pax_global_header 0000666 0000000 0000000 00000000064 14160100006 0014476 g ustar 00root root 0000000 0000000 52 comment=2bc3e35daf3aa10f8a87fda1812187bec25e6359
pgmodeler-0.9.4/ 0000775 0000000 0000000 00000000000 14160100006 0013466 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/.github/ 0000775 0000000 0000000 00000000000 14160100006 0015026 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/.github/FUNDING.yml 0000664 0000000 0000000 00000000063 14160100006 0016642 0 ustar 00root root 0000000 0000000 ---
custom: ["https://pgmodeler.io/#donationForm"]
pgmodeler-0.9.4/.github/ISSUE_TEMPLATE/ 0000775 0000000 0000000 00000000000 14160100006 0017211 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/.github/ISSUE_TEMPLATE/Bug_report.md 0000664 0000000 0000000 00000001767 14160100006 0021656 0 ustar 00root root 0000000 0000000 ---
name: Report a bug
about: Instructions on how to report pgModeler bugs. Before report any bug please
check if someone already has submited issues similiar to yours. Duplicated issues
will be ignored.
---
**Bug description**
_A clear and concise description of what the bug is._
**How to reproduce**
_Please, if the bug can be reproduceable describe the steps in full details. If possible provide a sample model and/or a SQL dump for test purposes._
**Expected behavior**
_A clear and concise description of what you expected to happen._
**Screenshots**
_If applicable, add screenshots to help explain your problem._
**Info about your desktop**
- OS:
- Version:
- Window manager:
- pgModeler version:
- Qt version:
**Stacktrace / Debug info**
_If pgModeler crashed after the bug raised attach the stacktrace below_
```
Put the stacktrace here!
```
**Additional info**
_Add any other information that you may find useful to help in the problem solving._
pgmodeler-0.9.4/.github/ISSUE_TEMPLATE/Custom.md 0000664 0000000 0000000 00000000205 14160100006 0021002 0 ustar 00root root 0000000 0000000 ---
name: General discussion
about: For any discussion not related to bugs or feature requests please use this
one.
---
pgmodeler-0.9.4/.github/ISSUE_TEMPLATE/Feature_request.md 0000664 0000000 0000000 00000000634 14160100006 0022701 0 ustar 00root root 0000000 0000000 ---
name: Feature request / improvement
about: Give your suggestions for improvements to this project.
---
**Feature description**
_A clear and concise description of what the problem is._
**Sample image**
_If the feature requested is a visual improvement, please, attach some images to make it clear._
**Additional info**
_Add any other context or screenshots about the feature request here._
pgmodeler-0.9.4/.github/workflows/ 0000775 0000000 0000000 00000000000 14160100006 0017063 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/.github/workflows/linuxbuild.yml 0000664 0000000 0000000 00000001371 14160100006 0021767 0 ustar 00root root 0000000 0000000 name: Linux build
on:
push:
branches: [ master, develop, 0.9.*, '*fix*', '*change*', '*support*' ]
tags: 0.9.*
pull_request:
branches: [ master, develop, 0.9.* ]
jobs:
build:
runs-on: ubuntu-latest
strategy:
matrix:
qt: ['5.15.0', '5.14.2', '5.13.2', '5.12.9', '5.11.3', '5.10.1', '5.9.9']
steps:
- uses: actions/checkout@v2
- name: Installing Qt framework
uses: jurplel/install-qt-action@v2
with:
version: ${{ matrix.qt }}
- name: Running qmake
run: cd $GITHUB_WORKSPACE; qmake pgmodeler.pro -r PREFIX=$GITHUB_WORKSPACE/build CONFIG+=debug
- name: Building pgModeler
run: make -j6
- name: Deploying pgModeler
run: make install
pgmodeler-0.9.4/.github/workflows/macosbuild.yml 0000664 0000000 0000000 00000001521 14160100006 0021727 0 ustar 00root root 0000000 0000000 name: macOs build
on:
push:
branches: [ master, develop, 0.9.*, '*fix*', '*change*', '*support*' ]
tags: 0.9.*
pull_request:
branches: [ master, develop, 0.9.* ]
jobs:
build:
runs-on: macos-latest
strategy:
matrix:
qt: ['5.15.0', '5.14.2', '5.13.2', '5.12.9', '5.11.3', '5.10.1', '5.9.9']
steps:
- uses: actions/checkout@v2
- name: Installing Qt framework
uses: jurplel/install-qt-action@v2
with:
version: ${{ matrix.qt }}
- name: Running qmake
run: cd $GITHUB_WORKSPACE; qmake pgmodeler.pro -r PREFIX=/Applications/pgModeler.app/Contents PGSQL_INC=`pg_config --includedir` PGSQL_LIB=`pg_config --libdir`/libpq.dylib CONFIG+=debug
- name: Building pgModeler
run: make -j6
- name: Deploying pgModeler
run: make install
pgmodeler-0.9.4/.github/workflows/windowsbuild.yml 0000664 0000000 0000000 00000002435 14160100006 0022324 0 ustar 00root root 0000000 0000000 name: Windows build
on:
push:
branches: [ master, develop, 0.9.*, '*fix*', '*change*', '*support*' ]
tags: 0.9.*
pull_request:
branches: [ master, develop, 0.9.* ]
jobs:
build:
runs-on: windows-latest
strategy:
matrix:
qt: ['5.15.0']
defaults:
run:
shell: msys2 {0}
steps:
- uses: actions/checkout@v2
- uses: msys2/setup-msys2@v2
with:
msystem: MINGW64
update: true
install: base-devel mingw-w64-x86_64-make mingw-w64-x86_64-gcc mingw-w64-x86_64-postgresql mingw-w64-x86_64-qt5
# Workaround: Instead of using $GITHUB_WORKSPACE in PREFIX we actually use the path converted to unix-like
# since we're running the building inside msys2
- name: Running qmake
run: |
cd $GITHUB_WORKSPACE;
qmake pgmodeler.pro -r PREFIX=D:/a/pgmodeler/pgmodeler/build \
XML_INC=$(cygpath -m /mingw64/include/libxml2) \
XML_LIB=$(cygpath -m /mingw64/bin/libxml2-2.dll) \
PGSQL_INC=$(cygpath -m /mingw64/include) \
PGSQL_LIB=$(cygpath -m /mingw64/bin/libpq.dll) \
CONFIG+=debug
- name: Building pgModeler
run: mingw32-make -j6
- name: Deploying pgModeler
run: mingw32-make install
pgmodeler-0.9.4/.gitignore 0000664 0000000 0000000 00000000720 14160100006 0015455 0 ustar 00root root 0000000 0000000 .qmake.stash
*.[oa]
*.dll
*.exe
*.so.*
*.so
*.pