;::::9B:::9:99:9:::B9::::;;;;;;;;;;<          <><<;;;;;;;;;:::::9B:::9:99:99::B9:::::;;;;;;;;;<          <<<;;;;;;;;;;::::9B::99:99:9:::B9:::::;;;;;;;;;<          <<<;;;;;;;;;;::::9B:::9:99:9:::B9::::;;;;;;;;;;<          <<<;;;;;;;;;:::::9B:::9:99:9:::B9:::::;;;;;;;;;<      <<<>>>>>>>>>BBBBB:;BBB9:99:9BBB;:BBBBB>>>>>>>>><          <<<::::::::999999:99999:99:99999:999999::::::::<             <@<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><            <<<::::::::999999:99999:99:99999:999999::::::::<           <@<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<           <<<;;;;;;;;:::::9B::999:99:99:::B9:::::;;;;;;;;<               <<<;;;;;;;;;;:::9B:::99:99:999::B9:::::;;;;;;;;<                  <@?<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                <<<;;;;;;;;:::::9B::999:99:99:::B9:::;;;;;;;;;;<                  <<<;;;;;;;;:::::9B:::99:99:999::B9::::;;;;;;;;;<                <<<;;;;;;;;;::::9B:::99:99:99:::B9:::::;;;;;;;;<            <?<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                  <=<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<               <<<;;;;;;;;;;;::9B:::99:99:99:::B9::::;;;;;;;;;<                 <<<;;;;;;;;;::::9B:::99:99:99:::B9:::;;;;;;;;;;<                      <=<<;;;;;;;;;::::9B::999:99:999::B9::;;;;;;;;;;;<                         <>?@<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<                           <=<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                         <=<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><                 <<<::::::::999999:99999:99:99999:999999::::::::<              <<<>>>>>>>>BBBBB:;BBB99:99:99BBB;:BBBBB>>>>>>>><                  <@<<::::::::999999:99999:99:99999:999999::::::::<                  <=<<;;;;;;;;:::::9B:::99:99:99:::B9:::::;;;;;;;;<                <=<<;;;;;;;;:::::9B:::99:99:999::B9:::::;;;;;;;;<              <<<;;;;;;;;;;;::9B:::99:99:99:::B9::::;;;;;;;;;<            <<<;;;;;;;;;::::9B::999:99:99:::B9:::::;;;;;;;;<          <<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<       <<<;;;;;;;;:::::9B:::99:99:99:::B9::;;;;;;;;;;;<      <<<;;;;;;;;;::::9B:::99:99:999::B9:::::;;;;;;;;<     <<<;;;;;;;;;::::9B::999:99:99:::B9:::::;;;;;;;;<     <<<;;;;;;;;;::::9B:::99:99:99:::B9::::;;;;;;;;;<    <<<;;;;;;;;:::::9B:::99:99:99:::B9::::;;;;;;;;;<     <<<>>>>>>>>BBBBB:;BBB99:99:999::B9:::::;;;;;;;;<     <<<::::::::999999:99999:99:99:::B9:::::;;;;;;;;<     <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<            99999999999999   :::::::9999:::::::   ;;::99::;;    ;;;;;; :9999: ;;;;;;      ;;;;;;;;; ::99:: ;;;;;;;;;     55555     99;;999; :99: ;999;;99     5555555555555555555      99 99 99 99 99 99 99              5555555555555555555555555      9 99  99 9              55555555555555455555555555555555         9 9 9 9  9 9 9 9           55555555555555555444555555555555555555         9 9 9 9  9 9 9 9                 5555555555555544444444445555555555555555            99 9 9999999  9999999 9 99                5555555555544444444444444444555555555555555            9999999  9999999              45555544444444444444445555555555555                                   ''    4444444444444444555555555                                 ''     4444444445555555                                           4444555555                                        '    444455                                          4                                          9999999  9999999                         99 9 9999999  9999999 9 99                        9 9 9 9  9 9 9 9                            9 9 9 9  9 9 9 9                       9 99  99 9                             99 99 99 99 99 99 99                         99;;999; :99: ;999;;99                  ;;;;;;;;; ::99:: ;;;;;;;;;                 ;;;;;; :9999: ;;;;;;         ;;::99::;;55555555         :::::::9999:::::::5555555555555         999999999999995555555555555555       55555555555555555545555 555555555    55555555555555555555445555 55555554444       55555555555555555555544555 44444444444       55555555555555555555555555555544444 4444444444       5555555555555555555555555555555555 4     5555555555555555555555555555555555555       5555555555555555555555555555555555555        55555555555555555555555555555555555555           55555555555555555555555555555555555555               55555555555555555555555555555555555555              55555555555555555555555555555555555555                  55555555555555555555555555555555555555                      555555555555555555555555555555555555             555555555555555555555555555555555555               55555555555555555555555555555555555                    555555555555555555555555555555555                5555555555555555555555555555555                   ''   555555555555555555555555555                     ''  555555555555555555                            55555555555555555                           '  5555555555555555                                  55555555555555                          5555555555555 5555               55555555555 5555555                               55555 55555555                                   555555555                        55555555555                                 444444555555                            4444444444555                   444444444444               55555  4444        555555555  5555555555           55555555555555  55555555555555555555          555555555555555  55555555555555555555555555             5555555555555555  55555555555555555555555555555             5555555555555444 555555555555555555555555555555           5555555555544444 55555555555555555555555555555555555         55555555444444444 555555555555555555555555555555555555555        55555444444444444 555555555555555555555555555555555555555555555          55544444444444444 55555555555555555555555555555555555555555555555555555         554445555555555555555555555555555555555555555554555555555555555          444455555555555555555551155555555555555555555555555555555555555554455555555555555555                  455555555555555555555551155555555555555555555555555555555555555555555544555555555555555555              5555555555555555555555555515555555544455555555555555555555555555555555555555445555555555555555555                        15555555555555555555555555555555555554 5555544445555555555555555555555555555555555555545555555555555555555                  115555555555555555555555555555555555555555555 5554474455555555555555555555554444444555555554555555555555555555555                              55555555555555555555555555555555555555555554 5554777777445555555555555555555544455555554  5555555555555555555555                               15555555555555555555555555555555555555555555555 554777777745555555555555555555447777455555554  5555555555555555555555                                55551555555555555555555555555555555555555555555554 5577666677745555555555555555554477777745555554  555555555555555555555                                    555555555555555555555555555555555555555555555555555555554 54776666667745555555555555555554776667745555554  555555555555555555555                                    5555555555555555555555555555555555555555555555555555555555555554  5577666666677555555555555555555776666675555554 5555555555555555555555                                    55555555555555555555515555555555555555555555555555555555555555555554 5476666666666755555555555555555577766666675555554 5555555555555555555555                            55555555555555555555555155555555555555555555555555555555555555555555554555554115466666666666655555555555555555577666666675555554 555555555555555555555        """"""""""""""""""""""""""""""""""""""""""""""""                555555555555555555555555555555555555555555555555555555555555554444455555555555541115666666666666655555555555555555576666666665555554 555555555555555555555      ""                    555555555555555555555555555555555555555555555555555555555555555544444555555155544111115666666666666655555555555555555576666666665555554 55555555555555555555    ""                        5555555555555555555555555555555555555555555555555555555555555555554445555415444111111156666655555555555555555566666666665555544 55555555555555555555      ""                    55555555555555555555555555555555555555555555555555555555555555555554555551111111166665555555555555555556666666555554 5555555555555555555      ""                          5555555555555555555555555555555555555555555555555555555555555555555545554244411111111116665555555555555555556666555554 555555555555555555      ""                              555555555555555555555555555555555555555555555555555555555555555555545552444111111111166555555555555555555666555544 5555555555555555    ""                          55555555555555555555555555555555555555555555555555555555555555555555442244111111111114655555555555555555566655554 55555555555555    ""                      5555555555555555555555555555155555555555555555555555555555555555555422411111111111111455555555555555555556655544555555555555    ""                      555555555555555555555555555515555555555555444555555555555555555555522221111111111111145555555555555555565554455555555555    ""                              5555555555555555555555555555155555555555444455555555555555555522222221111111111111 45555555555555555555555854444555555  ""                        5555555555555555555555555515555555554445555555555555555522222222222222111111 4555555555555555555555555555555558  """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                                555555555555555555555551555115555555544455555555555555552222222222222222211111 455555555555555555555555555555555    """"""""""""""""""""""""""""""""""""""""""""""""""""""                            5555555555555555555555155115555555445555555555555522222222222222222222222 45555555555555555555555555555555555    """"""""""""""""""""""""""""""""""""""""""""""""""""""                            5555555555555555555555155115555555455555555555555222222222222222222222222 4555555555555555555555555555555555558855  """"""""""""""""""""""""""""""""""""""""""""""""""""""""""                    5555555555555555555551111155555555555555555555222222222222222222222222 4555555555555555555555554555555555588855 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                    55555555555555555555111115555555555555555555122222222222222222222222 44555555555555555555555555555555558854""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                  5555555555555555555111115555555555555555555111122222222222222222222 455544455555555555555445555555888554"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                                555555555555555555111111555555555555555551111112222222222222222222 444445555555555555554455555 54""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                                555555555555555551111111555555555555555551111111111111222222222222 4455555555555555555554444 44 """"""""                                5555555555555111111111555555555555551111111111111111111122222 44 55555555555555555555555 44""""""""""""                                111111111555555555255555551111111111111111112222 44 555555555555555555555555555 4 """""""""""######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""""                                111111111155555555255555552224111111111111111111111111222 44 55555555555555555555555555 """######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""                                111111111155555555255555221111111111111111111111111112 4 5555555555555555555555555 44 """######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""""                        111111111115555555225555422241111111111111111111111111 4 4555555555555555555555554 4 """"""""""""""""""######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                111111111111555555522245542221111111111111111111111111 4 45555555555555555555555 """######################################""""""""""""""""""""""""""""""""""""""""""""""""""""""""""            111111111114555555552222444222211111111111111111111111111  45555555555555555555554 """######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""                111111111111145555555552222442222211111111111111111111111111  4555555555555555555554 """######################################"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""            11111111111114455555555555522224221111111111111111111111111  445555555555555555544   """######################################"        1111111111111145555555555555555555222222222211111111111111111 44445555555555555444     """""""""""""""""""""""""""######################################"111111111111145555555555555555555222222222222222222222222211111111111111111 44444444455444     ""11111111111114555555555555555455222222222222222222222222222211111111111111 4444444     """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""111111111112255555555555555452222222222222222222222222221111111111111 444     """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""1111111111112114555555555554455222222222222222222222222222222111122111111          """""""""""""""""""""""""""""""""""""""""""""""11111111111121144555555555545552222222222222222222222222222222212222211111          """""""""""""""""""""""""""""""""""""""""""11111111111122445555555545555222222222222222222222222222222222222211111               """""""""""""""""""""""""""""""""""""""""1111111111222222444444445555222222222222222222222222222222222222221111              """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""11111111111222222245555552222222222222222222222222222222222222211111            """""""""""""1111111222222222222555555555555551111111111222222222222222222222222222211111          """""""""""""1111111222222222222225555555555555111111111122222222222222222222222222221111         """""""""""""""""""""""""""""""""""""""""111111222222222222225555555555541111111111112222222222222222222222222222111           """""""""""""""""""""""""""""""""""""""""""111111112222222222222225555555555541111111111111222222222222222222222222222221         """"""""""""""""""""""""""""""""""""""""""""""""111111112222222222222221455545555541111111111111111222222222222222222222222221          """""""""""""""""""""""""""""""""""""""""""""""""""""11122222222222222222211145544555511111111111111111111222222222222222222222211          """""""""""""112222222222222222221111144444554111111111111111111111122222222222222222222211111      """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""1222222222222222222111111444444111111111111111111111122222222222222222222211111111         ""***2222222222222222211111114444111111111111111111111112222222222222222222222222221           """"""""""""""""""""""""""""""""""""""""""""""""""""***2222222222222222111111111414441111111111111111111111122222222222222222222222222           """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""222222222222222211111111111141111111111111111111111111222222222222222222222222                """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""2222222222222211111111111111111111111111111111111112222222222222222222222                 """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""222222222222221111111111111111111111111111111111111111111222222222222222222            """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""22222222222211111111111111111111111111111111111111111111112222222222222222            """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""222222221111111111111111111111111111111111111111111111111122222222222222        """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""222222211111111111111111111111111111111111111111111111111111222222222        """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""2222222111111111111111111111111111111111111111111111111111111222222        """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""32222221111111111111111111111111111111111111111111111111111111222111      """""""""""""""""""""""""""""""""""""""""""""""""""""""2222222222222222111111111111111111111111111111111111111111111111111111111111    """""""""""""""""""222222222222111111111111111111111111111111111111111111111111111111111111      "######################################"""""""""""------"""""""2222222211111111111111111111111111111111111111111111111111111111111111      "######################################"""///"""""""2221111111111111111111111111111111111111111111111111111111111111      "######################################""",,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,111111111111111111111111111111111111111111111111111111111111    "######################################""""""""""""""""""++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++1111111111111111111111111111111111111111111111111111111    "######################################"""****************************************************************************************************11111111111111111111111111111111111111111111111    "######################################"""))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))11111111111111111111111111111111111111111111    "######################################"""((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((1111111111111111111111111111111111111111111111111  "######################################"""'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''"""111111111111111111111111111111111111111111111  "######################################"""""""""""""""""""""""""""&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&"""111111111111111111111111111111111111111    ""%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%11111111111111111111111111111111111    ""$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$111111111111111111111111111  """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""1111111111111111 11111111111111111""" """""""""""""""""""""""""""""""""""""""""""""""""!""""""""""""""""""""""""""""""""""  """"      !!"""""""""""""""""""""""""""""      """"""""""""""""""""""""""""""        """"""""""""""""""""  ""   ***********        ********************        """*****************************   ""************************************************************    """""""""""""""""""""""""""""""*****************************************************************************************************************************************************************************     """"""""""""""""""""""""""****************************************************************************************************************************************************************************************    ******************************************************************************************************************************************************************************************************""""""""""""""""""""""""""""""''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''"""""""""""""""""""""""""""""""""""*********************************************************************************************************************************************************************************"""""""""""""""""******************************************************************************************************************************************************************************************************************""""""""""""""""*********************************************************************************************************************************************************************************************************""****************************************************************************************************************************************************************************************************************************************000000*************************00..0.0.00**00..........0.  0....0000000....      ..00000...000..0!    !!!!!!..00000..0..00..0"""""""""""      !!!!!!!!!!!!!..00....0000.0""""""""""""""""""""!!        !!!!......!!!!..000.0!!!!.00."""""""""""""""""""""""""""""     !!!..........!!.000..!....!!.00..""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""           !!!!...!!!.00.0!!....!.00."""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""          !!!!!!.....!!.00.!...!!.00.""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""    !....!!!!...!!.00.!.00.!.00.""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""    !....!!!!!...!!!.00.....!000      !.....!!...!!!0000......!000."""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""    !..!!....!!000........!0000""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""!...!....!00....0000"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""!!....!.....!!000."""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""".....!!!........!00000"""""""""""""""""""""""""""""""""".......!!......0000""""""""""""""""""""""""""""""""....!!......00"""""""""""""""""""""""""""dd2-0.2.2/src/data/dd2.cfg0000644000175000017500000000007007636076510014631 0ustar reidracreidracBEGIN SOUND=3 CONTROL_1=0 CONTROL_2=0 FULL_SCREEN=1 END dd2-0.2.2/src/data/game.act0000644000175000017500000001113010071300473015061 0ustar reidracreidracITEMS=220 10 - 0 (6,1) . STAGE 1 *** 300 - 3 (200,-32) . ES 20 - 3 (180,-32) . 0 - 3 (220,-32) . ********* 200 - 3 (80,-32) . ES 20 - 3 (60,-32) . 0 - 3 (100,-32) . ********* 200 - 3 (200,-32) . ES 20 - 3 (180,-32) . 0 - 3 (220,-32) . ********* 100 - 2 (40,-32) . EC 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . ********* 75 - 2 (260,-32) . EC 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . ********* 75 - 3 (80,-32) . ES 20 - 3 (60,-32) . 0 - 3 (100,-32) . ********* 300 - 4 (200,-48) . AD 150 - 3 (100,-32) . GES 20 - 3 (80,-32) . 0 - 3 (120,-32) . 20 - 3 (60,-32) . 0 - 3 (140,-32) . ********* 200 - 2 (40,-32) . GEC 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . ********* 200 - 1 (60,-32) . HC 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . ********* 100 - 3 (60,-32) . ES 20 - 3 (40,-32) . 0 - 3 (80,-32) . ********* 200 - 4 (80,-48) . AD 200 - 3 (220,-32) . ES 20 - 3 (200,-32) . 0 - 3 (240,-32) . ********* 350 - 1 (60,-32) . HC 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . 30 - 1 (60,-32) . ********* 200 - 2 (40,-32) . GEC 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . ********* 100 - 2 (260,-32) . GEC 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . ********* 150 - 1 (60,-32) . HC 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . 80 - 1 (60,-32) . ********* 200 - 3 (110,-32) . GGES 20 - 3 (90,-32) . 0 - 3 (130,-32) . 20 - 3 (70,-32) . 0 - 3 (150,-32) . 20 - 3 (50,-32) . 0 - 3 (170,-32) . ********* 150 - 3 (190,-32) . GGES 20 - 3 (170,-32) . 0 - 3 (210,-32) . 20 - 3 (150,-32) . 0 - 3 (230,-32) . 20 - 3 (130,-32) . 0 - 3 (250,-32) . ********* 20 - 4 (80,-48) . AD 300 - 5 (100,-32) . FS 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . ********* 30 - 5 (220,-32) . FS 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 100 - 5 (100,-32) . FS 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . ********* 30 - 5 (220,-32) . FS 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 300 - 6 (125,-60) . BOSS 1 300 - 0 (6,2) . STAGE 2 *** 20 - 7 (40,-32) . MI 35 - 7 (80,-32) . 45- 7 (230,-32) . 40 - 7 (120,-32) . 30 - 7 (200,-32) . 55 - 7 (90,-32) . 60 - 7 (240,-32) . 45 - 7 (60,-32) . 30 - 7 (150,-32) . 45 - 7 (100,-32) . 60 - 7 (180,-32) . 20 - 7 (30,-32) . 20 - 7 (260,-32) . 30 - 7 (130,-32) . 30 - 7 (220,-32) . 55 - 7 (60,-32) . 60 - 7 (140,-32) . 45 - 7 (35,-32) . 30 - 7 (110,-32) . 60 - 7 (220,-32) . 30 - 7 (160,-32) . ********* 50 - 2 (260,-32) . EC 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . ********* 20 - 8 (40,-32) . SH 20 - 2 (40,-32) . EC 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . ********* 50 - 2 (260,-32) . EC 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . ********* 30 - 4 (60,-48) . AD 120 - 8 (260,-32) . SH 40 - 3 (200,-32) . GES 20 - 3 (180,-32) . 0 - 3 (220,-32) . 20 - 3 (160,-32) . 0 - 3 (240,-32) . ********* 100 - 8 (40,-32) . SH 100 - 3 (100,-32) . GES 20 - 3 (80,-32) . 0 - 3 (120,-32) . 20 - 3 (60,-32) . 0 - 3 (140,-32) . ********* 20 - 2 (40,-32) . EC 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . 30 - 2 (40,-32) . ********* 20 - 8 (260,-32) . SH 20 - 9 (130,-42) . MIC 180 - 9 (40,-42) . 0 - 9 (220,-42) . 80 - 8 (260,-32) . SH 80 - 8 (40,-32) . SH 230 - 9 (80,-42) . 0 - 9 (180,-42) . 120 - 8 (260,-32) . SH 120 - 8 (40,-32) . SH 20 - 9 (130,-42) . ********* 300 - 4 (130,-48) . AD 150 - 2 (260,-32) . EC 30 - 2 (260,-32) . 30 - 2 (260,-32) . 30 - 2 (260,-32) . ********* 100 - 3 (60,-32) . ES 20 - 3 (40,-32) . 0 - 3 (80,-32) . ********* 200 - 5 (220,-32) . FS 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (220,-32) . 30 - 5 (100,-32) . FS 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . 30 - 5 (100,-32) . ********* 300 - 10 (105,-52) . BOSS 2 10 - 0 (6,3) . STAGE 3 *** 300 - 11 (260,232) . RES 30 - 11 (260,232) . 30 - 11 (260,232) . ********* 100 - 11 (40,232) . RES 30 - 11 (40,232) . 30 - 11 (40,232) . ********* 60 - 8 (260,-32) . SH 80 - 11 (40,232) . RES 30 - 11 (40,232) . 30 - 11 (40,232) . ********* 100 - 11 (260,232) . RES 30 - 11 (260,232) . 30 - 11 (260,232) . ********* 60 - 8 (40,-32) . SH -1 - 0 (0,0) . END dd2-0.2.2/src/data/dd2-hiscore0000644000175000017500000000021610052427242015513 0ustar reidracreidracnobody:10:10000 nobody:9:9000 nobody:8:8000 nobody:7:7000 nobody:6:6000 nobody:5:5000 nobody:4:4000 nobody:3:3000 nobody:2:2000 nobody:1:1000 dd2-0.2.2/src/data/0000777000175000017500000000000010661102550013470 5ustar reidracreidracdd2-0.2.2/src/Makefile.am0000644000175000017500000000053210051450637014614 0ustar reidracreidracSUBDIRS = data AUTOMAKE_OPTIONS = no-dependencies bin_PROGRAMS = dd2 dd2_SOURCES = menu.c SDL_plus.c cfg.c engine.c control.c engine.h control.h cfg.h SDL_plus.h menu.h main.c main.h EXTRA_DIST = menu.c SDL_plus.c cfg.c engine.c control.c engine.h control.h cfg.h SDL_plus.h menu.h main.c main.h AM_CFLAGS = -DDD2_DATA=\"$(pkgdatadir)\" -Wall dd2-0.2.2/src/Makefile.in0000644000175000017500000002453610661102505014632 0ustar reidracreidrac# Makefile.in generated automatically by automake 1.4-p6 from Makefile.am # Copyright (C) 1994, 1995-8, 1999, 2001 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. SHELL = @SHELL@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ prefix = @prefix@ exec_prefix = @exec_prefix@ bindir = @bindir@ sbindir = @sbindir@ libexecdir = @libexecdir@ datadir = @datadir@ sysconfdir = @sysconfdir@ sharedstatedir = @sharedstatedir@ localstatedir = @localstatedir@ libdir = @libdir@ infodir = @infodir@ mandir = @mandir@ includedir = @includedir@ oldincludedir = /usr/include DESTDIR = pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = .. ACLOCAL = @ACLOCAL@ AUTOCONF = @AUTOCONF@ AUTOMAKE = @AUTOMAKE@ AUTOHEADER = @AUTOHEADER@ INSTALL = @INSTALL@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ $(AM_INSTALL_PROGRAM_FLAGS) INSTALL_DATA = @INSTALL_DATA@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ transform = @program_transform_name@ NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : CC = @CC@ MAKEINFO = @MAKEINFO@ PACKAGE = @PACKAGE@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ VERSION = @VERSION@ SUBDIRS = data AUTOMAKE_OPTIONS = no-dependencies bin_PROGRAMS = dd2 dd2_SOURCES = menu.c SDL_plus.c cfg.c engine.c control.c engine.h control.h cfg.h SDL_plus.h menu.h main.c main.h EXTRA_DIST = menu.c SDL_plus.c cfg.c engine.c control.c engine.h control.h cfg.h SDL_plus.h menu.h main.c main.h AM_CFLAGS = -DDD2_DATA=\"$(pkgdatadir)\" -Wall mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = PROGRAMS = $(bin_PROGRAMS) DEFS = @DEFS@ -I. -I$(srcdir) CPPFLAGS = @CPPFLAGS@ LDFLAGS = @LDFLAGS@ LIBS = @LIBS@ dd2_OBJECTS = menu.o SDL_plus.o cfg.o engine.o control.o main.o dd2_LDADD = $(LDADD) dd2_DEPENDENCIES = dd2_LDFLAGS = CFLAGS = @CFLAGS@ COMPILE = $(CC) $(DEFS) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(LDFLAGS) -o $@ DIST_COMMON = Makefile.am Makefile.in DISTFILES = $(DIST_COMMON) $(SOURCES) $(HEADERS) $(TEXINFOS) $(EXTRA_DIST) TAR = tar GZIP_ENV = --best SOURCES = $(dd2_SOURCES) OBJECTS = $(dd2_OBJECTS) all: all-redirect .SUFFIXES: .SUFFIXES: .S .c .o .s $(srcdir)/Makefile.in: Makefile.am $(top_srcdir)/configure.in $(ACLOCAL_M4) cd $(top_srcdir) && $(AUTOMAKE) --gnu src/Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status cd $(top_builddir) \ && CONFIG_FILES=$(subdir)/$@ CONFIG_HEADERS= $(SHELL) ./config.status mostlyclean-binPROGRAMS: clean-binPROGRAMS: -test -z "$(bin_PROGRAMS)" || rm -f $(bin_PROGRAMS) distclean-binPROGRAMS: maintainer-clean-binPROGRAMS: install-binPROGRAMS: $(bin_PROGRAMS) @$(NORMAL_INSTALL) $(mkinstalldirs) $(DESTDIR)$(bindir) @list='$(bin_PROGRAMS)'; for p in $$list; do \ if test -f $$p; then \ echo " $(INSTALL_PROGRAM) $$p $(DESTDIR)$(bindir)/`echo $$p|sed 's/$(EXEEXT)$$//'|sed '$(transform)'|sed 's/$$/$(EXEEXT)/'`"; \ $(INSTALL_PROGRAM) $$p $(DESTDIR)$(bindir)/`echo $$p|sed 's/$(EXEEXT)$$//'|sed '$(transform)'|sed 's/$$/$(EXEEXT)/'`; \ else :; fi; \ done uninstall-binPROGRAMS: @$(NORMAL_UNINSTALL) list='$(bin_PROGRAMS)'; for p in $$list; do \ rm -f $(DESTDIR)$(bindir)/`echo $$p|sed 's/$(EXEEXT)$$//'|sed '$(transform)'|sed 's/$$/$(EXEEXT)/'`; \ done .c.o: $(COMPILE) -c $< .s.o: $(COMPILE) -c $< .S.o: $(COMPILE) -c $< mostlyclean-compile: -rm -f *.o core *.core clean-compile: distclean-compile: -rm -f *.tab.c maintainer-clean-compile: dd2: $(dd2_OBJECTS) $(dd2_DEPENDENCIES) @rm -f dd2 $(LINK) $(dd2_LDFLAGS) $(dd2_OBJECTS) $(dd2_LDADD) $(LIBS) # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. @SET_MAKE@ all-recursive install-data-recursive install-exec-recursive \ installdirs-recursive install-recursive uninstall-recursive \ check-recursive installcheck-recursive info-recursive dvi-recursive: @set fnord $(MAKEFLAGS); amf=$$2; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" mostlyclean-recursive clean-recursive distclean-recursive \ maintainer-clean-recursive: @set fnord $(MAKEFLAGS); amf=$$2; \ dot_seen=no; \ rev=''; list='$(SUBDIRS)'; for subdir in $$list; do \ rev="$$subdir $$rev"; \ test "$$subdir" != "." || dot_seen=yes; \ done; \ test "$$dot_seen" = "no" && rev=". $$rev"; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done tags: TAGS ID: $(HEADERS) $(SOURCES) $(LISP) list='$(SOURCES) $(HEADERS)'; \ unique=`for i in $$list; do echo $$i; done | \ awk ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ here=`pwd` && cd $(srcdir) \ && mkid -f$$here/ID $$unique $(LISP) TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) $(LISP) tags=; \ here=`pwd`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -f $$subdir/TAGS && tags="$$tags -i $$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS)'; \ unique=`for i in $$list; do echo $$i; done | \ awk ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(ETAGS_ARGS)$$unique$(LISP)$$tags" \ || (cd $(srcdir) && etags -o $$here/TAGS $(ETAGS_ARGS) $$tags $$unique $(LISP)) mostlyclean-tags: clean-tags: distclean-tags: -rm -f TAGS ID maintainer-clean-tags: distdir = $(top_builddir)/$(PACKAGE)-$(VERSION)/$(subdir) subdir = src distdir: $(DISTFILES) @for file in $(DISTFILES); do \ d=$(srcdir); \ if test -d $$d/$$file; then \ cp -pr $$d/$$file $(distdir)/$$file; \ else \ test -f $(distdir)/$$file \ || ln $$d/$$file $(distdir)/$$file 2> /dev/null \ || cp -p $$d/$$file $(distdir)/$$file || :; \ fi; \ done for subdir in $(SUBDIRS); do \ if test "$$subdir" = .; then :; else \ test -d $(distdir)/$$subdir \ || mkdir $(distdir)/$$subdir \ || exit 1; \ chmod 777 $(distdir)/$$subdir; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir=../$(top_distdir) distdir=../$(distdir)/$$subdir distdir) \ || exit 1; \ fi; \ done info-am: info: info-recursive dvi-am: dvi: dvi-recursive check-am: all-am check: check-recursive installcheck-am: installcheck: installcheck-recursive install-exec-am: install-binPROGRAMS install-exec: install-exec-recursive install-data-am: install-data: install-data-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am install: install-recursive uninstall-am: uninstall-binPROGRAMS uninstall: uninstall-recursive all-am: Makefile $(PROGRAMS) all-redirect: all-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) AM_INSTALL_PROGRAM_FLAGS=-s install installdirs: installdirs-recursive installdirs-am: $(mkinstalldirs) $(DESTDIR)$(bindir) mostlyclean-generic: clean-generic: distclean-generic: -rm -f Makefile $(CONFIG_CLEAN_FILES) -rm -f config.cache config.log stamp-h stamp-h[0-9]* maintainer-clean-generic: mostlyclean-am: mostlyclean-binPROGRAMS mostlyclean-compile \ mostlyclean-tags mostlyclean-generic mostlyclean: mostlyclean-recursive clean-am: clean-binPROGRAMS clean-compile clean-tags clean-generic \ mostlyclean-am clean: clean-recursive distclean-am: distclean-binPROGRAMS distclean-compile distclean-tags \ distclean-generic clean-am distclean: distclean-recursive maintainer-clean-am: maintainer-clean-binPROGRAMS \ maintainer-clean-compile maintainer-clean-tags \ maintainer-clean-generic distclean-am @echo "This command is intended for maintainers to use;" @echo "it deletes files that may require special tools to rebuild." maintainer-clean: maintainer-clean-recursive .PHONY: mostlyclean-binPROGRAMS distclean-binPROGRAMS clean-binPROGRAMS \ maintainer-clean-binPROGRAMS uninstall-binPROGRAMS install-binPROGRAMS \ mostlyclean-compile distclean-compile clean-compile \ maintainer-clean-compile install-data-recursive \ uninstall-data-recursive install-exec-recursive \ uninstall-exec-recursive installdirs-recursive uninstalldirs-recursive \ all-recursive check-recursive installcheck-recursive info-recursive \ dvi-recursive mostlyclean-recursive distclean-recursive clean-recursive \ maintainer-clean-recursive tags tags-recursive mostlyclean-tags \ distclean-tags clean-tags maintainer-clean-tags distdir info-am info \ dvi-am dvi check check-am installcheck-am installcheck install-exec-am \ install-exec install-data-am install-data install-am install \ uninstall-am uninstall all-redirect all-am all installdirs-am \ installdirs mostlyclean-generic distclean-generic clean-generic \ maintainer-clean-generic clean mostlyclean distclean maintainer-clean # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: dd2-0.2.2/src/menu.c0000644000175000017500000003256310660375243013706 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include"SDL.h" #include"SDL_mixer.h" #include"menu.h" #include"engine.h" #include"cfg.h" #include"control.h" #include"SDL_plus.h" extern SDL_Surface *screen, *gfx; extern SDL_Joystick *joy[2]; extern Mix_Chunk *efx[8]; extern Mix_Music *bgm; extern int sound; extern pDesc player[2]; extern score hiscore[10]; extern cfg conf; extern float scroll,scroll2; void soundLoad(void); void drawGetName(char *name, int place, int playern) { char buffer[64]; /* erase the screen */ SDL_FillRect(screen,NULL,SDL_MapRGB(screen->format,0,0,0)); writeCString(gfx, screen, 90, 40, "congratulations", 0); sprintf(buffer,"player %i with score %.6li",playern,player[playern-1].score); writeCString(gfx, screen, 10, 80, buffer, 1); switch(place) { default: sprintf(buffer,"you got %ith place",place); break; case 1: sprintf(buffer,"you got %ist place",place); break; case 2: sprintf(buffer,"you got %ind place",place); break; case 3: sprintf(buffer,"you got %ird place",place); break; } writeCString(gfx, screen, 10, 97, buffer, 1); writeCString(gfx, screen, 10, 131, "enter your name", 0); if(name[0]) sprintf(buffer,"%s+",name); else strcpy(buffer,"+"); writeCString(gfx, screen, 175, 131, buffer, 1); SDL_Flip(screen); } int getName(char *name, int place, int playern) { Uint32 tick; SDL_Event mevent; int pos=0, i=0; char ckey='a'; if(joy[playern-1] && player[playern-1].joy) { name[pos]=ckey; name[pos+1]=0; } drawGetName(name,place,playern); tick=SDL_GetTicks(); while(1) { while(SDL_PollEvent(&mevent)) { if (mevent.type==SDL_QUIT) return 0; /* joystick control */ if(joy[playern-1] && player[playern-1].joy) { SDL_JoystickUpdate(); i=SDL_JoystickGetAxis(joy[playern-1],1); if(i>4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_DOWN; } if(i<-4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_UP; } i=SDL_JoystickGetAxis(joy[playern-1],0); if(i>4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_RIGHT; } if(SDL_JoystickGetButton(joy[playern-1], 0)) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_RETURN; } if(SDL_JoystickGetButton(joy[playern-1], 1)) { pos++; mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_BACKSPACE; } } if(mevent.type==SDL_KEYDOWN) { if(mevent.key.keysym.sym==SDLK_ESCAPE) { if(!name[0]) strcpy(name,"nobody"); return 1; } if(mevent.key.keysym.sym==SDLK_DOWN) { ckey--; if(ckey<'0') ckey='z'; if(ckey+1=='a') ckey='9'; name[pos]=ckey; name[pos+1]=0; drawGetName(name,place,playern); continue; } if(mevent.key.keysym.sym==SDLK_UP) { ckey++; if(ckey>'z') ckey='0'; if(ckey-1=='9') ckey='a'; name[pos]=ckey; name[pos+1]=0; drawGetName(name,place,playern); continue; } if(mevent.key.keysym.sym==SDLK_RIGHT) { if(pos<8) { name[pos]=ckey; pos++; name[pos]=0; drawGetName(name,place,playern); ckey='a'; continue; } } if(mevent.key.keysym.sym==SDLK_RETURN) if(name[0]) { /* pirutupiiii */ if(sound && efx[7]) Mix_PlayChannel(-1,efx[7],0); return 1; } if(mevent.key.keysym.sym==SDLK_BACKSPACE) { if(pos>0) { pos--; name[pos]=0; drawGetName(name,place,playern); } continue; } /* I don't know if this will work ever, in my system does */ if((mevent.key.keysym.sym>=SDLK_a && mevent.key.keysym.sym<=SDLK_z) || (mevent.key.keysym.sym>=SDLK_0 && mevent.key.keysym.sym<=SDLK_9)) { if(pos<8) { name[pos]=SDLK2ascii(mevent.key.keysym.sym); pos++; name[pos]=0; drawGetName(name,place,playern); ckey='a'; } } } } } return 0; } void drawHiscores(int max) { int i; SDL_Rect a,b; /* erase the screen */ SDL_FillRect(screen,NULL,SDL_MapRGB(screen->format,0,0,0)); /* DD2 characters */ a.x=60; a.y=5; b.x=450; b.y=43; b.w=211; b.h=190; SDL_BlitSurface(gfx, &b, screen, &a); /* header */ writeCString(gfx, screen, 80, 2, "the hall of fame", 1); for(i=0;i10000) { /* pirutupiiii */ if(sound && efx[7]) Mix_PlayChannel(-1,efx[7],0); return 1; } } return 0; } void drawConfigure(int option) { /* erase the screen */ SDL_FillRect(screen,NULL,SDL_MapRGB(screen->format,0,0,0)); /* options */ writeCString(gfx, screen, 20, 20, "player 1", 0); if(conf.control[0]==KEYBOARD) writeCString(gfx, screen, 20, 37, " keyboard", (option==1)); else writeCString(gfx, screen, 20, 37, " joystick 1", (option==1)); writeCString(gfx, screen, 20, 54, "player 2", 0); if(conf.control[1]==KEYBOARD) writeCString(gfx, screen, 20, 71, " keyboard", (option==2)); else writeCString(gfx, screen, 20, 71, " joystick 2", (option==2)); writeCString(gfx, screen, 20, 105, "sound", 0); switch(conf.sound) { default: case SOUND_HI: writeCString(gfx, screen, 20, 122, " high quality", (option==3)); break; case SOUND_MED: writeCString(gfx, screen, 20, 122, " medium quality", (option==3)); break; case SOUND_LOW: writeCString(gfx, screen, 20, 122, " low quality", (option==3)); break; case NO_SOUND: writeCString(gfx, screen, 20, 122, " no sound", (option==3)); break; } writeCString(gfx, screen, 20, 139, "graphic mode", 0); if(conf.fullscreen) writeCString(gfx, screen, 20, 156, " fullscreen", (option==4)); else writeCString(gfx, screen, 20, 156, " windowed", (option==4)); SDL_Flip(screen); } int configure() { SDL_Event mevent; int option=1,i; drawConfigure(option); while(1) { while(SDL_PollEvent(&mevent)) { if (mevent.type==SDL_QUIT) return 0; /* joystick control for the menu */ if(joy[0]) { SDL_JoystickUpdate(); i=SDL_JoystickGetAxis(joy[0],1); if(i>4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_DOWN; } if(i<-4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_UP; } if(SDL_JoystickGetButton(joy[0], 0)) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_RETURN; } if(SDL_JoystickGetButton(joy[0], 1)) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_ESCAPE; } } if(mevent.type==SDL_KEYDOWN) { if(mevent.key.keysym.sym==SDLK_ESCAPE) return 1; if(mevent.key.keysym.sym==SDLK_DOWN || mevent.key.keysym.sym==SDLK_s) { option++; if(option>4) option=1; drawConfigure(option); } if(mevent.key.keysym.sym==SDLK_UP || mevent.key.keysym.sym==SDLK_w) { option--; if(option<1) option=4; drawConfigure(option); } if(mevent.key.keysym.sym==SDLK_RETURN) { switch(option) { default: break; case 1: if(joy[0]) { conf.control[0]=conf.control[0] ? 0 : 1; drawConfigure(option); } break; case 2: if(joy[1]) { conf.control[1]=conf.control[1] ? 0 : 1; drawConfigure(option); } break; case 3: conf.sound--; if(conf.sound<0) conf.sound=3; if(sound) { if(bgm) { Mix_FreeMusic(bgm); bgm=NULL; } for(i=0;iformat,0,0,0)); /* BETA */ a.x=77; a.y=20; b.x=100; b.y=46; b.w=166; b.h=15; SDL_BlitSurface(gfx, &b, screen, &a); /* options */ writeCString(gfx, screen, 105, 50, "one player", (option==1)); writeCString(gfx, screen, 105, 67, "two players", (option==2)); writeCString(gfx, screen, 105, 94, "hall of fame", (option==3)); writeCString(gfx, screen, 105, 111, "configure", (option==4)); writeCString(gfx, screen, 105, 138, "about", (option==5)); writeCString(gfx, screen, 105, 155, "exit game", (option==6)); /* some credit */ a.x=154; a.y=184; b.x=268; b.y=57; b.w=166; b.h=16; SDL_BlitSurface(gfx, &b, screen, &a); SDL_Flip(screen); } int menu() { SDL_Event mevent; int option=1, i; /* pirutupiiii */ if(efx[7]) Mix_PlayChannel(-1,efx[7],0); drawMenu(option); /* some dirty init */ scroll=scroll2=0; while(1) { while(SDL_PollEvent(&mevent)) { if (mevent.type==SDL_QUIT) return 0; /* joystick control for the menu */ if(joy[0]) { SDL_JoystickUpdate(); i=SDL_JoystickGetAxis(joy[0],1); if(i>4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_DOWN; } if(i<-4200) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_UP; } if(SDL_JoystickGetButton(joy[0], 0)) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_RETURN; } if(SDL_JoystickGetButton(joy[0], 1)) { mevent.type=SDL_KEYDOWN; mevent.key.keysym.sym=SDLK_ESCAPE; } } if(mevent.type==SDL_KEYDOWN) { if(mevent.key.keysym.sym==SDLK_ESCAPE) return 0; if(mevent.key.keysym.sym==SDLK_DOWN || mevent.key.keysym.sym==SDLK_s) { option++; if(option>6) option=1; drawMenu(option); } if(mevent.key.keysym.sym==SDLK_UP || mevent.key.keysym.sym==SDLK_w) { option--; if(option<1) option=6; drawMenu(option); } if(mevent.key.keysym.sym==SDLK_RETURN) { switch(option) { default: break; case 1: player[0].shield=10; player[1].shield=0; player[0].score=player[1].score=0; player[0].stage=player[1].stage=0; return 1; case 2: player[0].shield=10; player[1].shield=10; player[0].score=player[1].score=0; player[0].stage=player[1].stage=0; return 1; case 3: if(!hiscores()) return 0; drawMenu(option); break; case 4: if(!configure()) return 0; drawMenu(option); break; case 5: if(!credits()) return 0; drawMenu(option); break; case 6: return 0; break; } } } } } return 0; } void drawCredits() { SDL_Rect a,b; /* erase the screen */ SDL_FillRect(screen,NULL,SDL_MapRGB(screen->format,0,0,0)); /* BETA */ a.x=77; a.y=20; b.x=100; b.y=46; b.w=166; b.h=15; SDL_BlitSurface(gfx, &b, screen, &a); writeCString(gfx, screen, 20, 50, "this is dd2 version " VERSION ".", 0); writeCString(gfx, screen, 20, 80, "main author", 1); writeCString(gfx, screen, 40, 105, "juan j. martinez", 0); writeCString(gfx, screen, 40, 140, "thanks you for playing...", 0); SDL_Flip(screen); } int credits() { Uint32 tick; SDL_Event mevent; drawCredits(); tick=SDL_GetTicks(); while(1) { while(SDL_PollEvent(&mevent)) { if (mevent.type==SDL_QUIT) return 0; if(mevent.type==SDL_KEYDOWN) { return 1; } } /* wait some time and return */ if(SDL_GetTicks()-tick>10000) { /* pirutupiiii */ if(sound && efx[7]) Mix_PlayChannel(-1,efx[7],0); return 1; } } return 0; } dd2-0.2.2/src/SDL_plus.c0000644000175000017500000001324010660375273014421 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include"SDL_plus.h" #include SDL_Surface * loadBMP(char *file) { SDL_Surface *a,*b; a=SDL_LoadBMP(file); if(!a) return NULL; b=SDL_DisplayFormat(a); if(!b) return NULL; SDL_FreeSurface(a); return b; } void writeNumber(SDL_Surface *src, SDL_Surface *dst, int x, int y, int number, int padd) { SDL_Rect a,b; char buffer[32],fmt[16]; int i; sprintf(fmt,"%%.%ii",padd); sprintf(buffer,fmt,number); a.y=y; a.w=8; a.h=12; b.y=73; b.w=8; b.h=12; for(i=0;i0) a.x+=12; } return; } /* ugly!!!! needs review */ char SDLK2ascii(int sym) { switch(sym) { default: break; case SDLK_a: return 'a'; case SDLK_b: return 'b'; case SDLK_c: return 'c'; case SDLK_d: return 'd'; case SDLK_e: return 'e'; case SDLK_f: return 'f'; case SDLK_g: return 'g'; case SDLK_h: return 'h'; case SDLK_i: return 'i'; case SDLK_j: return 'j'; case SDLK_k: return 'k'; case SDLK_l: return 'l'; case SDLK_m: return 'm'; case SDLK_n: return 'n'; case SDLK_o: return 'o'; case SDLK_p: return 'p'; case SDLK_q: return 'q'; case SDLK_r: return 'r'; case SDLK_s: return 's'; case SDLK_t: return 't'; case SDLK_u: return 'u'; case SDLK_v: return 'v'; case SDLK_w: return 'w'; case SDLK_x: return 'x'; case SDLK_y: return 'y'; case SDLK_z: return 'z'; case SDLK_0: return '0'; case SDLK_1: return '1'; case SDLK_2: return '2'; case SDLK_3: return '3'; case SDLK_4: return '4'; case SDLK_5: return '5'; case SDLK_6: return '6'; case SDLK_7: return '7'; case SDLK_8: return '8'; case SDLK_9: return '9'; } return ' '; } dd2-0.2.2/src/cfg.c0000644000175000017500000000535210660375060013472 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include "cfg.h" int loadCFG(char *path, cfg *c) { FILE *f; char buffer[512]; /* defaults */ c->sound=SOUND_HI; c->control[0]=KEYBOARD; c->control[1]=KEYBOARD; c->fullscreen=0; f=fopen(path,"rt"); if(!f) return 0; if(fscanf(f,"%511[^\n]\n",buffer)!=1) { fclose(f); return 0; } if(strcmp(buffer,"BEGIN")) { fclose(f); return 0; } if(fscanf(f,"SOUND=%i\nCONTROL_1=%i\nCONTROL_2=%i\nFULL_SCREEN=%i\n", &c->sound,&c->control[0],&c->control[1], &c->fullscreen)!=4) { fclose(f); return 0; } if(fscanf(f,"%511[^\n]\n",buffer)!=1) { fclose(f); return 0; } if(strcmp(buffer,"END")) { fclose(f); return 0; } fclose(f); return 1; } int saveCFG(char *path, cfg *c) { FILE *f; f=fopen(path,"wt"); if(!f) return 0; fprintf(f,"BEGIN\n"); fprintf(f,"SOUND=%i\nCONTROL_1=%i\nCONTROL_2=%i\nFULL_SCREEN=%i\n", c->sound,c->control[0],c->control[1], c->fullscreen); fprintf(f,"END\n"); fclose(f); return 1; } int loadScore(char *path, score *hisc) { FILE *f; int i,j; score swp; /* init to defaults */ for(i=0;i<10;i++) { strcat(hisc[i].name,"nobody"); hisc[i].stage=10-i; hisc[i].score=10000-(i*1000); } f=fopen(path,"rt"); if(!f) return 0; for(i=0;i<10;i++) if(fscanf(f,"%8[^:]:%i:%i\n", hisc[i].name, &hisc[i].stage, &hisc[i].score)!=3) { fclose(f); return 0; } fclose(f); /* it's needed the score is ordered */ for(i=0;i<9;i++) for(j=i;j<10;j++) { if(hisc[i].score This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #define _ENGINE_CORE_ #include"main.h" #include"engine.h" #include"SDL_plus.h" #include"SDL_mixer.h" #include #include #include extern SDL_Surface *screen, *gfx; extern Mix_Chunk *efx[2]; extern Mix_Music *bgm, *bgm_boss; extern int sound; int firstInit=0; bool boss=false; pDesc player[2]; fDesc fire[256]; fDesc *ffree=fire, *fused=NULL; vDesc vefx[256]; vDesc *vfree=vefx, *vused=NULL; oDesc objects[16]; oDesc *ofree=objects, *oused=NULL; eDesc enemy[64]; eDesc *efree=enemy, *eused=NULL; long int actCnt=0, actIdx=0; struct actionStruct { long int a; int type; int x,y; } *act=NULL; void engine_init() { int i,j; FILE *fd; char comm[32]; char buffer[512]; /* that should be init once */ if(!firstInit) { player[0].f=(SDL_Rect *)malloc(sizeof(SDL_Rect)*2); if(!player[0].f) { fprintf(stderr,"ENGINE_ERROR: memory\n"); exit(-1); } player[1].f=(SDL_Rect *)malloc(sizeof(SDL_Rect)*2); if(!player[1].f) { fprintf(stderr,"ENGINE_ERROR: memory\n"); exit(-1); } player[0].f[0].x=2; player[0].f[0].y=2; player[0].f[0].w=20; player[0].f[0].h=20; player[0].f[1].x=24; player[0].f[1].y=2; player[0].f[1].w=20; player[0].f[1].h=20; player[0].nf=2; /* player[0].joy=0; */ player[0].keys[0]=SDLK_LEFT; player[0].keys[1]=SDLK_RIGHT; player[0].keys[2]=SDLK_UP; player[0].keys[3]=SDLK_DOWN; #ifndef ALT_FIRE player[0].keys[4]=SDLK_RCTRL; #else player[0].keys[4]=SDLK_m; #endif player[1].f[0].x=2; player[1].f[0].y=24; player[1].f[0].w=20; player[1].f[0].h=20; player[1].f[1].x=24; player[1].f[1].y=24; player[1].f[1].w=20; player[1].f[1].h=20; player[1].nf=2; /* player[1].joy=0; */ player[1].keys[0]=SDLK_a; player[1].keys[1]=SDLK_d; player[1].keys[2]=SDLK_w; player[1].keys[3]=SDLK_s; player[1].keys[4]=SDLK_LCTRL; firstInit=1; } /* now follows the stuff that must be setup each play */ player[0].cf=0; player[0].score=0; //player[0].shield=0; player[0].weapon=0; player[0].level=0; player[0].x=100; player[0].y=160; player[0].incx=0; player[0].incy=0; player[0].fire=0; player[0].firef=0; player[0].ftime=2; player[0].cftime=0; player[0].companion=0; player[0].t=0; player[0].cinc=1; /* ********************* */ player[1].cf=0; player[1].score=0; //player[1].shield=0; player[1].weapon=0; player[1].level=0; player[1].x=200; player[1].y=160; player[1].incx=0; player[1].incy=0; player[1].fire=0; player[1].firef=0; player[1].ftime=2; player[1].cftime=0; player[1].companion=0; player[1].t=0; player[1].cinc=1; /* ********************* */ for(i=0;i<64;i++) enemy[i].n=&enemy[i+1]; enemy[i].n=NULL; for(i=0;i<256;i++) { fire[i].n=&fire[i+1]; vefx[i].n=&vefx[i+1]; } fire[i].n=NULL; vefx[i].n=NULL; for(i=0;i<15;i++) objects[i].n=&objects[i+1]; objects[i].n=NULL; ffree=fire; fused=NULL; vfree=vefx; vused=NULL; ofree=objects; oused=NULL; efree=enemy; eused=NULL; actCnt=0; actIdx=0; /* load the actions */ sprintf(buffer,"%s/game.act",DD2_DATA); fd=fopen(buffer,"rt"); if(!fd) { fprintf(stderr,"ENGINE_ERROR: unable to open act file\n"); exit(-1); } if(fscanf(fd,"ITEMS=%i\n",&j)!=1) { fprintf(stderr,"ENGINE_ERROR: bad act file, error at line 1\n"); exit(-1); } if(act) free(act); act=(struct actionStruct *)malloc(sizeof(struct actionStruct)*j); if(!act) { fprintf(stderr,"ENGINE_ERROR: memory\n"); exit(-1); } for(i=0;iy+=0.25; if(ot->ftime) ot->ftime--; else { ot->ftime=10; ot->cf=ot->cf ? 0 : 1; if(ot->y>SCREENH) { if(ot==oused) { otp=ofree; ofree=oused; oused=oused->n; ofree->n=otp; otp=ot=oused; continue; } else { otp->n=ot->n; ot->n=ofree; ofree=ot; ot=otp->n; continue; } } } a.x=ot->x; a.y=ot->y; b.w=20; b.h=20; switch(ot->type) { default: case OBJ_SHIELD: b.x=200; b.y=24; break; case OBJ_WEAPON1: b.x=90; b.y=24; break; case OBJ_WEAPON2: b.x=112; b.y=24; break; case OBJ_WEAPON3: b.x=134; b.y=24; break; case OBJ_COMPANION: b.x=178; b.y=24; break; } SDL_BlitSurface(gfx, &b, screen, &a); if(ot->cf) { b.x=68; b.y=24; SDL_BlitSurface(gfx, &b, screen, &a); } for(i=0;i<2;i++) if(player[i].shield) if(ot->x+10>player[i].x && ot->x+10y+10>player[i].y && ot->y+10type) { default: break; case OBJ_SHIELD: if(player[i].shield<10) { player[i].shield+=3; if(player[i].shield>10) player[i].shield=10; engine_add_vefx(VFX_SHUP,ot->x,ot->y); } else { player[i].score+=300; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); } break; case OBJ_WEAPON1: if(player[i].weapon!=0) { player[i].weapon=0; player[i].level--; if(player[i].level<0) player[i].level=0; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { if(player[i].level<4) { player[i].level++; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { player[i].score+=100; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); } } break; case OBJ_WEAPON2: if(player[i].weapon!=1) { player[i].weapon=1; player[i].level--; if(player[i].level<0) player[i].level=0; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { if(player[i].level<4) { player[i].level++; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { player[i].score+=100; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); } } break; case OBJ_WEAPON3: if(player[i].weapon!=2) { player[i].weapon=2; player[i].level--; if(player[i].level<0) player[i].level=0; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { if(player[i].level<4) { player[i].level++; engine_add_vefx(VFX_POW,ot->x,ot->y); } else { player[i].score+=100; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); } } break; case OBJ_COMPANION: if(!player[i].companion) { player[i].companion=1; player[i].t=0; player[i].cinc=1; circle_path(player[i].x+10,player[i].y+10,30,player[i].t,&player[i].cx,&player[i].cy); engine_add_vefx(VFX_POW,ot->x,ot->y); } else { player[i].score+=250; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); } break; } ot->y=SCREENW+20; } otp=ot; ot=ot->n; } } void engine_add_obj(int type, int x, int y) { oDesc *ot; if(ofree==NULL) { fprintf(stderr,"PANIC!!!! ofree reached limit\n"); exit(-1); } if(oused==NULL) { oused=ofree; ofree=ofree->n; oused->n=NULL; } else { ot=oused; oused=ofree; ofree=ofree->n; oused->n=ot; } oused->type=type; oused->x=x; oused->y=y; oused->ftime=10; oused->cf=0; } void engine_vefx() { vDesc *vt,*vtp; SDL_Rect a,b; /* process all the efx */ for(vtp=vt=vused;vt;) { if(vt->cftimeftime) vt->cftime++; else { vt->cftime=0; if(vt->cf+1==vt->nf) { if(vt==vused) { vtp=vfree; vfree=vused; vused=vused->n; vfree->n=vtp; vtp=vt=vused; continue; } else { vtp->n=vt->n; vt->n=vfree; vfree=vt; vt=vtp->n; continue; } } else vt->cf++; } if(vt->type!=VFX_STAGE) { a.x=vt->x; a.y=vt->y; b.x=vt->f[vt->cf].x; b.y=vt->f[vt->cf].y; b.w=vt->f[vt->cf].w; b.h=vt->f[vt->cf].h; SDL_BlitSurface(gfx, &b, screen, &a); } else { /* just the STAGE N banner */ char stage[16]; sprintf(stage,"stage %i",vt->y); writeCString(gfx, screen, 125, 1, stage, 0); } vtp=vt; vt=vt->n; } } void engine_add_vefx(int type, int x, int y) { vDesc *vt; if(vfree==NULL) { fprintf(stderr,"PANIC!!!! vfree reached limit\n"); exit(-1); } if(vused==NULL) { vused=vfree; vfree=vfree->n; vused->n=NULL; } else { vt=vused; vused=vfree; vfree=vfree->n; vused->n=vt; } vused->type=type; vused->x=x; vused->y=y; vused->cftime=0; switch(type) { default: case VFX_SHIELD: vused->ftime=4; vused->nf=4; vused->cf=0; vused->f[0].x=46; vused->f[0].y=2; vused->f[0].w=20; vused->f[0].h=20; vused->f[1]=vused->f[0]; vused->f[1].x=68; vused->f[2]=vused->f[0]; vused->f[2].x=90; vused->f[3]=vused->f[0]; vused->f[3].x=112; if(efx[3]) Mix_PlayChannel(-1,efx[3],0); break; case VFX_EXPLO: vused->ftime=4; vused->nf=4; vused->cf=0; vused->f[0].x=134; vused->f[0].y=2; vused->f[0].w=20; vused->f[0].h=20; vused->f[1]=vused->f[0]; vused->f[1].x=156; vused->f[2]=vused->f[0]; vused->f[2].x=178; vused->f[3]=vused->f[0]; vused->f[3].x=200; if(efx[6]) Mix_PlayChannel(-1,efx[6],0); break; case VFX_EXPLOB: vused->ftime=4; vused->nf=3; vused->cf=0; vused->f[0].x=222; vused->f[0].y=2; vused->f[0].w=20; vused->f[0].h=20; vused->f[1]=vused->f[0]; vused->f[1].x=244; vused->f[2]=vused->f[0]; vused->f[2].x=266; if(efx[4]) Mix_PlayChannel(-1,efx[4],0); break; case VFX_SHUP: vused->ftime=80; vused->nf=1; vused->cf=0; vused->f[0].x=222; vused->f[0].y=24; vused->f[0].w=45; vused->f[0].h=10; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); break; case VFX_POW: vused->ftime=80; vused->nf=1; vused->cf=0; vused->f[0].x=222; vused->f[0].y=35; vused->f[0].w=45; vused->f[0].h=10; if(efx[7]) Mix_PlayChannel(-1,efx[7],0); break; case VFX_STAGE: /* special vefx */ vused->ftime=250; vused->nf=1; vused->cf=0; if(player[0].shield) player[0].stage++; if(player[1].shield) player[1].stage++; break; case VFX_MEXPLO: engine_add_vefx(VFX_EXPLO, x-20, y); engine_add_vefx(VFX_EXPLO, x, y-20); engine_add_vefx(VFX_EXPLO, x, y+20); engine_add_vefx(VFX_EXPLO, x+20, y); break; } } void engine_add_fire(int from, int type, int x, int y, float incx, float incy, pDesc *p) { fDesc *ft; if(ffree==NULL) { fprintf(stderr,"PANIC!!!! ffree reached limit\n"); exit(-1); } if(fused==NULL) { fused=ffree; ffree=ffree->n; fused->n=NULL; } else { ft=fused; fused=ffree; ffree=ffree->n; fused->n=ft; } fused->own=from; fused->type=type; fused->x=x; fused->y=y; fused->incx=incx; fused->incy=incy; fused->cftime=0; fused->player=p; /* set speed */ switch(type) { default: case 0: fused->incx*=8; fused->incy*=8; fused->ftime=2; break; case 3: case 1: fused->incx*=10; fused->incy*=10; fused->ftime=2; break; case 2: fused->incx*=12; fused->incy*=12; fused->ftime=2; break; case 5: case 4: fused->incx*=4; fused->incy*=4; fused->ftime=2; break; case 6: fused->incx*=5; fused->incy*=5; fused->ftime=2; break; } } void engine_fire() { fDesc *ft,*ftp; eDesc *e; oDesc *o; SDL_Rect a,b; int i,j; /* process all the fires */ for(ftp=ft=fused;ft;) { if(ft->cftimeftime) ft->cftime++; else { ft->cftime=0; ft->x+=ft->incx; ft->y+=ft->incy; } /* check if goes out the screen */ if(ft->x<0 || ft->x>SCREENW || ft->y<0 || ft->y>SCREENH) { if(ft==fused) { ftp=ffree; ffree=fused; fused=fused->n; ffree->n=ftp; ftp=ft=fused; continue; } else { ftp->n=ft->n; ft->n=ffree; ffree=ft; ft=ftp->n; continue; } } /* walls */ if(ft->x<30 || ft->x>SCREENW-25) { engine_add_vefx(VFX_EXPLOB,ft->x-12,ft->y-12); ft->y=-20; } /* players */ if(ft->own!=1) { for(i=0,j=0;i<2;i++) if(player[i].shield) if(ft->x>player[i].x && ft->xy>player[i].y && ft->yx-12,ft->y-12); j++; player[i].shield--; if(player[i].shield) engine_add_vefx(VFX_SHIELD,player[i].x,player[i].y); else engine_add_vefx(VFX_EXPLO,player[i].x,player[i].y); } if(j) ft->y=-10; } /* enemies */ if(ft->own!=2) { for(e=eused; e; e=e->n) { if(e->shield) { if((e->hit)(e,ft->x+2,ft->y+2)) { engine_add_vefx(VFX_EXPLOB,ft->x-12,ft->y-12); ft->y=-20; e->shield--; if(!e->shield) { engine_add_vefx(VFX_EXPLO,e->x+6,e->y+6); ft->player->score+=e->score; if(e->type==6) engine_add_vefx(VFX_MEXPLO,e->x+46,e->y+26); if(e->type==10) engine_add_vefx(VFX_MEXPLO,e->x+55,e->y+26); } else ft->player->score+=e->score/(ft->player->level+1); } } } } /* object change */ if(ft->own!=2) { for(o=oused; o; o=o->n) if(ft->x+2>o->x && ft->x+2x+20 && ft->y+2>o->y && ft->y+2y+20) { if(o->typetype++; else o->type=OBJ_FIRST; engine_add_vefx(VFX_EXPLOB,ft->x-12,ft->y-12); ft->y=-20; } } /* companion */ if(ft->own!=1) { for(i=0;i<2;i++) if(player[i].shield && player[i].companion) if(ft->x+2>player[i].cx && ft->x+2y+2>player[i].cy && ft->y+2type) { default: case 0: b.x=47; b.y=24; b.w=5; b.h=10; break; case 1: b.x=53; b.y=24; b.w=5; b.h=10; break; case 2: b.x=59; b.y=24; b.w=5; b.h=10; break; case 3: b.x=47; b.y=35; b.w=5; b.h=9; break; case 4: b.x=58; b.y=36; b.w=4; b.h=4; break; case 5: b.x=734; b.y=1; b.w=5; b.h=5; break; case 6: b.x=740; b.y=1; b.w=5; b.h=6; break; } a.x=ft->x; a.y=ft->y; SDL_BlitSurface(gfx, &b, screen, &a); ftp=ft; ft=ft->n; } } void engine_player(pDesc *p) { SDL_Rect a,b; eDesc *e; /* calc move */ if(p->cftimeftime) p->cftime++; else { p->cftime=0; if(p->incx) { if(p->incx>0) { if(p->x+4x+=4; else { p->shield--; if(p->shield) engine_add_vefx(VFX_SHIELD,p->x,p->y); else engine_add_vefx(VFX_EXPLO,p->x,p->y); } } else { if(p->x-4>20) p->x-=4; else { p->shield--; if(p->shield) engine_add_vefx(VFX_SHIELD,p->x,p->y); else engine_add_vefx(VFX_EXPLO,p->x,p->y); } } } if(p->incy) { if(p->incy>0) { if(p->y+4y+=4; } else { if(p->y-4>40) p->y-=4; } } /* enemy hit */ for(e=eused; e; e=e->n) { if(e->shield) { /* just 4 point, player size hardcoded (!) */ if((e->hit)(e,p->x+5,p->y+5) || (e->hit)(e,p->x+15,p->y+5) || (e->hit)(e,p->x+15,p->y+15) || (e->hit)(e,p->x+5,p->y+15) ) { if(p->shield) engine_add_vefx(VFX_SHIELD,p->x,p->y); else engine_add_vefx(VFX_EXPLO,p->x,p->y); e->shield--; p->shield--; if(!e->shield) engine_add_vefx(VFX_EXPLO,e->x+6,e->y+6); } /* and companion */ if(p->companion) { if((e->hit)(e,p->cx+3,p->cy+3)) { engine_add_vefx(VFX_EXPLOB,p->cx-10,p->cy-10); e->shield--; p->companion=0; if(!e->shield) engine_add_vefx(VFX_EXPLO,e->x+6,e->y+6); } } } } /* fire */ if(p->fire==1) { p->fire++; if(p->firef!=0) p->firef=0; else p->firef=1; switch(p->weapon) { default: case 0: switch(p->level) { default: case 0: engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); break; case 1: if(p->firef) engine_add_fire(1,p->weapon,p->x+4,p->y,0,-1,p); else engine_add_fire(1,p->weapon,p->x+12,p->y,0,-1,p); break; case 2: if(p->firef) engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); break; case 3: if(p->firef) { engine_add_fire(1,p->weapon,p->x+4,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0,-1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); } break; case 4: if(p->firef) { engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y,-0.20,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.20,-1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+14,p->y,0.10,-1,p); } break; } if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 1: switch(p->level) { default: case 0: engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); break; case 1: if(p->firef) engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); else { engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y+8,-0.25,1,p); engine_add_fire(1,p->weapon,p->x+12,p->y+8,0.25,1,p); } break; case 2: if(p->firef) { engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y+8,-0.25,1,p); engine_add_fire(1,p->weapon,p->x+12,p->y+8,0.25,1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); } break; case 3: if(p->firef) { engine_add_fire(1,p->weapon,p->x+4,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y+8,-0.25,1,p); engine_add_fire(1,p->weapon,p->x+12,p->y+8,0.25,1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); } break; case 4: if(p->firef) { engine_add_fire(1,p->weapon,p->x+8,p->y,0,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y+8,-0.25,1,p); engine_add_fire(1,p->weapon,p->x+12,p->y+8,0.25,1,p); engine_add_fire(1,p->weapon,p->x+4,p->y,-0.20,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.20,-1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+14,p->y,0.10,-1,p); } break; } if(efx[0]) Mix_PlayChannel(-1,efx[0],0); break; case 2: switch(p->level) { default: case 0: engine_add_fire(1,p->weapon,p->x+8,p->y-10,0,-1,p); break; case 1: if(p->firef) engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); else engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); break; case 2: if(p->firef) { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); } else engine_add_fire(1,p->weapon,p->x+8,p->y-10,0,-1,p); break; case 3: if(p->firef) { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.25,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.25,-1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); } break; case 4: if(p->firef) { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.25,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.25,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.45,-1,p); } else { engine_add_fire(1,p->weapon,p->x+4,p->y,-0.45,-1,p); engine_add_fire(1,p->weapon,p->x+4,p->y,-0.10,-1,p); engine_add_fire(1,p->weapon,p->x+12,p->y,0.10,-1,p); engine_add_fire(1,p->weapon,p->x+8,p->y-10,0,-1,p); } break; } if(efx[2]) Mix_PlayChannel(-1,efx[2],0); break; } if(p->companion) { engine_add_fire(1,3,p->cx+2,p->cy-8,0,-1,p); if(efx[5]) Mix_PlayChannel(-1,efx[5],0); } } /* next frame */ p->cf++; if(p->cf==p->nf) p->cf=0; if(p->companion) { if(p->incx && p->incx!=p->cinc) p->cinc=p->incx; p->t+=10*p->cinc; } } /* player sprite */ a.x=p->x; a.y=p->y; b.x=p->f[p->cf].x; b.y=p->f[p->cf].y; b.w=p->f[p->cf].w; b.h=p->f[p->cf].h; SDL_BlitSurface(gfx, &b, screen, &a); /* companion */ if(p->companion) { a.x=p->cx; a.y=p->cy; b.x=162; b.y=30; b.w=7; b.h=7; SDL_BlitSurface(gfx, &b, screen, &a); if(p->cx<25 || p->cx>SCREENW-32) { engine_add_vefx(VFX_EXPLOB,p->cx-10,p->cy-10); p->companion=0; } else { circle_path(p->x+10,p->y+10,30,p->t,&p->cx,&p->cy); p->cx-=4; p->cy-=4; } } } void circle_path(int x, int y, int r, int t, float *rx, float *ry) { *rx=floor((double)r*cos((double)t/100)+(double)x); *ry=floor((double)r*sin((double)t/100)+(double)y); } void engine_enemy() { eDesc *et,*etp; if(!boss) { /* check action */ actCnt++; while(actCnt==act[actIdx].a) if(act[actIdx].type) { engine_add_enemy(act[actIdx].type, act[actIdx].x, act[actIdx].y); actIdx++; actCnt=0; } else {/* if the type == 0 then it's a vefx */ /* x value holds the kind and y holds type data */ engine_add_vefx(act[actIdx].x, act[actIdx].x, act[actIdx].y); actIdx++; actCnt=0; } /* temporal loop */ if(actCnt>1000) { actCnt=0; actIdx=0; } } /* process all the enemies */ for(etp=et=eused;et;) { if(et->cftimeftime) et->cftime++; else { et->cftime=0; if(!et->shield) { if(et->type==4) engine_add_obj(OBJ_WEAPON1, et->x+20, et->y+20); if(et->type==6 || et->type==10) { boss=false; if(sound) Mix_FadeInMusic(bgm,-1,2000); engine_add_obj(OBJ_SHIELD, et->x+46, et->y+26); } if(et->type==7 || et->type==9) { engine_add_fire(2,5,et->x+16,et->y+16,-1,0.5,NULL); engine_add_fire(2,5,et->x+16,et->y+16,1,-0.5,NULL); engine_add_fire(2,5,et->x+16,et->y+16,0.5,1,NULL); engine_add_fire(2,5,et->x+16,et->y+16,-0.5,-1,NULL); engine_add_fire(2,5,et->x+16,et->y+16,0.5,-1,NULL); engine_add_fire(2,5,et->x+16,et->y+16,-0.5,1,NULL); engine_add_fire(2,5,et->x+16,et->y+16,1,0.5,NULL); engine_add_fire(2,5,et->x+16,et->y+16,-1,-0.5,NULL); } if(et==eused) { etp=efree; efree=eused; eused=eused->n; efree->n=etp; etp=et=eused; continue; } else { etp->n=et->n; et->n=efree; efree=et; et=etp->n; continue; } } /* IA */ (et->ia)(et); } /* DRAW */ (et->draw)(et); etp=et; et=et->n; } } void engine_add_enemy(int type, int x, int y) { eDesc *et; if(efree==NULL) { fprintf(stderr,"PANIC!!!! efree reached limit\n"); exit(-1); } if(eused==NULL) { eused=efree; efree=efree->n; eused->n=NULL; } else { et=eused; eused=efree; efree=efree->n; eused->n=et; } eused->type=type; eused->x=x; eused->y=y; eused->cftime=0; eused->ftime=2; eused->init=0; memset(eused->var,0,sizeof(int)*10); switch(type) { default: fprintf(stderr,"FATAL: undefined enemy!\n"); exit(-1); break; case 1: eused->shield=2; eused->score=10; eused->ia=enemy_type1; eused->draw=enemy_type1d; eused->hit=enemy_type1h; break; case 2: eused->shield=1; eused->score=5; eused->ia=enemy_type2; eused->draw=enemy_type2d; eused->hit=enemy_type2h; break; case 3: eused->shield=1; eused->score=10; eused->ia=enemy_type3; eused->draw=enemy_type3d; eused->hit=enemy_type3h; break; case 4: eused->shield=20; eused->score=25; eused->ia=enemy_type4; eused->draw=enemy_type4d; eused->hit=enemy_type4h; break; case 5: eused->shield=2; eused->score=15; eused->ia=enemy_type5; eused->draw=enemy_type5d; eused->hit=enemy_type5h; break; case 6: eused->shield=250; eused->score=30; eused->ia=enemy_type6; eused->draw=enemy_type6d; eused->hit=enemy_type6h; boss=true; if(sound) Mix_FadeInMusic(bgm_boss,-1,2000); break; case 7: eused->shield=1; eused->score=25; eused->ia=enemy_type7; eused->draw=enemy_type7d; eused->hit=enemy_type7h; break; case 8: eused->shield=8; eused->score=5; eused->ia=enemy_type8; eused->draw=enemy_type8d; eused->hit=enemy_type8h; break; case 9: eused->shield=20; eused->score=20; eused->ia=enemy_type9; eused->draw=enemy_type9d; eused->hit=enemy_type9h; break; case 10: eused->shield=500; eused->score=40; eused->ia=enemy_type10; eused->draw=enemy_type10d; eused->hit=enemy_type10h; boss=true; if(sound) Mix_FadeInMusic(bgm_boss,-1,2000); break; case 11: eused->shield=1; eused->score=5; eused->ia=enemy_type11; eused->draw=enemy_type11d; eused->hit=enemy_type11h; break; } } /* ********************************************* */ void enemy_type1(eDesc *e) { int i; float m[2]={1.0f,1.0f}; /* var 0 -> radian var 1 -> loop time var 2,3 -> fire var 4,5 -> frames (for fire) */ if(e->init<3) { if(e->var[3]==60) { e->var[2]=1; e->var[3]=20; } else e->var[3]++; if(e->var[2]) { for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+28)!=0) m[i]=(double)((player[i].x+10)-(e->x+14))/(double)((player[i].y+10)-(e->y+28)); } else { if((e->y-4)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+14))/(double)((e->y-4)-(player[i].y+10)); } } if(abs(m[0])yx+14,e->y+28,m[i],1,NULL); else engine_add_fire(2,4,e->x+14,e->y-4,m[i],-1,NULL); e->var[2]=0; e->var[4]=1; e->var[5]=8; } } } switch(e->init) { default: e->shield=0; break; case 0: e->y+=6; if(e->y==64) { e->init++; e->var[0]=325; e->var[1]=0; } break; case 1: circle_path(140,76,80,e->var[0],&e->x,&e->y); e->var[0]-=7; if(e->var[1]!=140) e->var[1]++; else e->init++; break; case 2: if(e->y>-32) e->y-=6; else e->init++; break; } if(e->var[5]) { e->var[5]--; if(!e->var[5]) { e->var[4]=0; } } } void enemy_type1d(eDesc *e) { SDL_Rect b[2]={{ 1,134,32,32 },{ 36,134,32,32 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } int enemy_type1h(eDesc *e, int x, int y) { return (x>e->x && xx+40 && y>e->y && yy+40); } /* ********************************************* */ void enemy_type2(eDesc *e) { int i; /* 4 -> frame control 0 -> direction 1 -> fire */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=2; if(e->y>40) { e->init++; if(e->x>160) e->var[0]=0; else e->var[0]=1; } break; case 1: if(e->y>SCREENH) e->init++; else e->y+=2; if(e->var[0]) { if(e->x+4>SCREENW-50) e->var[0]=0; else e->x+=4; } else { if(e->x-4<30) e->var[0]=1; else e->x-=4; } for(i=0;!e->var[1] && i<2;i++) if(player[i].shield) if(abs(player[i].x-e->x)<8 && player[i].y>e->y) { engine_add_fire(2,4,e->x+10,e->y+20,0,+1.5,NULL); e->var[1]=1; } break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type2d(eDesc *e) { SDL_Rect b[2]={{ 75,139,24,18 },{ 110,139,24,18 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } int enemy_type2h(eDesc *e, int x, int y) { return (x>e->x && xx+24 && y>e->y && yy+18); } /* ********************************************* */ void enemy_type3(eDesc *e) { int i; /* 4 -> frame control 1 -> fire */ switch(e->init) { default: e->shield=0; break; case 0: if(e->y>SCREENH) e->init++; else e->y+=3; for(i=0;!e->var[1] && i<2;i++) if(player[i].shield) if(abs(player[i].x-e->x)<8 && player[i].y>e->y) { engine_add_fire(2,4,e->x+10,e->y+20,0,+1.5,NULL); e->var[1]=1; } break; } e->var[4]=e->var[4] ? 0 : 1; } /* ********************************************* */ void enemy_type4(eDesc *e) { int i; float m[2]={1.0f,1.0f}; /* 1 -> fire cycle 2 -> timer 4,5 -> frame control */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=2; if(e->y>20) { e->init++; e->var[5]=2; e->var[1]++; } break; case 1: e->y+=0.5; e->var[2]++; if(e->var[2]>150) e->init++; break; case 2: e->y+=2; e->var[5]=0; e->var[1]=0; break; } if(e->var[1]>0) { switch(e->var[1]) { case 2: engine_add_fire(2,5,e->x+22,e->y+20,1,1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,1,-1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-1,1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-1,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+14,e->y+11); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 8: engine_add_fire(2,5,e->x+22,e->y+20,0.5,1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,0.5,-1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-0.5,1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-0.5,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+14,e->y+11); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 14: engine_add_fire(2,5,e->x+22,e->y+20,1,0.5,NULL); engine_add_fire(2,5,e->x+22,e->y+20,1,-0.5,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-1,0.5,NULL); engine_add_fire(2,5,e->x+22,e->y+20,-1,-0.5,NULL); engine_add_vefx(VFX_EXPLOB,e->x+14,e->y+11); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 20: engine_add_fire(2,5,e->x+22,e->y+20,-1,0,NULL); engine_add_fire(2,5,e->x+22,e->y+20,1,0,NULL); engine_add_fire(2,5,e->x+22,e->y+20,0,1,NULL); engine_add_fire(2,5,e->x+22,e->y+20,0,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+14,e->y+11); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 25: case 30: case 35: for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+21)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((player[i].y+10)-(e->y+21)); } else { if((e->y+21)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((e->y+21)-(player[i].y+10)); } } if(abs(m[0])yx+22,e->y+39,m[i],1,NULL); else engine_add_fire(2,4,e->x+22,e->y+39,m[i],-1,NULL); } break; } if(e->var[1]>40) e->var[1]=1; else e->var[1]++; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type4d(eDesc *e) { SDL_Rect b[4]={{ 246,83,47,47 },{ 297,83,47,47 },{ 348,83,47,47 },{ 399,83,47,47 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]+e->var[5]], screen, &a); } int enemy_type4h(eDesc *e, int x, int y) { return (x>e->x && xx+48 && y>e->y && yy+48); } /* ********************************************* */ void enemy_type5(eDesc *e) { /* 4 -> frame control 0 -> direction 1 -> fire */ switch(e->init) { default: e->shield=0; break; case 0: e->init++; e->var[1]=(int)e & 0x0f; /* pseudo random :) */ case 1: if(e->y>SCREENH) e->init++; else e->y+=4; if(e->var[0]) { if(e->x+5>SCREENW-50) e->var[0]=0; else e->x+=5; } else { if(e->x-5<30) e->var[0]=1; else e->x-=5; } if(e->var[1]>16) { engine_add_fire(2,6,e->x+8,e->y+20,0,+1.5,NULL); engine_add_fire(2,6,e->x+21,e->y+20,0,+1.5,NULL); e->var[1]=0; } e->var[1]++; break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type5d(eDesc *e) { SDL_Rect b[2]={{ 141,139,32,32 },{ 176,139,32,32 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } int enemy_type5h(eDesc *e, int x, int y) { return (x>e->x && xx+32 && y>e->y && yy+32); } /* ********************************************* */ void enemy_type6(eDesc *e) { int i; float m[2]={1.0f,1.0f}; /* 1 -> fire cycle 2 -> timer 3 -> fire type 4 -> frame control */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=2; if(e->y==20) { e->init++; e->var[1]=1; } break; case 1: break; case 2: e->y+=2; e->x-=2; if(e->x<25) e->init++; break; case 3: e->y-=2; e->x+=2; if(e->y==20) e->init++; break; case 4: e->y+=2; e->x+=2; if(e->x>223) e->init++; break; case 5: e->y-=2; e->x-=2; if(e->y==20) { e->init=1; e->var[1]=1; e->var[3]=0; } break; } if(e->var[1]>0) { if(e->var[3]==0) switch(e->var[1]) { case 2: engine_add_fire(2,5,e->x+10,e->y+26,1,1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,1,-1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-1,1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-1,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2,e->y+18); engine_add_fire(2,5,e->x+10+49,e->y+26,1,1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,1,-1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-1,1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-1,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2+49,e->y+18); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 8: engine_add_fire(2,5,e->x+10,e->y+26,0.5,1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,0.5,-1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-0.5,1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-0.5,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2,e->y+18); engine_add_fire(2,5,e->x+10+49,e->y+26,0.5,1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,0.5,-1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-0.5,1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-0.5,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2+49,e->y+18); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 14: engine_add_fire(2,5,e->x+10,e->y+26,1,0.5,NULL); engine_add_fire(2,5,e->x+10,e->y+26,1,-0.5,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-1,0.5,NULL); engine_add_fire(2,5,e->x+10,e->y+26,-1,-0.5,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2,e->y+18); engine_add_fire(2,5,e->x+10+49,e->y+26,1,0.5,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,1,-0.5,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-1,0.5,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,-1,-0.5,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2+49,e->y+18); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 20: engine_add_fire(2,5,e->x+10,e->y+26,-1,0,NULL); engine_add_fire(2,5,e->x+10,e->y+26,1,0,NULL); engine_add_fire(2,5,e->x+10,e->y+26,0,1,NULL); engine_add_fire(2,5,e->x+10,e->y+26,0,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2,e->y+18); engine_add_fire(2,5,e->x+10+49,e->y+26,-1,0,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,1,0,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,0,1,NULL); engine_add_fire(2,5,e->x+10+49,e->y+26,0,-1,NULL); engine_add_vefx(VFX_EXPLOB,e->x+2+49,e->y+18); if(efx[1]) Mix_PlayChannel(-1,efx[1],0); break; case 25: case 30: case 35: for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+21)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((player[i].y+10)-(e->y+21)); } else { if((e->y+21)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((e->y+21)-(player[i].y+10)); } } if(abs(m[0])yx+35,e->y+38,m[i],1,NULL); else engine_add_fire(2,4,e->x+35,e->y+38,m[i],-1,NULL); } break; } else { switch(e->var[1]) { case 2: case 14: engine_add_fire(2,6,e->x+20,e->y+40,0,+1.5,NULL); engine_add_fire(2,6,e->x+20+27,e->y+40,0,+1.5,NULL); if(efx[5]) Mix_PlayChannel(-1,efx[5],0); break; case 35: for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+21)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((player[i].y+10)-(e->y+21)); } else { if((e->y+21)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+21))/(double)((e->y+21)-(player[i].y+10)); } } if(abs(m[0])yx+35,e->y+38,m[i],1,NULL); else engine_add_fire(2,4,e->x+35,e->y+38,m[i],-1,NULL); } break; default: break; } } if(e->var[1]>40) { e->var[1]=1; if(e->var[3]==0) { e->init++; e->var[3]=1; } } else e->var[1]++; } e->var[4]++; if(e->var[4]>3) e->var[4]=0; } void enemy_type6d(eDesc *e) { SDL_Rect b[4]={{ 664,41,73,52 },{ 664,95,73,52 },{ 664,149,73,52 },{ 664,95,73,52 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } int enemy_type6h(eDesc *e, int x, int y) { return (x>e->x && xx+73 && y>e->y && yy+52); } /* ********************************************* */ void enemy_type7(eDesc *e) { /* 1 -> timer 4 -> frame control */ switch(e->init) { default: e->shield=0; break; case 0: e->y++; if(e->y>SCREENH) e->init++; break; } e->var[1]++; if(e->var[1]==2) { e->var[1]=0; e->var[4]++; if(e->var[4]>3) e->var[4]=0; } } void enemy_type7d(eDesc *e) { SDL_Rect b[4]={{ 211,134,32,32 },{ 246,134,32,32 },{ 211,169,32,32 },{ 246,169,32,32 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } /* ********************************************* */ void enemy_type8(eDesc *e) { int k; /* 0 -> timer 4 -> frame control 5 -> fire timer */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=4; if(e->y>20) { e->var[0]=80; e->init++; } break; case 1: e->var[5]--; k=-1; if(player[0].shield) k=0; if(player[1].shield) { if(k==-1) k=1; else if(abs(player[1].x-e->x)>abs(player[0].x-e->x)) k=1; } if(k!=-1) { if(abs(e->x-player[k].x)<16) { if(e->var[5]<0) { if(efx[5]) Mix_PlayChannel(-1,efx[5],0); engine_add_fire(2,6,e->x+5,e->y+23,0,2,NULL); engine_add_fire(2,6,e->x+22,e->y+23,0,2,NULL); e->var[5]=6; } } if(abs(e->x-player[k].x)>8) { if(e->x>player[k].x) e->var[1]=-2; else e->var[1]=+2; if(e->x+e->var[1]x+e->var[1]>30) e->x+=e->var[1]; } e->var[0]--; if(e->var[0]==0) e->init++; } else e->init++; break; case 2: e->var[5]--; if(e->y>SCREENH) { e->init++; break; } else e->y+=2; if(e->var[1]>0) { if(e->x+4>SCREENW-55) e->var[1]=0; else e->x+=4; } else { if(e->x-4<30) e->var[1]=1; else e->x-=4; } k=0; if(player[0].shield) k=(int)(abs(e->x-player[0].x)<16); if(player[1].shield) k+=(int)(abs(e->x-player[0].x)<16); if(k>0) { if(e->var[5]<0) { if(efx[5]) Mix_PlayChannel(-1,efx[5],0); engine_add_fire(2,6,e->x+5,e->y+23,0,2,NULL); engine_add_fire(2,6,e->x+22,e->y+23,0,2,NULL); e->var[5]=6; } } break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type8d(eDesc *e) { SDL_Rect b[2]={{ 141,169,32,32 },{ 176,169,32,32 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]], screen, &a); } /* ********************************************* */ void enemy_type9(eDesc *e) { /* 0 -> status 1 -> timer 4 -> frame control */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=2; if(e->y>40) e->init++; break; case 1: e->var[1]++; if(e->var[1]>10) { engine_add_vefx(VFX_EXPLOB,e->x,e->y); engine_add_enemy(7, e->x-8, e->y-8); engine_add_vefx(VFX_EXPLOB,e->x+32,e->y); engine_add_enemy(7, e->x+32, e->y-8); engine_add_vefx(VFX_EXPLOB,e->x-2,e->y+41); engine_add_enemy(7, e->x-8, e->y+28); engine_add_vefx(VFX_EXPLOB,e->x+32,e->y+41); engine_add_enemy(7, e->x+32, e->y+28); e->init++; e->var[0]=2; } break; case 2: e->y-=2; if(e->y<-41) e->init++; break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type9d(eDesc *e) { SDL_Rect b[4]={{ 450,248,48,41 },{ 501,248,48,41 },{ 552,248,48,41 },{ 603,248,48,41 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[0]+e->var[4]], screen, &a); } int enemy_type9h(eDesc *e, int x, int y) { if(e->var[0]==0) return (x>e->x && xx+48 && y>e->y && yy+41); else return (x>e->x+11 && xx+48-11 && y>e->y+11 && yy+41-11); } /* ********************************************* */ void enemy_type10(eDesc *e) { int i; float m[2]={1.0f,1.0f}; /* 0 -> status 1 -> timer 2 -> dir 3 -> timer 4 -> frame control */ switch(e->init) { default: e->shield=0; break; case 0: e->y+=2; if(e->y==30) { e->init++; e->var[1]=60; e->var[3]=0; } break; case 1: e->var[3]++; e->var[1]--; if(e->var[1]==0) { e->init++; e->var[1]=150; e->var[3]=0; } else { if(e->var[3]==10) { e->var[3]=0; if(e->var[0]==0) { engine_add_fire(2,5,e->x+6,e->y+32,-1,0.5,NULL); engine_add_fire(2,5,e->x+6,e->y+32,1,-0.5,NULL); engine_add_fire(2,5,e->x+6,e->y+32,0.5,1,NULL); engine_add_fire(2,5,e->x+6,e->y+32,-0.5,-1,NULL); engine_add_fire(2,5,e->x+6,e->y+32,0.5,-1,NULL); engine_add_fire(2,5,e->x+6,e->y+32,-0.5,1,NULL); engine_add_fire(2,5,e->x+6,e->y+32,1,0.5,NULL); engine_add_fire(2,5,e->x+6,e->y+32,-1,-0.5,NULL); engine_add_vefx(VFX_EXPLOB,e->x-1,e->y+25); } if(e->var[0]<2) { engine_add_fire(2,5,e->x+6+91,e->y+32,-1,0.5,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,1,-0.5,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,0.5,1,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,-0.5,-1,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,0.5,-1,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,-0.5,1,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,1,0.5,NULL); engine_add_fire(2,5,e->x+6+91,e->y+32,-1,-0.5,NULL); engine_add_vefx(VFX_EXPLOB,e->x+90,e->y+25); } for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+21)!=0) m[i]=(double)((player[i].x+10)-(e->x+52))/(double)((player[i].y+10)-(e->y+24)); } else { if((e->y+21)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+52))/(double)((e->y+24)-(player[i].y+10)); } } if(abs(m[0])yx+52,e->y+24,m[i],1,NULL); else engine_add_fire(2,4,e->x+52,e->y+24,m[i],-1,NULL); } } } break; case 2: e->var[1]--; e->var[3]++; if(e->var[1]==0) { e->var[2]=0; if(e->var[0]!=2) e->init++; } else { if(e->var[2]==0) { if(e->var[0]!=2) e->x-=2; else e->x-=4; if(e->x<30) e->var[2]=1; } else { if(e->var[0]!=2) e->x+=2; else e->x+=4; if(e->x>SCREENW-30-110) e->var[2]=0; } if(e->var[3]==18) { e->var[3]=0; if(e->var[0]==0) { engine_add_fire(2,6,e->x+13,e->y+37,0,+1.5,NULL); } if(e->var[0]<2) { engine_add_fire(2,6,e->x+90,e->y+37,0,+1.5,NULL); if(efx[5]) Mix_PlayChannel(-1,efx[5],0); } } if(e->var[3]==0 || e->var[3]==10) { for(i=0;i<2;i++) if(player[i].shield) { if(e->yy+21)!=0) m[i]=(double)((player[i].x+10)-(e->x+52))/(double)((player[i].y+10)-(e->y+24)); } else { if((e->y+21)-(player[i].y+10)!=0) m[i]=(double)((player[i].x+10)-(e->x+52))/(double)((e->y+24)-(player[i].y+10)); } } if(abs(m[0])yx+52,e->y+24,m[i],1,NULL); else engine_add_fire(2,4,e->x+52,e->y+24,m[i],-1,NULL); } } } break; case 3: if(e->var[2]==0) { e->y+=2; if(e->y>140) e->var[2]=1; } else { e->y-=2; if(e->y==30) { if(e->var[0]!=2) e->init=1; else e->init=2; e->var[1]=60; e->var[3]=0; } } break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type10d(eDesc *e) { SDL_Rect b[4]={{ 664,203,55,52 },{ 718,203,55,52 },{ 664,257,55,52 },{ 718,257,55,52 }}; SDL_Rect c[4]={{ 664,311,25,36 },{ 724,311,25,36 },{ 688,311,25,36 },{ 748,311,25,36 }}; SDL_Rect a; if(e->shield>100) { a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[2*e->var[4]], screen, &a); } else { a.x=e->x+30; a.y=e->y; SDL_BlitSurface(gfx, &c[e->var[4]], screen, &a); if(e->var[0]==0) { engine_add_vefx(VFX_MEXPLO,e->x,e->y+20); e->var[0]=1; } } if(e->shield>75) { a.x=e->x+54; a.y=e->y; SDL_BlitSurface(gfx, &b[(2*e->var[4])+1], screen, &a); } else { a.x=e->x+54; a.y=e->y; SDL_BlitSurface(gfx, &c[2+e->var[4]], screen, &a); if(e->var[0]==1) { engine_add_vefx(VFX_MEXPLO,e->x+90,e->y+20); e->var[0]=2; } } } int enemy_type10h(eDesc *e, int x, int y) { switch(e->var[0]) { default: return (x>e->x && xx+110 && y>e->y && yy+36) || (x>e->x && xx+36 && y>e->y && yy+52) || (x>e->x+72 && xx+110 && y>e->y && yy+52); break; case 1: return (x>e->x+32 && xx+110 && y>e->y && yy+36) || (x>e->x+72 && xx+110 && y>e->y && yy+52); break; case 2: return (x>e->x+32 && xx+80 && y>e->y && yy+36); break; } } /* ********************************************* */ void enemy_type11(eDesc *e) { int i; /* 4 -> frame control 2 -> frame mod 0 -> direction 1 -> fire 3 -> direction y */ switch(e->init) { default: e->shield=0; break; case 0: e->var[3]=-2; e->init++; break; case 1: if(e->var[2] && e->y>SCREENH) e->init++; else e->y+=e->var[3]; if(e->y<-32) e->init++; if(e->var[0]) { if(e->x+4>SCREENW-50) e->var[0]=0; else e->x+=4; } else { if(e->x-4<30) e->var[0]=1; else e->x-=4; } if(e->var[2]) for(i=0;!e->var[1] && i<2;i++) if(player[i].shield) if(abs(player[i].x-e->x)<8 && player[i].y>e->y) { engine_add_fire(2,4,e->x+10,e->y+20,0,+1.5,NULL); e->var[1]=1; } break; case 2: e->var[2]=2; e->var[3]=3; e->init=1; break; } e->var[4]=e->var[4] ? 0 : 1; } void enemy_type11d(eDesc *e) { SDL_Rect b[4]={{ 75,178,24,18 },{ 110,178,24,18 }, { 75,139,24,18 },{ 110,139,24,18 }}; SDL_Rect a; a.x=e->x; a.y=e->y; SDL_BlitSurface(gfx, &b[e->var[4]+e->var[2]], screen, &a); } dd2-0.2.2/src/control.c0000644000175000017500000000364410660375174014423 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include "main.h" #include "control.h" #include "SDL_plus.h" extern bool pause; void control_player_joy(SDL_Joystick *joy, pDesc *p) { int x,y,but; if(pause) return; SDL_JoystickUpdate(); x=SDL_JoystickGetAxis(joy,0); y=SDL_JoystickGetAxis(joy,1); if(x<-4200) { p->incx=-1; } if(x>4200) { p->incx=+1; } if(y<-4200) { p->incy=-1; } if(y>4200) { p->incy=+1; } if(x>-4200 && x<4200) p->incx=0; if(y>-4200 && y<4200) p->incy=0; but=SDL_JoystickGetButton(joy, 0); if(but && !p->fire) p->fire=1; if(!but) p->fire=0; } void control_player(pDesc *p) { Uint8* keys; keys=SDL_GetKeyState(NULL); if(pause) return; if(keys[p->keys[0]]) { p->incx=-1; } if(keys[p->keys[1]]) { p->incx=+1; } if(keys[p->keys[2]]) { p->incy=-1; } if(keys[p->keys[3]]) { p->incy=+1; } if((!keys[p->keys[2]] && !keys[p->keys[3]]) || (keys[p->keys[2]] && keys[p->keys[3]])) { p->incy=0; } if((!keys[p->keys[0]] && !keys[p->keys[1]]) || (keys[p->keys[0]] && keys[p->keys[1]])) { p->incx=0; } if(keys[p->keys[4]] && !p->fire) p->fire=1; if(!keys[p->keys[4]]) p->fire=0; } dd2-0.2.2/src/engine.h0000644000175000017500000001037110660375216014205 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef __ENGINE__ #define __ENGINE__ #ifndef DD2_DATA #define DD2_DATA="./data" #endif #include "SDL.h" #include "SDL_mixer.h" /* player data */ typedef struct pdesc { SDL_Rect *f; /* description for frames */ int ftime; int cftime; int nf; /* number of frames */ int cf; /* current frame */ int x,y; int incx,incy; int companion; long t; int cinc; float cx,cy; int joy; int keys[5]; int fire; int firef; unsigned long score; char stage; char shield; char weapon; /* 0,1,2 */ char level; /* 0,1,2, ... */ } pDesc; /* fire data */ typedef struct fdesc { char own; /* 0: nobody, 1 player 2: enemy */ pDesc *player; int type; int ftime; int cftime; float x,y; float incx,incy; struct fdesc *n; } fDesc; /* visual efect data */ typedef struct vdesc { int type; int ftime; int cftime; int x,y; int nf; int cf; SDL_Rect f[4]; /* description for frames */ struct vdesc *n; } vDesc; /* object data */ typedef struct odesc { int type; int ftime,cf; float x,y; struct odesc *n; } oDesc; /* enemies */ typedef struct edesc { int type; int ftime; int cftime; float x,y; int score; int shield; int init; int var[10]; void (*ia)(struct edesc *e); void (*draw)(struct edesc *e); int (*hit)(struct edesc *e, int x, int y); struct edesc *n; } eDesc; void engine_init(); void engine_release(); void engine_player(pDesc *p); void engine_fire(); void engine_add_fire(int from, int type, int x, int y, float incx, float incy, pDesc *p); void engine_vefx(); void engine_add_vefx(int type, int x, int y); void engine_obj(); void engine_add_obj(int type, int x, int y); void engine_enemy(); void engine_add_enemy(int type, int x, int y); /* disc 1 */ void enemy_type1(eDesc *e); void enemy_type1d(eDesc *e); int enemy_type1h(eDesc *e, int x, int y); /* ship 1 */ void enemy_type2(eDesc *e); void enemy_type2d(eDesc *e); int enemy_type2h(eDesc *e, int x, int y); /* ship 2 */ void enemy_type3(eDesc *e); #define enemy_type3d enemy_type2d #define enemy_type3h enemy_type2h /* provider 1 */ void enemy_type4(eDesc *e); void enemy_type4d(eDesc *e); int enemy_type4h(eDesc *e, int x, int y); /* fast ship 1 */ void enemy_type5(eDesc *e); void enemy_type5d(eDesc *e); int enemy_type5h(eDesc *e, int x, int y); /* boss 1 */ void enemy_type6(eDesc *e); void enemy_type6d(eDesc *e); int enemy_type6h(eDesc *e, int x, int y); /* energy mine */ void enemy_type7(eDesc *e); void enemy_type7d(eDesc *e); #define enemy_type7h enemy_type5h /* shootter */ void enemy_type8(eDesc *e); void enemy_type8d(eDesc *e); #define enemy_type8h enemy_type5h /* energy mine carrier */ void enemy_type9(eDesc *e); void enemy_type9d(eDesc *e); int enemy_type9h(eDesc *e, int x, int y); /* boss 2 */ void enemy_type10(eDesc *e); void enemy_type10d(eDesc *e); int enemy_type10h(eDesc *e, int x, int y); /* ship 3 */ void enemy_type11(eDesc *e); void enemy_type11d(eDesc *e); #define enemy_type11h enemy_type2h void circle_path(int x, int y, int r, int t, float *rx, float *ry); #define SCREENW 320 #define SCREENH 200 /* efx */ #define VFX_SHIELD 1 #define VFX_EXPLO 2 #define VFX_EXPLOB 3 #define VFX_SHUP 4 #define VFX_POW 5 #define VFX_STAGE 6 #define VFX_MEXPLO 7 /* objects */ #define OBJ_WEAPON1 1 #define OBJ_WEAPON2 2 #define OBJ_WEAPON3 3 #define OBJ_SHIELD 4 #define OBJ_COMPANION 5 #define OBJ_LAST 5 #define OBJ_FIRST 1 #endif dd2-0.2.2/src/control.h0000644000175000017500000000173710660375234014426 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef __CONTROL__ #define __CONTROL__ #include "SDL.h" #include "engine.h" void control_player_joy(SDL_Joystick *joy, pDesc *p); void control_player(pDesc *p); #endif dd2-0.2.2/src/cfg.h0000644000175000017500000000237710660375166013512 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef _CFG_H_ #define _CFG_H_ #define NO_SOUND 0 #define SOUND_LOW 1 #define SOUND_MED 2 #define SOUND_HI 3 #define KEYBOARD 0 #define JOYSTICK 1 typedef struct score { char name[9]; int stage; int score; } score; typedef struct cfgStruct { int sound; int control[2]; int fullscreen; } cfg; int loadCFG(char *path, cfg *c); int saveCFG(char *path, cfg *c); int loadScore(char *path, score *hisc); int saveScore(char *path, score *hisc); #endif dd2-0.2.2/src/SDL_plus.h0000644000175000017500000000227710660375302014427 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef __SDL_PLUS__ #define __SDL_PLUS__ #include "SDL.h" #include "engine.h" SDL_Surface *loadBMP(char *file); void writeNumber(SDL_Surface *src, SDL_Surface *dst, int x, int y, int number, int padd); void drawPanel(SDL_Surface *src, SDL_Surface *dst, pDesc *player); void writeCString(SDL_Surface *src, SDL_Surface *dst, int x, int y, char *str, int color); char SDLK2ascii(int sym); #endif dd2-0.2.2/src/menu.h0000644000175000017500000000220310660375263013701 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef _MENU_H_ #define _MENU_H_ void drawGetName(char *name, int place, int playern); int getName(char *name, int place, int playern); void drawHiscores(int max); int hiscores(); void drawConfigure(int option); int configure(); void drawMenu(int option); int menu(); void drawCredits(); int credits(); #define NUM_EFX 8 #endif dd2-0.2.2/src/main.c0000644000175000017500000002437210660375636013673 0ustar reidracreidrac/* Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include"main.h" #include"SDL.h" #include"SDL_mixer.h" #include"menu.h" #define APP_NAME "Dodgin' Diamond ][" #define FPS 60 #include "control.h" #include "SDL_plus.h" #include "engine.h" #include "cfg.h" #ifdef WIN32 static const char COPYRIGHT[]="Dodgin' Diamond 2 - Copyright (c) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License; either version 2 of the License, or (at your option) any later version, as published by the Free Software Foundation (www.fsf.org)."; #endif SDL_Surface *screen, *gfx; extern pDesc player[2]; SDL_Joystick *joy[2]={ NULL, NULL }; SDL_Event event; Uint32 tick, ntick; float scroll=0,scroll2=0; bool pause; Uint32 pause_tick; extern bool boss; cfg conf; score hiscore[10]; Mix_Chunk *efx[8]={ NULL, NULL, NULL, NULL, NULL, NULL, NULL, NULL }; Mix_Music *bgm=NULL, *bgm_boss=NULL; int sound; bool done; /* load all the sound stuff */ void soundLoad() { int i; char buffer[512]; sprintf(buffer,"%s/bgm1.xm",DD2_DATA); bgm=Mix_LoadMUS(buffer); if(!bgm) fprintf(stderr,"Unable load bgm: %s\n", SDL_GetError()); sprintf(buffer,"%s/bgm2.xm",DD2_DATA); bgm_boss=Mix_LoadMUS(buffer); if(!bgm_boss) fprintf(stderr,"Unable load bgm_boss: %s\n", SDL_GetError()); for(i=0;i=1000/FPS) { tick=ntick; /* scroll here */ { SDL_Rect a,b; if(scroll>0) scroll-=0.5; else scroll=200; b.x=1; b.w=SCREENW; a.x=0; if(!scroll) { a.y=0; b.y=204; b.h=SCREENH; SDL_BlitSurface(gfx, &b, screen, &a); } else { a.y=0; b.y=204+(int)scroll; b.h=SCREENH-(int)scroll; SDL_BlitSurface(gfx, &b, screen, &a); a.y=SCREENH-(int)scroll; b.y=204; b.h=(int)scroll; SDL_BlitSurface(gfx, &b, screen, &a); } /* scroll parallax here */ if(scroll2>0) scroll2-=2; else scroll2=200; b.x=324; b.w=25; a.x=0; if(!scroll2) { a.y=0; b.y=204; b.h=SCREENH; SDL_BlitSurface(gfx, &b, screen, &a); b.x=358; a.x=SCREENW-25; SDL_BlitSurface(gfx, &b, screen, &a); } else { a.y=0; b.y=204+(int)scroll2; b.h=SCREENH-(int)scroll2; SDL_BlitSurface(gfx, &b, screen, &a); a.y=SCREENH-(int)scroll2; b.y=204; b.h=(int)scroll2; SDL_BlitSurface(gfx, &b, screen, &a); b.x=358; a.x=SCREENW-25; a.y=0; b.y=204+(int)scroll2; b.h=SCREENH-(int)scroll2; SDL_BlitSurface(gfx, &b, screen, &a); a.y=SCREENH-(int)scroll2; b.y=204; b.h=(int)scroll2; SDL_BlitSurface(gfx, &b, screen, &a); } } /* enemy here */ engine_enemy(); /* fire here */ engine_fire(); /* character here */ if(player[0].shield) engine_player(&player[0]); if(player[1].shield) engine_player(&player[1]); if(!(player[0].shield | player[1].shield)) afterdeath++; engine_obj(); engine_vefx(); /* panel */ drawPanel(gfx,screen,player); SDL_Flip(screen); } } } int main (int argc, char *argv[]) { int i,j,k; char buffer[512]; SDL_VideoInfo *vi; unsigned char bpp=8; #ifndef WIN32 if(argc==2) if(argv[1][0]=='-' && argv[1][1]=='v') { printf("%s v%s\nCopyright (c) 2003,2004 Juan J. Martinez \n", PACKAGE, VERSION); printf("This is free software, and you are welcome\nto redistribute it" " under certain conditions; read COPYING for details.\n"); return 1; } /* try local configuration */ sprintf(buffer,"%.500s/.dd2rc",getenv("HOME")); if(!loadCFG(buffer,&conf)) { /* if there's no local, use global */ sprintf(buffer,"%s/dd2.cfg",DD2_DATA); if(!loadCFG(buffer,&conf)) fprintf(stderr,"unable to read configuration, using defaults\n"); } #else sprintf(buffer,"%s/dd2.cfg",DD2_DATA); if(!loadCFG(buffer,&conf)) fprintf(stderr,"unable to read configuration, using defaults\n"); #endif /* read hi-scores */ sprintf(buffer,"%s/dd2-hiscore",DD2_DATA); if(!loadScore(buffer,hiscore)) fprintf(stderr,"unable to read hi-scores, using defaults\n"); /* don't init sound if it's not needed */ if(conf.sound!=NO_SOUND) i=SDL_Init(SDL_INIT_VIDEO|SDL_INIT_AUDIO|SDL_INIT_JOYSTICK); else i=SDL_Init(SDL_INIT_VIDEO|SDL_INIT_JOYSTICK); if(i<0) { fprintf(stderr,"Unable to init SDL: %s\n", SDL_GetError()); return 1; } atexit(SDL_Quit); sound=SDL_WasInit(SDL_INIT_AUDIO) & SDL_INIT_AUDIO; /* no sound, 16000, 22050, 44100 */ if(sound && conf.sound!=NO_SOUND) { switch(conf.sound) { default: case SOUND_HI: i=44100; break; case SOUND_MED: i=22050; break; case SOUND_LOW: i=16000; break; } if(Mix_OpenAudio(i, MIX_DEFAULT_FORMAT, 2, 2048)<0) { fprintf(stderr, "Unable to set audio: %s\n", SDL_GetError()); sound=0; } else soundLoad(); } vi=(SDL_VideoInfo *)SDL_GetVideoInfo(); if(vi) bpp=vi->vfmt->BitsPerPixel; if(conf.fullscreen) screen=SDL_SetVideoMode(SCREENW, SCREENH, bpp, SDL_HWSURFACE|SDL_HWPALETTE|SDL_DOUBLEBUF|SDL_FULLSCREEN); else screen=SDL_SetVideoMode(SCREENW, SCREENH, bpp, SDL_HWSURFACE|SDL_HWPALETTE|SDL_DOUBLEBUF); if(!screen) { fprintf(stderr, "Unable to set video mode: %s\n", SDL_GetError()); return 1; } /* init the joystick */ if(SDL_WasInit(SDL_INIT_JOYSTICK) & SDL_INIT_JOYSTICK) if(SDL_NumJoysticks()>=1) { joy[0]=SDL_JoystickOpen(0); if(SDL_NumJoysticks()>1) joy[1]=SDL_JoystickOpen(1); } /* hide the mouse */ SDL_ShowCursor(SDL_DISABLE); /* set the caption */ SDL_WM_SetCaption(APP_NAME,NULL); /* load console gfx */ sprintf(buffer,"%s/gfx.bmp",DD2_DATA); gfx=loadBMP(buffer); if(!gfx) { fprintf(stderr,"Unable load gfx: %s\n", SDL_GetError()); return 1; } /* set transparent color */ if(SDL_SetColorKey(gfx, SDL_SRCCOLORKEY, SDL_MapRGB(gfx->format, 255, 0, 255))<0) { fprintf(stderr,"Unable to setup gfx: %s\n", SDL_GetError()); return 1; } /* main LOOP */ while(menu()) { /* init the engine */ engine_init(); SDL_FillRect(screen,NULL,SDL_MapRGB(screen->format,0,0,0)); SDL_Flip(screen); if(sound && bgm) { Mix_VolumeMusic(MIX_MAX_VOLUME); Mix_FadeInMusic(bgm,-1,2000); SDL_Delay(2000); } player[0].joy=(int)conf.control[0]==JOYSTICK; player[1].joy=(int)conf.control[1]==JOYSTICK; pause=0; pause_tick=0; boss=0; gameLoop(); if(sound && bgm) { Mix_FadeOutMusic(2000); SDL_Delay(3000); } for(i=0;i<2;i++) { /* check if there's a place for this score */ for(j=9;j>=0 && hiscore[j].scorej;k--) hiscore[k+1]=hiscore[k]; /* put the new score */ hiscore[j+1].score=player[i].score; hiscore[j+1].stage=player[i].stage; hiscore[j+1].name[0]=0; if(!getName(hiscore[j+1].name, j+2,i+1)) break; /* probably a problem if the user closes the window */ /* show the hall of fame */ hiscores(); } } } if(sound) { if(bgm) Mix_FreeMusic(bgm); if(bgm_boss) Mix_FreeMusic(bgm_boss); for(i=0;i This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifndef _MAIN_H_ #define _MAIN_H_ typedef int bool; #define true 1 #define false 0 #endif dd2-0.2.2/src/0000777000175000017500000000000010661102550012557 5ustar reidracreidracdd2-0.2.2/Makefile.in0000644000175000017500000002525710661102505014044 0ustar reidracreidrac# Makefile.in generated automatically by automake 1.4-p6 from Makefile.am # Copyright (C) 1994, 1995-8, 1999, 2001 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. SHELL = @SHELL@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ prefix = @prefix@ exec_prefix = @exec_prefix@ bindir = @bindir@ sbindir = @sbindir@ libexecdir = @libexecdir@ datadir = @datadir@ sysconfdir = @sysconfdir@ sharedstatedir = @sharedstatedir@ localstatedir = @localstatedir@ libdir = @libdir@ infodir = @infodir@ mandir = @mandir@ includedir = @includedir@ oldincludedir = /usr/include DESTDIR = pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = . ACLOCAL = @ACLOCAL@ AUTOCONF = @AUTOCONF@ AUTOMAKE = @AUTOMAKE@ AUTOHEADER = @AUTOHEADER@ INSTALL = @INSTALL@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ $(AM_INSTALL_PROGRAM_FLAGS) INSTALL_DATA = @INSTALL_DATA@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ transform = @program_transform_name@ NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : CC = @CC@ MAKEINFO = @MAKEINFO@ PACKAGE = @PACKAGE@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ VERSION = @VERSION@ SUBDIRS = src EXTRA_DIST = snapshot-sh AUTHORS COPYING NEWS README TODO ChangeLog docsdir = $(datadir)/doc/$(PACKAGE) docs_DATA = AUTHORS COPYING NEWS README TODO ChangeLog ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = DATA = $(docs_DATA) DIST_COMMON = README AUTHORS COPYING ChangeLog INSTALL Makefile.am \ Makefile.in NEWS TODO acinclude.m4 aclocal.m4 configure configure.in \ install-sh missing mkinstalldirs DISTFILES = $(DIST_COMMON) $(SOURCES) $(HEADERS) $(TEXINFOS) $(EXTRA_DIST) TAR = tar GZIP_ENV = --best all: all-redirect .SUFFIXES: $(srcdir)/Makefile.in: Makefile.am $(top_srcdir)/configure.in $(ACLOCAL_M4) cd $(top_srcdir) && $(AUTOMAKE) --gnu Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status $(BUILT_SOURCES) cd $(top_builddir) \ && CONFIG_FILES=$@ CONFIG_HEADERS= $(SHELL) ./config.status $(ACLOCAL_M4): configure.in acinclude.m4 cd $(srcdir) && $(ACLOCAL) config.status: $(srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(srcdir)/configure: $(srcdir)/configure.in $(ACLOCAL_M4) $(CONFIGURE_DEPENDENCIES) cd $(srcdir) && $(AUTOCONF) install-docsDATA: $(docs_DATA) @$(NORMAL_INSTALL) $(mkinstalldirs) $(DESTDIR)$(docsdir) @list='$(docs_DATA)'; for p in $$list; do \ if test -f $(srcdir)/$$p; then \ echo " $(INSTALL_DATA) $(srcdir)/$$p $(DESTDIR)$(docsdir)/$$p"; \ $(INSTALL_DATA) $(srcdir)/$$p $(DESTDIR)$(docsdir)/$$p; \ else if test -f $$p; then \ echo " $(INSTALL_DATA) $$p $(DESTDIR)$(docsdir)/$$p"; \ $(INSTALL_DATA) $$p $(DESTDIR)$(docsdir)/$$p; \ fi; fi; \ done uninstall-docsDATA: @$(NORMAL_UNINSTALL) list='$(docs_DATA)'; for p in $$list; do \ rm -f $(DESTDIR)$(docsdir)/$$p; \ done # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. @SET_MAKE@ all-recursive install-data-recursive install-exec-recursive \ installdirs-recursive install-recursive uninstall-recursive \ check-recursive installcheck-recursive info-recursive dvi-recursive: @set fnord $(MAKEFLAGS); amf=$$2; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" mostlyclean-recursive clean-recursive distclean-recursive \ maintainer-clean-recursive: @set fnord $(MAKEFLAGS); amf=$$2; \ dot_seen=no; \ rev=''; list='$(SUBDIRS)'; for subdir in $$list; do \ rev="$$subdir $$rev"; \ test "$$subdir" != "." || dot_seen=yes; \ done; \ test "$$dot_seen" = "no" && rev=". $$rev"; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done tags: TAGS ID: $(HEADERS) $(SOURCES) $(LISP) list='$(SOURCES) $(HEADERS)'; \ unique=`for i in $$list; do echo $$i; done | \ awk ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ here=`pwd` && cd $(srcdir) \ && mkid -f$$here/ID $$unique $(LISP) TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) $(LISP) tags=; \ here=`pwd`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -f $$subdir/TAGS && tags="$$tags -i $$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS)'; \ unique=`for i in $$list; do echo $$i; done | \ awk ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(ETAGS_ARGS)$$unique$(LISP)$$tags" \ || (cd $(srcdir) && etags -o $$here/TAGS $(ETAGS_ARGS) $$tags $$unique $(LISP)) mostlyclean-tags: clean-tags: distclean-tags: -rm -f TAGS ID maintainer-clean-tags: distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist -rm -rf $(distdir) GZIP=$(GZIP_ENV) $(TAR) zxf $(distdir).tar.gz mkdir $(distdir)/=build mkdir $(distdir)/=inst dc_install_base=`cd $(distdir)/=inst && pwd`; \ cd $(distdir)/=build \ && ../configure --srcdir=.. --prefix=$$dc_install_base \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) dist -rm -rf $(distdir) @banner="$(distdir).tar.gz is ready for distribution"; \ dashes=`echo "$$banner" | sed s/./=/g`; \ echo "$$dashes"; \ echo "$$banner"; \ echo "$$dashes" dist: distdir -chmod -R a+r $(distdir) GZIP=$(GZIP_ENV) $(TAR) chozf $(distdir).tar.gz $(distdir) -rm -rf $(distdir) dist-all: distdir -chmod -R a+r $(distdir) GZIP=$(GZIP_ENV) $(TAR) chozf $(distdir).tar.gz $(distdir) -rm -rf $(distdir) distdir: $(DISTFILES) -rm -rf $(distdir) mkdir $(distdir) -chmod 777 $(distdir) here=`cd $(top_builddir) && pwd`; \ top_distdir=`cd $(distdir) && pwd`; \ distdir=`cd $(distdir) && pwd`; \ cd $(top_srcdir) \ && $(AUTOMAKE) --include-deps --build-dir=$$here --srcdir-name=$(top_srcdir) --output-dir=$$top_distdir --gnu Makefile @for file in $(DISTFILES); do \ d=$(srcdir); \ if test -d $$d/$$file; then \ cp -pr $$d/$$file $(distdir)/$$file; \ else \ test -f $(distdir)/$$file \ || ln $$d/$$file $(distdir)/$$file 2> /dev/null \ || cp -p $$d/$$file $(distdir)/$$file || :; \ fi; \ done for subdir in $(SUBDIRS); do \ if test "$$subdir" = .; then :; else \ test -d $(distdir)/$$subdir \ || mkdir $(distdir)/$$subdir \ || exit 1; \ chmod 777 $(distdir)/$$subdir; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir=../$(distdir) distdir=../$(distdir)/$$subdir distdir) \ || exit 1; \ fi; \ done info-am: info: info-recursive dvi-am: dvi: dvi-recursive check-am: all-am check: check-recursive installcheck-am: installcheck: installcheck-recursive install-exec-am: install-exec: install-exec-recursive install-data-am: install-docsDATA install-data: install-data-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am install: install-recursive uninstall-am: uninstall-docsDATA uninstall: uninstall-recursive all-am: Makefile $(DATA) all-redirect: all-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) AM_INSTALL_PROGRAM_FLAGS=-s install installdirs: installdirs-recursive installdirs-am: $(mkinstalldirs) $(DESTDIR)$(docsdir) mostlyclean-generic: clean-generic: distclean-generic: -rm -f Makefile $(CONFIG_CLEAN_FILES) -rm -f config.cache config.log stamp-h stamp-h[0-9]* maintainer-clean-generic: mostlyclean-am: mostlyclean-tags mostlyclean-generic mostlyclean: mostlyclean-recursive clean-am: clean-tags clean-generic mostlyclean-am clean: clean-recursive distclean-am: distclean-tags distclean-generic clean-am distclean: distclean-recursive -rm -f config.status maintainer-clean-am: maintainer-clean-tags maintainer-clean-generic \ distclean-am @echo "This command is intended for maintainers to use;" @echo "it deletes files that may require special tools to rebuild." maintainer-clean: maintainer-clean-recursive -rm -f config.status .PHONY: uninstall-docsDATA install-docsDATA install-data-recursive \ uninstall-data-recursive install-exec-recursive \ uninstall-exec-recursive installdirs-recursive uninstalldirs-recursive \ all-recursive check-recursive installcheck-recursive info-recursive \ dvi-recursive mostlyclean-recursive distclean-recursive clean-recursive \ maintainer-clean-recursive tags tags-recursive mostlyclean-tags \ distclean-tags clean-tags maintainer-clean-tags distdir info-am info \ dvi-am dvi check check-am installcheck-am installcheck install-exec-am \ install-exec install-data-am install-data install-am install \ uninstall-am uninstall all-redirect all-am all installdirs-am \ installdirs mostlyclean-generic distclean-generic clean-generic \ maintainer-clean-generic clean mostlyclean distclean maintainer-clean # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: dd2-0.2.2/README0000644000175000017500000001341710071300153012644 0ustar reidracreidrac This is Dodgin' Diamond II With sound & music where available. ** Required ** DD2 needs SDL 1.2.x and SDL_Mixer. You can find both needed libraries at http://www.libsdl.org/ You can get newest version of this package at: http://www.usebox.net/jjm/dd2/ ** Install ** UNIX Instructions In the root directory of DD2 package: $ ./configure $ make $ su $ make install $ exit $ dd2 You may read the generic INSTALL file. Win32 Instructions The game doesn't need any installation. Just unzip the package and run dd2.exe. In case of error (eg. the game doesn't start), check stderr.txt file in dd2.exe directory. ** Configuration ** You can change player control, sound and graphic mode in the configuration screen of the game. By now you must restart DD2 in order to activate graphic configuration changes. ** Keyboard ** Player 1: UP, DOWN, LEFT, RIGHT, RIGHT CONTROL Player 2: w, s, a, d, LEFT CONTROL There are reports of systems with just one control key. In those systems you should use 'm' key instead RIGHT CONTROL. To enable this alternative fire key, configure with: $ ./configure --enable-alternate-fire-key ** Joystick ** Player 1: Joystick 1 (if available) Player 2: Joystick 2 (if available) Use the pad to move, first button to fire and second button to pause/resume the game. In the menu, use up/down, first button to select, and second button to exit. In the hiscore entry, use up/down to select letters, right to enter, second button to delete and first button to finish. ** Troubleshooting ** Some common issues: 1. Your computer is very old (slow) and the game doesn't run properly (Win32/X11). You can try changing sound quality in the configuration screen. Better sound requires a faster computer. 2. You graphic card doesn't support SDL's 320x200 8bpp full screen mode properly (Win32). That's not frequent, but may happen. You can set 'windowed' graphic mode in the configuration screeen. Setup Windows resolution to 640x480 and it will be playable in a window. 3. You cannot run DD2 in full screen mode (X11). SDL's full screen mode it's only supported under Win32. If you run it in full screen mode probably it will change your display to the closest screen mode available (if you don't have 320x200 in your mode list). If you wanna play it 320x200 full screen, add this mode to your X11 configuration. Check the FAQ about using SDL: http://www.libsdl.org/faq.php. 4. The sound doesn't work; or the sound works bad and/or the programs does 'Segmentation Fault' at exit (UNIX). This may be due you're running an audio daemon (esd, artsd) and SDL tries OSS API with /dev/dsp by default. You can use SDL_AUDIODRIVER environment variable to set the name of the driver you wanna use. The drivers available depend on your SDL installation. In order to use esd driver, execute in a bash alike shell: SDL_AUDIODRIVER="esd" dd2 Check the FAQ about using SDL: http://www.libsdl.org/faq.php. 5. My joystick/gamepad doesn't respond correctly (UNIX/Win32). You must calibrate your device. Under UNIX systems you should use jscal (If available). Under Win32 you should follow vendor instructions. 6. When I press alt+tab while playing on fullscreen mode all the graphics get corrupted when I continue playing the game (Win32). I don't have a windows system to try to fix that. I think it's something related to SDL usage of Direct X surfaces, but I don't know. By now the best way to avoid this problem is to not press alt+tab! 7. The game doesn't work on MAC OS X. DD2 uses SDL_DOUBLEBUF and that feature is not supported on MAC OS X. However since version 1.2.6 SDL has experimental code that should make it work, but I have no reports about it working. 8. I have a problem that is not listed here! Check the FAQ about using SDL: http://www.libsdl.org/faq.php. If you don't find a solution in that FAQ, just drop me a mail. ** Development scenario ** DD2 is being developed with... FreeBSD 4.8 (versions of dd2 pre 0.1) Debian GNU/Linux 3.0 (Woody) SoundTracker 0.6.6 Gimp 1.2.3 ** Feedback ** This software is BETA, so you should notice bugs or things not finished. In case of bugs, please report them to: "Juan J. Martinez" ** DD2 LICENSE ** Dodgin' Diamond 2, a shot'em up arcade Copyright (C) 2003,2004 Juan J. Martinez This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License Version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. **** About libraries distributed with DD2 binaries (Win32) ----------------------------------------------------- SDL RUN-TIME ENVIRONMENT: SDL.DLL and SDL_MIXER.DLL The Simple DirectMedia Layer (SDL for short) is a cross-platfrom library designed to make it easy to write multi-media software, such as games and emulators. SDL_mixer is a sample multi-channel audio mixer library. It supports any number of simultaneously playing channels of 16 bit stereo audio, plus a single channel of music, mixed by the popular MikMod MOD, Timidity MIDI, Ogg Vorbis, and SMPEG MP3 libraries. The Simple DirectMedia Layer library source code is available from: http://www.libsdl.org/ SDL_mixer library source code is available from: http://www.libsdl.org/projects/SDL_mixer/ These libraries are distributed under the terms of the GNU LGPL license: http://www.gnu.org/copyleft/lesser.html **** dd2-0.2.2/AUTHORS0000644000175000017500000000004207636076510013046 0ustar reidracreidracJuan J. Martinez dd2-0.2.2/COPYING0000444000175000017500000004307607636076510013045 0ustar reidracreidrac GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 675 Mass Ave, Cambridge, MA 02139, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS Appendix: How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. dd2-0.2.2/ChangeLog0000644000175000017500000000312110660375373013551 0ustar reidracreidrac0.2.2: - GPL v2 or later, for LGPLv3 compatibility 0.2.1: -joystick support for hiscore (up/down change letter, right next char, button 2 delete, button 1 finish) -ugly credits screen (just to do something from TODO list) -windowed mode is now default (thanks to Ben Anderman for his feedback) -while playing with joysticks, 2nd button is pause -menu can be used with 1st joystick (1st button accept, 2nd button exit) -support for two joysticks -hiscore it's shown only when needed -fix: hall of fame (thanks to Richard Andersson for his feedback) 0.2: -stage 2 ready -boss 2 ready -stage 1 ready -boss 1 added -boss bg music added -fix: pause key works also when joystick is used -fix: screenshot key works also when joystick is used -fix: now you don't need to restart the game to change controls 0.1: -game pause ('p' key) -graphic changes -gets current bpp to set the video mode -artwork by Aida Martnez Salamanca -weapon change now is level-1 (previous releases did level/2) -energy is now somewhat more useful (shied up +3) -added another ship -added some FX -Little 'finetune' in enemies AI -demo.act renamed to game.act. That won't be a demo stage anymore. -fix in configuration screen when you start DD2 with no sound and later change to sound -fixes in score (3nd -> 3rd uh) -some safety checks added 0.0.3: -some fixes in README -added hall of fame screen -added exit and hall of fame menu entries -added hi-score support (screen and save/load) -added special vefx 'stage' 0.0.2: -better user interface (menus, configuration screen) -experimental joystick support enabled 0.0.1: -initial public release dd2-0.2.2/INSTALL0000444000175000017500000001722707636076510013042 0ustar reidracreidracBasic Installation ================== These are generic installation instructions. The `configure' shell script attempts to guess correct values for various system-dependent variables used during compilation. It uses those values to create a `Makefile' in each directory of the package. It may also create one or more `.h' files containing system-dependent definitions. Finally, it creates a shell script `config.status' that you can run in the future to recreate the current configuration, a file `config.cache' that saves the results of its tests to speed up reconfiguring, and a file `config.log' containing compiler output (useful mainly for debugging `configure'). If you need to do unusual things to compile the package, please try to figure out how `configure' could check whether to do them, and mail diffs or instructions to the address given in the `README' so they can be considered for the next release. If at some point `config.cache' contains results you don't want to keep, you may remove or edit it. The file `configure.in' is used to create `configure' by a program called `autoconf'. You only need `configure.in' if you want to change it or regenerate `configure' using a newer version of `autoconf'. The simplest way to compile this package is: 1. `cd' to the directory containing the package's source code and type `./configure' to configure the package for your system. If you're using `csh' on an old version of System V, you might need to type `sh ./configure' instead to prevent `csh' from trying to execute `configure' itself. Running `configure' takes awhile. While running, it prints some messages telling which features it is checking for. 2. Type `make' to compile the package. 3. Optionally, type `make check' to run any self-tests that come with the package. 4. Type `make install' to install the programs and any data files and documentation. 5. You can remove the program binaries and object files from the source code directory by typing `make clean'. To also remove the files that `configure' created (so you can compile the package for a different kind of computer), type `make distclean'. There is also a `make maintainer-clean' target, but that is intended mainly for the package's developers. If you use it, you may have to get all sorts of other programs in order to regenerate files that came with the distribution. Compilers and Options ===================== Some systems require unusual options for compilation or linking that the `configure' script does not know about. You can give `configure' initial values for variables by setting them in the environment. Using a Bourne-compatible shell, you can do that on the command line like this: CC=c89 CFLAGS=-O2 LIBS=-lposix ./configure Or on systems that have the `env' program, you can do it like this: env CPPFLAGS=-I/usr/local/include LDFLAGS=-s ./configure Compiling For Multiple Architectures ==================================== You can compile the package for more than one kind of computer at the same time, by placing the object files for each architecture in their own directory. To do this, you must use a version of `make' that supports the `VPATH' variable, such as GNU `make'. `cd' to the directory where you want the object files and executables to go and run the `configure' script. `configure' automatically checks for the source code in the directory that `configure' is in and in `..'. If you have to use a `make' that does not supports the `VPATH' variable, you have to compile the package for one architecture at a time in the source code directory. After you have installed the package for one architecture, use `make distclean' before reconfiguring for another architecture. Installation Names ================== By default, `make install' will install the package's files in `/usr/local/bin', `/usr/local/man', etc. You can specify an installation prefix other than `/usr/local' by giving `configure' the option `--prefix=PATH'. You can specify separate installation prefixes for architecture-specific files and architecture-independent files. If you give `configure' the option `--exec-prefix=PATH', the package will use PATH as the prefix for installing programs and libraries. Documentation and other data files will still use the regular prefix. In addition, if you use an unusual directory layout you can give options like `--bindir=PATH' to specify different values for particular kinds of files. Run `configure --help' for a list of the directories you can set and what kinds of files go in them. If the package supports it, you can cause programs to be installed with an extra prefix or suffix on their names by giving `configure' the option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'. Optional Features ================= Some packages pay attention to `--enable-FEATURE' options to `configure', where FEATURE indicates an optional part of the package. They may also pay attention to `--with-PACKAGE' options, where PACKAGE is something like `gnu-as' or `x' (for the X Window System). The `README' should mention any `--enable-' and `--with-' options that the package recognizes. For packages that use the X Window System, `configure' can usually find the X include and library files automatically, but if it doesn't, you can use the `configure' options `--x-includes=DIR' and `--x-libraries=DIR' to specify their locations. Specifying the System Type ========================== There may be some features `configure' can not figure out automatically, but needs to determine by the type of host the package will run on. Usually `configure' can figure that out, but if it prints a message saying it can not guess the host type, give it the `--host=TYPE' option. TYPE can either be a short name for the system type, such as `sun4', or a canonical name with three fields: CPU-COMPANY-SYSTEM See the file `config.sub' for the possible values of each field. If `config.sub' isn't included in this package, then this package doesn't need to know the host type. If you are building compiler tools for cross-compiling, you can also use the `--target=TYPE' option to select the type of system they will produce code for and the `--build=TYPE' option to select the type of system on which you are compiling the package. Sharing Defaults ================ If you want to set default values for `configure' scripts to share, you can create a site shell script called `config.site' that gives default values for variables like `CC', `cache_file', and `prefix'. `configure' looks for `PREFIX/share/config.site' if it exists, then `PREFIX/etc/config.site' if it exists. Or, you can set the `CONFIG_SITE' environment variable to the location of the site script. A warning: not all `configure' scripts look for a site script. Operation Controls ================== `configure' recognizes the following options to control how it operates. `--cache-file=FILE' Use and save the results of the tests in FILE instead of `./config.cache'. Set FILE to `/dev/null' to disable caching, for debugging `configure'. `--help' Print a summary of the options to `configure', and exit. `--quiet' `--silent' `-q' Do not print messages saying which checks are being made. To suppress all normal output, redirect it to `/dev/null' (any error messages will still be shown). `--srcdir=DIR' Look for the package's source code in directory DIR. Usually `configure' can determine that directory automatically. `--version' Print the version of Autoconf used to generate the `configure' script, and exit. `configure' also accepts some other, not widely useful, options. dd2-0.2.2/Makefile.am0000644000175000017500000000025707636076510014042 0ustar reidracreidracSUBDIRS = src EXTRA_DIST = snapshot-sh AUTHORS COPYING NEWS README TODO ChangeLog docsdir = $(datadir)/doc/$(PACKAGE) docs_DATA = AUTHORS COPYING NEWS README TODO ChangeLog dd2-0.2.2/NEWS0000644000175000017500000000136010660375452012477 0ustar reidracreidracABOUT 0.2.2: This release only involves license changes. That's a 'fix things' release... so no new stage, sorry. I've had several reports about DD2's Joystick support working :D "freakdave" has repported DD2 0.2 works in the X-Box game console, but it has some problems. I've tried to fix such problems: -Use first Joystick in menu (1st but. select, 2nd but. exit) -Joystick should work in hiscores (UP/DOWN and RIGHT, 1st but. finish, 2nd but. delete) -While playing with Joystick, 2nd but. is pause -Now you can play DD2 with two Joysticks I've added support to systems with just one CONTROL key. You should configure the package with --enable-alternate-fire-key switch in order to use 'm' key instead RIGHT CONTROL. dd2-0.2.2/TODO0000644000175000017500000000011410066374656012471 0ustar reidracreidrac- more levels (gfx, ia, ...) - more music - optimizations (sin/cos tables?) dd2-0.2.2/acinclude.m40000644000175000017500000001254007636076510014175 0ustar reidracreidrac# Configure paths for SDL # Sam Lantinga 9/21/99 # stolen from Manish Singh # stolen back from Frank Belew # stolen from Manish Singh # Shamelessly stolen from Owen Taylor dnl AM_PATH_SDL([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND]]]) dnl Test for SDL, and define SDL_CFLAGS and SDL_LIBS dnl AC_DEFUN(AM_PATH_SDL, [dnl dnl Get the cflags and libraries from the sdl-config script dnl AC_ARG_WITH(sdl-prefix,[ --with-sdl-prefix=PFX Prefix where SDL is installed (optional)], sdl_prefix="$withval", sdl_prefix="") AC_ARG_WITH(sdl-exec-prefix,[ --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)], sdl_exec_prefix="$withval", sdl_exec_prefix="") AC_ARG_ENABLE(sdltest, [ --disable-sdltest Do not try to compile and run a test SDL program], , enable_sdltest=yes) if test x$sdl_exec_prefix != x ; then sdl_args="$sdl_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_args="$sdl_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi AC_PATH_PROG(SDL_CONFIG, sdl-config, no) min_sdl_version=ifelse([$1], ,0.11.0,$1) AC_MSG_CHECKING(for SDL - version >= $min_sdl_version) no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdlconf_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdlconf_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" dnl dnl Now check if the installed SDL is sufficiently new. (Also sanity dnl checks the results of sdl-config to some extent dnl rm -f conf.sdltest AC_TRY_RUN([ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { return 1; } } ],, no_sdl=yes,[echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then AC_MSG_RESULT(yes) ifelse([$2], , :, [$2]) else AC_MSG_RESULT(no) if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_TRY_LINK([ #include #include "SDL.h" ], [ return 0; ], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH"], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" ]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(SDL_CFLAGS) AC_SUBST(SDL_LIBS) rm -f conf.sdltest ]) dd2-0.2.2/aclocal.m40000644000175000017500000002146710660375652013654 0ustar reidracreidracdnl aclocal.m4 generated automatically by aclocal 1.4-p4 dnl Copyright (C) 1994, 1995-8, 1999 Free Software Foundation, Inc. dnl This file is free software; the Free Software Foundation dnl gives unlimited permission to copy and/or distribute it, dnl with or without modifications, as long as this notice is preserved. dnl This program is distributed in the hope that it will be useful, dnl but WITHOUT ANY WARRANTY, to the extent permitted by law; without dnl even the implied warranty of MERCHANTABILITY or FITNESS FOR A dnl PARTICULAR PURPOSE. # Configure paths for SDL # Sam Lantinga 9/21/99 # stolen from Manish Singh # stolen back from Frank Belew # stolen from Manish Singh # Shamelessly stolen from Owen Taylor dnl AM_PATH_SDL([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND]]]) dnl Test for SDL, and define SDL_CFLAGS and SDL_LIBS dnl AC_DEFUN(AM_PATH_SDL, [dnl dnl Get the cflags and libraries from the sdl-config script dnl AC_ARG_WITH(sdl-prefix,[ --with-sdl-prefix=PFX Prefix where SDL is installed (optional)], sdl_prefix="$withval", sdl_prefix="") AC_ARG_WITH(sdl-exec-prefix,[ --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)], sdl_exec_prefix="$withval", sdl_exec_prefix="") AC_ARG_ENABLE(sdltest, [ --disable-sdltest Do not try to compile and run a test SDL program], , enable_sdltest=yes) if test x$sdl_exec_prefix != x ; then sdl_args="$sdl_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_args="$sdl_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi AC_PATH_PROG(SDL_CONFIG, sdl-config, no) min_sdl_version=ifelse([$1], ,0.11.0,$1) AC_MSG_CHECKING(for SDL - version >= $min_sdl_version) no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdlconf_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdlconf_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" dnl dnl Now check if the installed SDL is sufficiently new. (Also sanity dnl checks the results of sdl-config to some extent dnl rm -f conf.sdltest AC_TRY_RUN([ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { return 1; } } ],, no_sdl=yes,[echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then AC_MSG_RESULT(yes) ifelse([$2], , :, [$2]) else AC_MSG_RESULT(no) if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_TRY_LINK([ #include #include "SDL.h" ], [ return 0; ], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH"], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" ]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(SDL_CFLAGS) AC_SUBST(SDL_LIBS) rm -f conf.sdltest ]) # Do all the work for Automake. This macro actually does too much -- # some checks are only needed if your package does certain things. # But this isn't really a big deal. # serial 1 dnl Usage: dnl AM_INIT_AUTOMAKE(package,version, [no-define]) AC_DEFUN(AM_INIT_AUTOMAKE, [AC_REQUIRE([AC_PROG_INSTALL]) PACKAGE=[$1] AC_SUBST(PACKAGE) VERSION=[$2] AC_SUBST(VERSION) dnl test to see if srcdir already configured if test "`cd $srcdir && pwd`" != "`pwd`" && test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi ifelse([$3],, AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])) AC_REQUIRE([AM_SANITY_CHECK]) AC_REQUIRE([AC_ARG_PROGRAM]) dnl FIXME This is truly gross. missing_dir=`cd $ac_aux_dir && pwd` AM_MISSING_PROG(ACLOCAL, aclocal, $missing_dir) AM_MISSING_PROG(AUTOCONF, autoconf, $missing_dir) AM_MISSING_PROG(AUTOMAKE, automake, $missing_dir) AM_MISSING_PROG(AUTOHEADER, autoheader, $missing_dir) AM_MISSING_PROG(MAKEINFO, makeinfo, $missing_dir) AC_REQUIRE([AC_PROG_MAKE_SET])]) # # Check to make sure that the build environment is sane. # AC_DEFUN(AM_SANITY_CHECK, [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftestfile # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftestfile 2> /dev/null` if test "[$]*" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftestfile` fi if test "[$]*" != "X $srcdir/configure conftestfile" \ && test "[$]*" != "X conftestfile $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "[$]2" = conftestfile ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi rm -f conftest* AC_MSG_RESULT(yes)]) dnl AM_MISSING_PROG(NAME, PROGRAM, DIRECTORY) dnl The program must properly implement --version. AC_DEFUN(AM_MISSING_PROG, [AC_MSG_CHECKING(for working $2) # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if ($2 --version) < /dev/null > /dev/null 2>&1; then $1=$2 AC_MSG_RESULT(found) else $1="$3/missing $2" AC_MSG_RESULT(missing) fi AC_SUBST($1)]) dd2-0.2.2/configure0000755000175000017500000014577010661102513013710 0ustar reidracreidrac#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated automatically using autoconf version 2.13 # Copyright (C) 1992, 93, 94, 95, 96 Free Software Foundation, Inc. # # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. # Defaults: ac_help= ac_default_prefix=/usr/local # Any additions from configure.in: ac_help="$ac_help --with-sdl-prefix=PFX Prefix where SDL is installed (optional)" ac_help="$ac_help --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)" ac_help="$ac_help --disable-sdltest Do not try to compile and run a test SDL program" ac_help="$ac_help --enable-alternate-fire-key Use 'm' key instead RIGHT CONTROL for fire" # Initialize some variables set by options. # The variables have the same names as the options, with # dashes changed to underlines. build=NONE cache_file=./config.cache exec_prefix=NONE host=NONE no_create= nonopt=NONE no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= target=NONE verbose= x_includes=NONE x_libraries=NONE bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datadir='${prefix}/share' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' libdir='${exec_prefix}/lib' includedir='${prefix}/include' oldincludedir='/usr/include' infodir='${prefix}/info' mandir='${prefix}/man' # Initialize some other variables. subdirs= MFLAGS= MAKEFLAGS= SHELL=${CONFIG_SHELL-/bin/sh} # Maximum number of lines to put in a shell here document. ac_max_here_lines=12 ac_prev= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval "$ac_prev=\$ac_option" ac_prev= continue fi case "$ac_option" in -*=*) ac_optarg=`echo "$ac_option" | sed 's/[-_a-zA-Z0-9]*=//'` ;; *) ac_optarg= ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case "$ac_option" in -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir="$ac_optarg" ;; -build | --build | --buil | --bui | --bu) ac_prev=build ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build="$ac_optarg" ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file="$ac_optarg" ;; -datadir | --datadir | --datadi | --datad | --data | --dat | --da) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=* | --data=* | --dat=* \ | --da=*) datadir="$ac_optarg" ;; -disable-* | --disable-*) ac_feature=`echo $ac_option|sed -e 's/-*disable-//'` # Reject names that are not valid shell variable names. if test -n "`echo $ac_feature| sed 's/[-a-zA-Z0-9_]//g'`"; then { echo "configure: error: $ac_feature: invalid feature name" 1>&2; exit 1; } fi ac_feature=`echo $ac_feature| sed 's/-/_/g'` eval "enable_${ac_feature}=no" ;; -enable-* | --enable-*) ac_feature=`echo $ac_option|sed -e 's/-*enable-//' -e 's/=.*//'` # Reject names that are not valid shell variable names. if test -n "`echo $ac_feature| sed 's/[-_a-zA-Z0-9]//g'`"; then { echo "configure: error: $ac_feature: invalid feature name" 1>&2; exit 1; } fi ac_feature=`echo $ac_feature| sed 's/-/_/g'` case "$ac_option" in *=*) ;; *) ac_optarg=yes ;; esac eval "enable_${ac_feature}='$ac_optarg'" ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix="$ac_optarg" ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he) # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat << EOF Usage: configure [options] [host] Options: [defaults in brackets after descriptions] Configuration: --cache-file=FILE cache test results in FILE --help print this message --no-create do not create output files --quiet, --silent do not print \`checking...' messages --version print the version of autoconf that created configure Directory and file names: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [same as prefix] --bindir=DIR user executables in DIR [EPREFIX/bin] --sbindir=DIR system admin executables in DIR [EPREFIX/sbin] --libexecdir=DIR program executables in DIR [EPREFIX/libexec] --datadir=DIR read-only architecture-independent data in DIR [PREFIX/share] --sysconfdir=DIR read-only single-machine data in DIR [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data in DIR [PREFIX/com] --localstatedir=DIR modifiable single-machine data in DIR [PREFIX/var] --libdir=DIR object code libraries in DIR [EPREFIX/lib] --includedir=DIR C header files in DIR [PREFIX/include] --oldincludedir=DIR C header files for non-gcc in DIR [/usr/include] --infodir=DIR info documentation in DIR [PREFIX/info] --mandir=DIR man documentation in DIR [PREFIX/man] --srcdir=DIR find the sources in DIR [configure dir or ..] --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names EOF cat << EOF Host type: --build=BUILD configure for building on BUILD [BUILD=HOST] --host=HOST configure for HOST [guessed] --target=TARGET configure for TARGET [TARGET=HOST] Features and packages: --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) --enable-FEATURE[=ARG] include FEATURE [ARG=yes] --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) --x-includes=DIR X include files are in DIR --x-libraries=DIR X library files are in DIR EOF if test -n "$ac_help"; then echo "--enable and --with options recognized:$ac_help" fi exit 0 ;; -host | --host | --hos | --ho) ac_prev=host ;; -host=* | --host=* | --hos=* | --ho=*) host="$ac_optarg" ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir="$ac_optarg" ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir="$ac_optarg" ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir="$ac_optarg" ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir="$ac_optarg" ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst \ | --locals | --local | --loca | --loc | --lo) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* \ | --locals=* | --local=* | --loca=* | --loc=* | --lo=*) localstatedir="$ac_optarg" ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir="$ac_optarg" ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir="$ac_optarg" ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix="$ac_optarg" ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix="$ac_optarg" ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix="$ac_optarg" ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name="$ac_optarg" ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir="$ac_optarg" ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir="$ac_optarg" ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site="$ac_optarg" ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir="$ac_optarg" ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir="$ac_optarg" ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target="$ac_optarg" ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers) echo "configure generated by autoconf version 2.13" exit 0 ;; -with-* | --with-*) ac_package=`echo $ac_option|sed -e 's/-*with-//' -e 's/=.*//'` # Reject names that are not valid shell variable names. if test -n "`echo $ac_package| sed 's/[-_a-zA-Z0-9]//g'`"; then { echo "configure: error: $ac_package: invalid package name" 1>&2; exit 1; } fi ac_package=`echo $ac_package| sed 's/-/_/g'` case "$ac_option" in *=*) ;; *) ac_optarg=yes ;; esac eval "with_${ac_package}='$ac_optarg'" ;; -without-* | --without-*) ac_package=`echo $ac_option|sed -e 's/-*without-//'` # Reject names that are not valid shell variable names. if test -n "`echo $ac_package| sed 's/[-a-zA-Z0-9_]//g'`"; then { echo "configure: error: $ac_package: invalid package name" 1>&2; exit 1; } fi ac_package=`echo $ac_package| sed 's/-/_/g'` eval "with_${ac_package}=no" ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes="$ac_optarg" ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries="$ac_optarg" ;; -*) { echo "configure: error: $ac_option: invalid option; use --help to show usage" 1>&2; exit 1; } ;; *) if test -n "`echo $ac_option| sed 's/[-a-z0-9.]//g'`"; then echo "configure: warning: $ac_option: invalid host type" 1>&2 fi if test "x$nonopt" != xNONE; then { echo "configure: error: can only configure for one host and one target at a time" 1>&2; exit 1; } fi nonopt="$ac_option" ;; esac done if test -n "$ac_prev"; then { echo "configure: error: missing argument to --`echo $ac_prev | sed 's/_/-/g'`" 1>&2; exit 1; } fi trap 'rm -fr conftest* confdefs* core core.* *.core $ac_clean_files; exit 1' 1 2 15 # File descriptor usage: # 0 standard input # 1 file creation # 2 errors and warnings # 3 some systems may open it to /dev/tty # 4 used on the Kubota Titan # 6 checking for... messages and results # 5 compiler messages saved in config.log if test "$silent" = yes; then exec 6>/dev/null else exec 6>&1 fi exec 5>./config.log echo "\ This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. " 1>&5 # Strip out --no-create and --no-recursion so they do not pile up. # Also quote any args containing shell metacharacters. ac_configure_args= for ac_arg do case "$ac_arg" in -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c) ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) ;; *" "*|*" "*|*[\[\]\~\#\$\^\&\*\(\)\{\}\\\|\;\<\>\?]*) ac_configure_args="$ac_configure_args '$ac_arg'" ;; *) ac_configure_args="$ac_configure_args $ac_arg" ;; esac done # NLS nuisances. # Only set these to C if already set. These must not be set unconditionally # because not all systems understand e.g. LANG=C (notably SCO). # Fixing LC_MESSAGES prevents Solaris sh from translating var values in `set'! # Non-C LC_CTYPE values break the ctype check. if test "${LANG+set}" = set; then LANG=C; export LANG; fi if test "${LC_ALL+set}" = set; then LC_ALL=C; export LC_ALL; fi if test "${LC_MESSAGES+set}" = set; then LC_MESSAGES=C; export LC_MESSAGES; fi if test "${LC_CTYPE+set}" = set; then LC_CTYPE=C; export LC_CTYPE; fi # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -rf conftest* confdefs.h # AIX cpp loses on an empty file, so make sure it contains at least a newline. echo > confdefs.h # A filename unique to this package, relative to the directory that # configure is in, which we can look for to find out if srcdir is correct. ac_unique_file=Makefile.am # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then its parent. ac_prog=$0 ac_confdir=`echo $ac_prog|sed 's%/[^/][^/]*$%%'` test "x$ac_confdir" = "x$ac_prog" && ac_confdir=. srcdir=$ac_confdir if test ! -r $srcdir/$ac_unique_file; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r $srcdir/$ac_unique_file; then if test "$ac_srcdir_defaulted" = yes; then { echo "configure: error: can not find sources in $ac_confdir or .." 1>&2; exit 1; } else { echo "configure: error: can not find sources in $srcdir" 1>&2; exit 1; } fi fi srcdir=`echo "${srcdir}" | sed 's%\([^/]\)/*$%\1%'` # Prefer explicitly selected file to automatically selected ones. if test -z "$CONFIG_SITE"; then if test "x$prefix" != xNONE; then CONFIG_SITE="$prefix/share/config.site $prefix/etc/config.site" else CONFIG_SITE="$ac_default_prefix/share/config.site $ac_default_prefix/etc/config.site" fi fi for ac_site_file in $CONFIG_SITE; do if test -r "$ac_site_file"; then echo "loading site script $ac_site_file" . "$ac_site_file" fi done if test -r "$cache_file"; then echo "loading cache $cache_file" . $cache_file else echo "creating cache $cache_file" > $cache_file fi ac_ext=c # CFLAGS is not in ac_cpp because -g, -O, etc. are not valid cpp options. ac_cpp='$CPP $CPPFLAGS' ac_compile='${CC-cc} -c $CFLAGS $CPPFLAGS conftest.$ac_ext 1>&5' ac_link='${CC-cc} -o conftest${ac_exeext} $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS 1>&5' cross_compiling=$ac_cv_prog_cc_cross ac_exeext= ac_objext=o if (echo "testing\c"; echo 1,2,3) | grep c >/dev/null; then # Stardent Vistra SVR4 grep lacks -e, says ghazi@caip.rutgers.edu. if (echo -n testing; echo 1,2,3) | sed s/-n/xn/ | grep xn >/dev/null; then ac_n= ac_c=' ' ac_t=' ' else ac_n=-n ac_c= ac_t= fi else ac_n= ac_c='\c' ac_t= fi ac_aux_dir= for ac_dir in $srcdir $srcdir/.. $srcdir/../..; do if test -f $ac_dir/install-sh; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f $ac_dir/install.sh; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break fi done if test -z "$ac_aux_dir"; then { echo "configure: error: can not find install-sh or install.sh in $srcdir $srcdir/.. $srcdir/../.." 1>&2; exit 1; } fi ac_config_guess=$ac_aux_dir/config.guess ac_config_sub=$ac_aux_dir/config.sub ac_configure=$ac_aux_dir/configure # This should be Cygnus configure. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # ./install, which can be erroneously created by make from ./install.sh. echo $ac_n "checking for a BSD compatible install""... $ac_c" 1>&6 echo "configure:565: checking for a BSD compatible install" >&5 if test -z "$INSTALL"; then if eval "test \"`echo '$''{'ac_cv_path_install'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else IFS="${IFS= }"; ac_save_IFS="$IFS"; IFS=":" for ac_dir in $PATH; do # Account for people who put trailing slashes in PATH elements. case "$ac_dir/" in /|./|.//|/etc/*|/usr/sbin/*|/usr/etc/*|/sbin/*|/usr/afsws/bin/*|/usr/ucb/*) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do if test -f $ac_dir/$ac_prog; then if test $ac_prog = install && grep dspmsg $ac_dir/$ac_prog >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : else ac_cv_path_install="$ac_dir/$ac_prog -c" break 2 fi fi done ;; esac done IFS="$ac_save_IFS" fi if test "${ac_cv_path_install+set}" = set; then INSTALL="$ac_cv_path_install" else # As a last resort, use the slow shell script. We don't cache a # path for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the path is relative. INSTALL="$ac_install_sh" fi fi echo "$ac_t""$INSTALL" 1>&6 # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL_PROGRAM}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' echo $ac_n "checking whether build environment is sane""... $ac_c" 1>&6 echo "configure:618: checking whether build environment is sane" >&5 # Just in case sleep 1 echo timestamp > conftestfile # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftestfile 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftestfile` fi if test "$*" != "X $srcdir/configure conftestfile" \ && test "$*" != "X conftestfile $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". { echo "configure: error: ls -t appears to fail. Make sure there is not a broken alias in your environment" 1>&2; exit 1; } fi test "$2" = conftestfile ) then # Ok. : else { echo "configure: error: newly created file is older than distributed files! Check your system clock" 1>&2; exit 1; } fi rm -f conftest* echo "$ac_t""yes" 1>&6 if test "$program_transform_name" = s,x,x,; then program_transform_name= else # Double any \ or $. echo might interpret backslashes. cat <<\EOF_SED > conftestsed s,\\,\\\\,g; s,\$,$$,g EOF_SED program_transform_name="`echo $program_transform_name|sed -f conftestsed`" rm -f conftestsed fi test "$program_prefix" != NONE && program_transform_name="s,^,${program_prefix},; $program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s,\$\$,${program_suffix},; $program_transform_name" # sed with no file args requires a program. test "$program_transform_name" = "" && program_transform_name="s,x,x," echo $ac_n "checking whether ${MAKE-make} sets \${MAKE}""... $ac_c" 1>&6 echo "configure:675: checking whether ${MAKE-make} sets \${MAKE}" >&5 set dummy ${MAKE-make}; ac_make=`echo "$2" | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_prog_make_${ac_make}_set'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftestmake <<\EOF all: @echo 'ac_maketemp="${MAKE}"' EOF # GNU make sometimes prints "make[1]: Entering...", which would confuse us. eval `${MAKE-make} -f conftestmake 2>/dev/null | grep temp=` if test -n "$ac_maketemp"; then eval ac_cv_prog_make_${ac_make}_set=yes else eval ac_cv_prog_make_${ac_make}_set=no fi rm -f conftestmake fi if eval "test \"`echo '$ac_cv_prog_make_'${ac_make}_set`\" = yes"; then echo "$ac_t""yes" 1>&6 SET_MAKE= else echo "$ac_t""no" 1>&6 SET_MAKE="MAKE=${MAKE-make}" fi PACKAGE=dd2 VERSION=0.2.2 if test "`cd $srcdir && pwd`" != "`pwd`" && test -f $srcdir/config.status; then { echo "configure: error: source directory already configured; run "make distclean" there first" 1>&2; exit 1; } fi cat >> confdefs.h <> confdefs.h <&6 echo "configure:721: checking for working aclocal" >&5 # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if (aclocal --version) < /dev/null > /dev/null 2>&1; then ACLOCAL=aclocal echo "$ac_t""found" 1>&6 else ACLOCAL="$missing_dir/missing aclocal" echo "$ac_t""missing" 1>&6 fi echo $ac_n "checking for working autoconf""... $ac_c" 1>&6 echo "configure:734: checking for working autoconf" >&5 # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if (autoconf --version) < /dev/null > /dev/null 2>&1; then AUTOCONF=autoconf echo "$ac_t""found" 1>&6 else AUTOCONF="$missing_dir/missing autoconf" echo "$ac_t""missing" 1>&6 fi echo $ac_n "checking for working automake""... $ac_c" 1>&6 echo "configure:747: checking for working automake" >&5 # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if (automake --version) < /dev/null > /dev/null 2>&1; then AUTOMAKE=automake echo "$ac_t""found" 1>&6 else AUTOMAKE="$missing_dir/missing automake" echo "$ac_t""missing" 1>&6 fi echo $ac_n "checking for working autoheader""... $ac_c" 1>&6 echo "configure:760: checking for working autoheader" >&5 # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if (autoheader --version) < /dev/null > /dev/null 2>&1; then AUTOHEADER=autoheader echo "$ac_t""found" 1>&6 else AUTOHEADER="$missing_dir/missing autoheader" echo "$ac_t""missing" 1>&6 fi echo $ac_n "checking for working makeinfo""... $ac_c" 1>&6 echo "configure:773: checking for working makeinfo" >&5 # Run test in a subshell; some versions of sh will print an error if # an executable is not found, even if stderr is redirected. # Redirect stdin to placate older versions of autoconf. Sigh. if (makeinfo --version) < /dev/null > /dev/null 2>&1; then MAKEINFO=makeinfo echo "$ac_t""found" 1>&6 else MAKEINFO="$missing_dir/missing makeinfo" echo "$ac_t""missing" 1>&6 fi # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 echo "configure:790: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS=":" ac_dummy="$PATH" for ac_dir in $ac_dummy; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then ac_cv_prog_CC="gcc" break fi done IFS="$ac_save_ifs" fi fi CC="$ac_cv_prog_CC" if test -n "$CC"; then echo "$ac_t""$CC" 1>&6 else echo "$ac_t""no" 1>&6 fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 echo "configure:820: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS=":" ac_prog_rejected=no ac_dummy="$PATH" for ac_dir in $ac_dummy; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then if test "$ac_dir/$ac_word" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" break fi done IFS="$ac_save_ifs" if test $ac_prog_rejected = yes; then # We found a bogon in the path, so make sure we never use it. set dummy $ac_cv_prog_CC shift if test $# -gt 0; then # We chose a different compiler from the bogus one. # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift set dummy "$ac_dir/$ac_word" "$@" shift ac_cv_prog_CC="$@" fi fi fi fi CC="$ac_cv_prog_CC" if test -n "$CC"; then echo "$ac_t""$CC" 1>&6 else echo "$ac_t""no" 1>&6 fi if test -z "$CC"; then case "`uname -s`" in *win32* | *WIN32*) # Extract the first word of "cl", so it can be a program name with args. set dummy cl; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 echo "configure:871: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS=":" ac_dummy="$PATH" for ac_dir in $ac_dummy; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then ac_cv_prog_CC="cl" break fi done IFS="$ac_save_ifs" fi fi CC="$ac_cv_prog_CC" if test -n "$CC"; then echo "$ac_t""$CC" 1>&6 else echo "$ac_t""no" 1>&6 fi ;; esac fi test -z "$CC" && { echo "configure: error: no acceptable cc found in \$PATH" 1>&2; exit 1; } fi echo $ac_n "checking whether the C compiler ($CC $CFLAGS $LDFLAGS) works""... $ac_c" 1>&6 echo "configure:903: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) works" >&5 ac_ext=c # CFLAGS is not in ac_cpp because -g, -O, etc. are not valid cpp options. ac_cpp='$CPP $CPPFLAGS' ac_compile='${CC-cc} -c $CFLAGS $CPPFLAGS conftest.$ac_ext 1>&5' ac_link='${CC-cc} -o conftest${ac_exeext} $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS 1>&5' cross_compiling=$ac_cv_prog_cc_cross cat > conftest.$ac_ext << EOF #line 914 "configure" #include "confdefs.h" main(){return(0);} EOF if { (eval echo configure:919: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then ac_cv_prog_cc_works=yes # If we can't run a trivial program, we are probably using a cross compiler. if (./conftest; exit) 2>/dev/null; then ac_cv_prog_cc_cross=no else ac_cv_prog_cc_cross=yes fi else echo "configure: failed program was:" >&5 cat conftest.$ac_ext >&5 ac_cv_prog_cc_works=no fi rm -fr conftest* ac_ext=c # CFLAGS is not in ac_cpp because -g, -O, etc. are not valid cpp options. ac_cpp='$CPP $CPPFLAGS' ac_compile='${CC-cc} -c $CFLAGS $CPPFLAGS conftest.$ac_ext 1>&5' ac_link='${CC-cc} -o conftest${ac_exeext} $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS 1>&5' cross_compiling=$ac_cv_prog_cc_cross echo "$ac_t""$ac_cv_prog_cc_works" 1>&6 if test $ac_cv_prog_cc_works = no; then { echo "configure: error: installation or configuration problem: C compiler cannot create executables." 1>&2; exit 1; } fi echo $ac_n "checking whether the C compiler ($CC $CFLAGS $LDFLAGS) is a cross-compiler""... $ac_c" 1>&6 echo "configure:945: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) is a cross-compiler" >&5 echo "$ac_t""$ac_cv_prog_cc_cross" 1>&6 cross_compiling=$ac_cv_prog_cc_cross echo $ac_n "checking whether we are using GNU C""... $ac_c" 1>&6 echo "configure:950: checking whether we are using GNU C" >&5 if eval "test \"`echo '$''{'ac_cv_prog_gcc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.c <&5; (eval $ac_try) 2>&5; }; } | egrep yes >/dev/null 2>&1; then ac_cv_prog_gcc=yes else ac_cv_prog_gcc=no fi fi echo "$ac_t""$ac_cv_prog_gcc" 1>&6 if test $ac_cv_prog_gcc = yes; then GCC=yes else GCC= fi ac_test_CFLAGS="${CFLAGS+set}" ac_save_CFLAGS="$CFLAGS" CFLAGS= echo $ac_n "checking whether ${CC-cc} accepts -g""... $ac_c" 1>&6 echo "configure:978: checking whether ${CC-cc} accepts -g" >&5 if eval "test \"`echo '$''{'ac_cv_prog_cc_g'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else echo 'void f(){}' > conftest.c if test -z "`${CC-cc} -g -c conftest.c 2>&1`"; then ac_cv_prog_cc_g=yes else ac_cv_prog_cc_g=no fi rm -f conftest* fi echo "$ac_t""$ac_cv_prog_cc_g" 1>&6 if test "$ac_test_CFLAGS" = set; then CFLAGS="$ac_save_CFLAGS" elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then CFLAGS="-g -O2" else CFLAGS="-g" fi else if test "$GCC" = yes; then CFLAGS="-O2" else CFLAGS= fi fi echo $ac_n "checking for main in -lm""... $ac_c" 1>&6 echo "configure:1011: checking for main in -lm" >&5 ac_lib_var=`echo m'_'main | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else ac_save_LIBS="$LIBS" LIBS="-lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else echo "configure: failed program was:" >&5 cat conftest.$ac_ext >&5 rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=no" fi rm -f conftest* LIBS="$ac_save_LIBS" fi if eval "test \"`echo '$ac_cv_lib_'$ac_lib_var`\" = yes"; then echo "$ac_t""yes" 1>&6 ac_tr_lib=HAVE_LIB`echo m | sed -e 's/[^a-zA-Z0-9_]/_/g' \ -e 'y/abcdefghijklmnopqrstuvwxyz/ABCDEFGHIJKLMNOPQRSTUVWXYZ/'` cat >> confdefs.h <&6 { echo "configure: error: math lib is needed" 1>&2; exit 1; } fi CFLAGS="$CFLAGS -Wall" # Check whether --with-sdl-prefix or --without-sdl-prefix was given. if test "${with_sdl_prefix+set}" = set; then withval="$with_sdl_prefix" sdl_prefix="$withval" else sdl_prefix="" fi # Check whether --with-sdl-exec-prefix or --without-sdl-exec-prefix was given. if test "${with_sdl_exec_prefix+set}" = set; then withval="$with_sdl_exec_prefix" sdl_exec_prefix="$withval" else sdl_exec_prefix="" fi # Check whether --enable-sdltest or --disable-sdltest was given. if test "${enable_sdltest+set}" = set; then enableval="$enable_sdltest" : else enable_sdltest=yes fi if test x$sdl_exec_prefix != x ; then sdl_args="$sdl_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_args="$sdl_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi # Extract the first word of "sdl-config", so it can be a program name with args. set dummy sdl-config; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 echo "configure:1098: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_SDL_CONFIG'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else case "$SDL_CONFIG" in /*) ac_cv_path_SDL_CONFIG="$SDL_CONFIG" # Let the user override the test with a path. ;; ?:/*) ac_cv_path_SDL_CONFIG="$SDL_CONFIG" # Let the user override the test with a dos path. ;; *) IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS=":" ac_dummy="$PATH" for ac_dir in $ac_dummy; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then ac_cv_path_SDL_CONFIG="$ac_dir/$ac_word" break fi done IFS="$ac_save_ifs" test -z "$ac_cv_path_SDL_CONFIG" && ac_cv_path_SDL_CONFIG="no" ;; esac fi SDL_CONFIG="$ac_cv_path_SDL_CONFIG" if test -n "$SDL_CONFIG"; then echo "$ac_t""$SDL_CONFIG" 1>&6 else echo "$ac_t""no" 1>&6 fi min_sdl_version=1.2.0 echo $ac_n "checking for SDL - version >= $min_sdl_version""... $ac_c" 1>&6 echo "configure:1133: checking for SDL - version >= $min_sdl_version" >&5 no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdlconf_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdlconf_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" rm -f conf.sdltest if test "$cross_compiling" = yes; then echo $ac_n "cross compiling; assumed OK... $ac_c" else cat > conftest.$ac_ext < #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { return 1; } } EOF if { (eval echo configure:1212: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then : else echo "configure: failed program was:" >&5 cat conftest.$ac_ext >&5 rm -fr conftest* no_sdl=yes fi rm -fr conftest* fi CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then echo "$ac_t""yes" 1>&6 : else echo "$ac_t""no" 1>&6 if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" cat > conftest.$ac_ext < #include "SDL.h" int main() { return 0; ; return 0; } EOF if { (eval echo configure:1256: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH" else echo "configure: failed program was:" >&5 cat conftest.$ac_ext >&5 rm -rf conftest* echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" fi rm -f conftest* CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" { echo "configure: error: SDL library is needed" 1>&2; exit 1; } fi rm -f conf.sdltest CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" echo $ac_n "checking for main in -lSDL_mixer""... $ac_c" 1>&6 echo "configure:1293: checking for main in -lSDL_mixer" >&5 ac_lib_var=`echo SDL_mixer'_'main | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else ac_save_LIBS="$LIBS" LIBS="-lSDL_mixer $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else echo "configure: failed program was:" >&5 cat conftest.$ac_ext >&5 rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=no" fi rm -f conftest* LIBS="$ac_save_LIBS" fi if eval "test \"`echo '$ac_cv_lib_'$ac_lib_var`\" = yes"; then echo "$ac_t""yes" 1>&6 ac_tr_lib=HAVE_LIB`echo SDL_mixer | sed -e 's/[^a-zA-Z0-9_]/_/g' \ -e 'y/abcdefghijklmnopqrstuvwxyz/ABCDEFGHIJKLMNOPQRSTUVWXYZ/'` cat >> confdefs.h <&6 { echo "configure: error: SDL_Mixer library is needed for sound support" 1>&2; exit 1; } fi # Check whether --enable-alternate-fire-key or --disable-alternate-fire-key was given. if test "${enable_alternate_fire_key+set}" = set; then enableval="$enable_alternate_fire_key" CFLAGS="$CFLAGS -DALT_FIRE" fi trap '' 1 2 15 cat > confcache <<\EOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs. It is not useful on other systems. # If it contains results you don't want to keep, you may remove or edit it. # # By default, configure uses ./config.cache as the cache file, # creating it if it does not exist already. You can give configure # the --cache-file=FILE option to use a different cache file; that is # what configure does when it calls configure scripts in # subdirectories, so they share the cache. # Giving --cache-file=/dev/null disables caching, for debugging configure. # config.status only pays attention to the cache file if you give it the # --recheck option to rerun configure. # EOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, don't put newlines in cache variables' values. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. (set) 2>&1 | case `(ac_space=' '; set | grep ac_space) 2>&1` in *ac_space=\ *) # `set' does not quote correctly, so add quotes (double-quote substitution # turns \\\\ into \\, and sed turns \\ into \). sed -n \ -e "s/'/'\\\\''/g" \ -e "s/^\\([a-zA-Z0-9_]*_cv_[a-zA-Z0-9_]*\\)=\\(.*\\)/\\1=\${\\1='\\2'}/p" ;; *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n -e 's/^\([a-zA-Z0-9_]*_cv_[a-zA-Z0-9_]*\)=\(.*\)/\1=${\1=\2}/p' ;; esac >> confcache if cmp -s $cache_file confcache; then : else if test -w $cache_file; then echo "updating cache $cache_file" cat confcache > $cache_file else echo "not updating unwritable cache $cache_file" fi fi rm -f confcache trap 'rm -fr conftest* confdefs* core core.* *.core $ac_clean_files; exit 1' 1 2 15 test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' # Any assignment to VPATH causes Sun make to only execute # the first set of double-colon rules, so remove it if not needed. # If there is a colon in the path, we need to keep it. if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=[^:]*$/d' fi trap 'rm -f $CONFIG_STATUS conftest*; exit 1' 1 2 15 # Transform confdefs.h into DEFS. # Protect against shell expansion while executing Makefile rules. # Protect against Makefile macro expansion. cat > conftest.defs <<\EOF s%#define \([A-Za-z_][A-Za-z0-9_]*\) *\(.*\)%-D\1=\2%g s%[ `~#$^&*(){}\\|;'"<>?]%\\&%g s%\[%\\&%g s%\]%\\&%g s%\$%$$%g EOF DEFS=`sed -f conftest.defs confdefs.h | tr '\012' ' '` rm -f conftest.defs # Without the "./", some shells look in PATH for config.status. : ${CONFIG_STATUS=./config.status} echo creating $CONFIG_STATUS rm -f $CONFIG_STATUS cat > $CONFIG_STATUS </dev/null | sed 1q`: # # $0 $ac_configure_args # # Compiler output produced by configure, useful for debugging # configure, is in ./config.log if it exists. ac_cs_usage="Usage: $CONFIG_STATUS [--recheck] [--version] [--help]" for ac_option do case "\$ac_option" in -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) echo "running \${CONFIG_SHELL-/bin/sh} $0 $ac_configure_args --no-create --no-recursion" exec \${CONFIG_SHELL-/bin/sh} $0 $ac_configure_args --no-create --no-recursion ;; -version | --version | --versio | --versi | --vers | --ver | --ve | --v) echo "$CONFIG_STATUS generated by autoconf version 2.13" exit 0 ;; -help | --help | --hel | --he | --h) echo "\$ac_cs_usage"; exit 0 ;; *) echo "\$ac_cs_usage"; exit 1 ;; esac done ac_given_srcdir=$srcdir ac_given_INSTALL="$INSTALL" trap 'rm -fr `echo "Makefile src/Makefile src/data/Makefile" | sed "s/:[^ ]*//g"` conftest*; exit 1' 1 2 15 EOF cat >> $CONFIG_STATUS < conftest.subs <<\\CEOF $ac_vpsub $extrasub s%@SHELL@%$SHELL%g s%@CFLAGS@%$CFLAGS%g s%@CPPFLAGS@%$CPPFLAGS%g s%@CXXFLAGS@%$CXXFLAGS%g s%@FFLAGS@%$FFLAGS%g s%@DEFS@%$DEFS%g s%@LDFLAGS@%$LDFLAGS%g s%@LIBS@%$LIBS%g s%@exec_prefix@%$exec_prefix%g s%@prefix@%$prefix%g s%@program_transform_name@%$program_transform_name%g s%@bindir@%$bindir%g s%@sbindir@%$sbindir%g s%@libexecdir@%$libexecdir%g s%@datadir@%$datadir%g s%@sysconfdir@%$sysconfdir%g s%@sharedstatedir@%$sharedstatedir%g s%@localstatedir@%$localstatedir%g s%@libdir@%$libdir%g s%@includedir@%$includedir%g s%@oldincludedir@%$oldincludedir%g s%@infodir@%$infodir%g s%@mandir@%$mandir%g s%@INSTALL_PROGRAM@%$INSTALL_PROGRAM%g s%@INSTALL_SCRIPT@%$INSTALL_SCRIPT%g s%@INSTALL_DATA@%$INSTALL_DATA%g s%@PACKAGE@%$PACKAGE%g s%@VERSION@%$VERSION%g s%@ACLOCAL@%$ACLOCAL%g s%@AUTOCONF@%$AUTOCONF%g s%@AUTOMAKE@%$AUTOMAKE%g s%@AUTOHEADER@%$AUTOHEADER%g s%@MAKEINFO@%$MAKEINFO%g s%@SET_MAKE@%$SET_MAKE%g s%@CC@%$CC%g s%@SDL_CONFIG@%$SDL_CONFIG%g s%@SDL_CFLAGS@%$SDL_CFLAGS%g s%@SDL_LIBS@%$SDL_LIBS%g CEOF EOF cat >> $CONFIG_STATUS <<\EOF # Split the substitutions into bite-sized pieces for seds with # small command number limits, like on Digital OSF/1 and HP-UX. ac_max_sed_cmds=90 # Maximum number of lines to put in a sed script. ac_file=1 # Number of current file. ac_beg=1 # First line for current file. ac_end=$ac_max_sed_cmds # Line after last line for current file. ac_more_lines=: ac_sed_cmds="" while $ac_more_lines; do if test $ac_beg -gt 1; then sed "1,${ac_beg}d; ${ac_end}q" conftest.subs > conftest.s$ac_file else sed "${ac_end}q" conftest.subs > conftest.s$ac_file fi if test ! -s conftest.s$ac_file; then ac_more_lines=false rm -f conftest.s$ac_file else if test -z "$ac_sed_cmds"; then ac_sed_cmds="sed -f conftest.s$ac_file" else ac_sed_cmds="$ac_sed_cmds | sed -f conftest.s$ac_file" fi ac_file=`expr $ac_file + 1` ac_beg=$ac_end ac_end=`expr $ac_end + $ac_max_sed_cmds` fi done if test -z "$ac_sed_cmds"; then ac_sed_cmds=cat fi EOF cat >> $CONFIG_STATUS <> $CONFIG_STATUS <<\EOF for ac_file in .. $CONFIG_FILES; do if test "x$ac_file" != x..; then # Support "outfile[:infile[:infile...]]", defaulting infile="outfile.in". case "$ac_file" in *:*) ac_file_in=`echo "$ac_file"|sed 's%[^:]*:%%'` ac_file=`echo "$ac_file"|sed 's%:.*%%'` ;; *) ac_file_in="${ac_file}.in" ;; esac # Adjust a relative srcdir, top_srcdir, and INSTALL for subdirectories. # Remove last slash and all that follows it. Not all systems have dirname. ac_dir=`echo $ac_file|sed 's%/[^/][^/]*$%%'` if test "$ac_dir" != "$ac_file" && test "$ac_dir" != .; then # The file is in a subdirectory. test ! -d "$ac_dir" && mkdir "$ac_dir" ac_dir_suffix="/`echo $ac_dir|sed 's%^\./%%'`" # A "../" for each directory in $ac_dir_suffix. ac_dots=`echo $ac_dir_suffix|sed 's%/[^/]*%../%g'` else ac_dir_suffix= ac_dots= fi case "$ac_given_srcdir" in .) srcdir=. if test -z "$ac_dots"; then top_srcdir=. else top_srcdir=`echo $ac_dots|sed 's%/$%%'`; fi ;; /*) srcdir="$ac_given_srcdir$ac_dir_suffix"; top_srcdir="$ac_given_srcdir" ;; *) # Relative path. srcdir="$ac_dots$ac_given_srcdir$ac_dir_suffix" top_srcdir="$ac_dots$ac_given_srcdir" ;; esac case "$ac_given_INSTALL" in [/$]*) INSTALL="$ac_given_INSTALL" ;; *) INSTALL="$ac_dots$ac_given_INSTALL" ;; esac echo creating "$ac_file" rm -f "$ac_file" configure_input="Generated automatically from `echo $ac_file_in|sed 's%.*/%%'` by configure." case "$ac_file" in *Makefile*) ac_comsub="1i\\ # $configure_input" ;; *) ac_comsub= ;; esac ac_file_inputs=`echo $ac_file_in|sed -e "s%^%$ac_given_srcdir/%" -e "s%:% $ac_given_srcdir/%g"` sed -e "$ac_comsub s%@configure_input@%$configure_input%g s%@srcdir@%$srcdir%g s%@top_srcdir@%$top_srcdir%g s%@INSTALL@%$INSTALL%g " $ac_file_inputs | (eval "$ac_sed_cmds") > $ac_file fi; done rm -f conftest.s* EOF cat >> $CONFIG_STATUS <> $CONFIG_STATUS <<\EOF exit 0 EOF chmod +x $CONFIG_STATUS rm -fr confdefs* $ac_clean_files test "$no_create" = yes || ${CONFIG_SHELL-/bin/sh} $CONFIG_STATUS || exit 1 dd2-0.2.2/configure.in0000644000175000017500000000114410660375406014310 0ustar reidracreidracdnl Process this file with autoconf to produce a configure script. AC_INIT(Makefile.am) AM_INIT_AUTOMAKE(dd2, 0.2.2) AC_PROG_CC AC_CHECK_LIB(m, main,, AC_MSG_ERROR(math lib is needed)) CFLAGS="$CFLAGS -Wall" AM_PATH_SDL(1.2.0,, AC_MSG_ERROR(SDL library is needed)) CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_CHECK_LIB(SDL_mixer, main,, AC_MSG_ERROR(SDL_Mixer library is needed for sound support)) AC_ARG_ENABLE(alternate-fire-key, [ --enable-alternate-fire-key Use 'm' key instead RIGHT CONTROL for fire], [CFLAGS="$CFLAGS -DALT_FIRE"]) AC_OUTPUT(Makefile src/Makefile src/data/Makefile) dd2-0.2.2/install-sh0000555000175000017500000001273607636076510014015 0ustar reidracreidrac#!/bin/sh # # install - install a program, script, or datafile # This comes from X11R5 (mit/util/scripts/install.sh). # # Copyright 1991 by the Massachusetts Institute of Technology # # Permission to use, copy, modify, distribute, and sell this software and its # documentation for any purpose is hereby granted without fee, provided that # the above copyright notice appear in all copies and that both that # copyright notice and this permission notice appear in supporting # documentation, and that the name of M.I.T. not be used in advertising or # publicity pertaining to distribution of the software without specific, # written prior permission. M.I.T. makes no representations about the # suitability of this software for any purpose. It is provided "as is" # without express or implied warranty. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. It can only install one file at a time, a restriction # shared with many OS's install programs. # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit="${DOITPROG-}" # put in absolute paths if you don't have them in your path; or use env. vars. mvprog="${MVPROG-mv}" cpprog="${CPPROG-cp}" chmodprog="${CHMODPROG-chmod}" chownprog="${CHOWNPROG-chown}" chgrpprog="${CHGRPPROG-chgrp}" stripprog="${STRIPPROG-strip}" rmprog="${RMPROG-rm}" mkdirprog="${MKDIRPROG-mkdir}" transformbasename="" transform_arg="" instcmd="$mvprog" chmodcmd="$chmodprog 0755" chowncmd="" chgrpcmd="" stripcmd="" rmcmd="$rmprog -f" mvcmd="$mvprog" src="" dst="" dir_arg="" while [ x"$1" != x ]; do case $1 in -c) instcmd="$cpprog" shift continue;; -d) dir_arg=true shift continue;; -m) chmodcmd="$chmodprog $2" shift shift continue;; -o) chowncmd="$chownprog $2" shift shift continue;; -g) chgrpcmd="$chgrpprog $2" shift shift continue;; -s) stripcmd="$stripprog" shift continue;; -t=*) transformarg=`echo $1 | sed 's/-t=//'` shift continue;; -b=*) transformbasename=`echo $1 | sed 's/-b=//'` shift continue;; *) if [ x"$src" = x ] then src=$1 else # this colon is to work around a 386BSD /bin/sh bug : dst=$1 fi shift continue;; esac done if [ x"$src" = x ] then echo "install: no input file specified" exit 1 else true fi if [ x"$dir_arg" != x ]; then dst=$src src="" if [ -d $dst ]; then instcmd=: chmodcmd="" else instcmd=mkdir fi else # Waiting for this to be detected by the "$instcmd $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if [ -f $src -o -d $src ] then true else echo "install: $src does not exist" exit 1 fi if [ x"$dst" = x ] then echo "install: no destination specified" exit 1 else true fi # If destination is a directory, append the input filename; if your system # does not like double slashes in filenames, you may need to add some logic if [ -d $dst ] then dst="$dst"/`basename $src` else true fi fi ## this sed command emulates the dirname command dstdir=`echo $dst | sed -e 's,[^/]*$,,;s,/$,,;s,^$,.,'` # Make sure that the destination directory exists. # this part is taken from Noah Friedman's mkinstalldirs script # Skip lots of stat calls in the usual case. if [ ! -d "$dstdir" ]; then defaultIFS=' ' IFS="${IFS-${defaultIFS}}" oIFS="${IFS}" # Some sh's can't handle IFS=/ for some reason. IFS='%' set - `echo ${dstdir} | sed -e 's@/@%@g' -e 's@^%@/@'` IFS="${oIFS}" pathcomp='' while [ $# -ne 0 ] ; do pathcomp="${pathcomp}${1}" shift if [ ! -d "${pathcomp}" ] ; then $mkdirprog "${pathcomp}" else true fi pathcomp="${pathcomp}/" done fi if [ x"$dir_arg" != x ] then $doit $instcmd $dst && if [ x"$chowncmd" != x ]; then $doit $chowncmd $dst; else true ; fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dst; else true ; fi && if [ x"$stripcmd" != x ]; then $doit $stripcmd $dst; else true ; fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dst; else true ; fi else # If we're going to rename the final executable, determine the name now. if [ x"$transformarg" = x ] then dstfile=`basename $dst` else dstfile=`basename $dst $transformbasename | sed $transformarg`$transformbasename fi # don't allow the sed command to completely eliminate the filename if [ x"$dstfile" = x ] then dstfile=`basename $dst` else true fi # Make a temp file name in the proper directory. dsttmp=$dstdir/#inst.$$# # Move or copy the file name to the temp name $doit $instcmd $src $dsttmp && trap "rm -f ${dsttmp}" 0 && # and set any options; do chmod last to preserve setuid bits # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $instcmd $src $dsttmp" command. if [ x"$chowncmd" != x ]; then $doit $chowncmd $dsttmp; else true;fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dsttmp; else true;fi && if [ x"$stripcmd" != x ]; then $doit $stripcmd $dsttmp; else true;fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dsttmp; else true;fi && # Now rename the file to the real destination. $doit $rmcmd -f $dstdir/$dstfile && $doit $mvcmd $dsttmp $dstdir/$dstfile fi && exit 0 dd2-0.2.2/missing0000555000175000017500000001451007636076510013400 0ustar reidracreidrac#! /bin/sh # Common stub for a few missing GNU programs while installing. # Copyright (C) 1996, 1997, 2001 Free Software Foundation, Inc. # Franc,ois Pinard , 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.in; then configure_ac=configure.ac else configure_ac=configure.in fi case "$1" in -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file yacc create \`y.tab.[ch]', if possible, from existing .[ch]" ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing - GNU libit 0.0" ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; aclocal) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`acinclude.m4' or \`$configure_ac'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`$configure_ac'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`acconfig.h' or \`$configure_ac'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' $configure_ac` test -z "$files" && files="config.h" touch_files= for f in $files; do case "$f" in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`$configure_ac'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; bison|yacc) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if [ $# -ne 1 ]; then eval LASTARG="\${$#}" case "$LASTARG" in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" y.tab.h fi ;; esac fi if [ ! -f y.tab.h ]; then echo >y.tab.h fi if [ ! -f y.tab.c ]; then echo 'main() { return 0; }' >y.tab.c fi ;; lex|flex) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if [ $# -ne 1 ]; then eval LASTARG="\${$#}" case "$LASTARG" in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if [ ! -f lex.yy.c ]; then echo 'main() { return 0; }' >lex.yy.c fi ;; makeinfo) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." file=`echo "$*" | sed -n 's/.*-o \([^ ]*\).*/\1/p'` if test -z "$file"; then file=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n '/^@setfilename/ { s/.* \([^ ]*\) *$/\1/; p; q; }' $file` fi touch $file ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and you do not seem to have it handy on your system. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequirements for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 dd2-0.2.2/mkinstalldirs0000555000175000017500000000132207636076510014604 0ustar reidracreidrac#! /bin/sh # mkinstalldirs --- make directory hierarchy # Author: Noah Friedman # Created: 1993-05-16 # Public domain # $Id: mkinstalldirs,v 1.13 1999/01/05 03:18:55 bje Exp $ errstatus=0 for file do set fnord `echo ":$file" | sed -ne 's/^:\//#/;s/^://;s/\// /g;s/^#/\//;p'` shift pathcomp= for d do pathcomp="$pathcomp$d" case "$pathcomp" in -* ) pathcomp=./$pathcomp ;; esac if test ! -d "$pathcomp"; then echo "mkdir $pathcomp" mkdir "$pathcomp" || lasterr=$? if test ! -d "$pathcomp"; then errstatus=$lasterr fi fi pathcomp="$pathcomp/" done done exit $errstatus # mkinstalldirs ends here dd2-0.2.2/snapshot-sh0000644000175000017500000000045707636076510014202 0ustar reidracreidracSHOTDATE=`date +"%Y%m%d"` make distclean mkdir ./.tmp/ mkdir ./.tmp/dd2_$SHOTDATE echo "This is $SHOTDATE snapshot of the game, not an official release." > ./.tmp/dd2_$SHOTDATE/README.snapshot cp -R * ./.tmp/dd2_$SHOTDATE cd ./.tmp/ tar cvfz ../dd2_$SHOTDATE.tar.gz ./dd2_$SHOTDATE cd .. rm -rf ./.tmp/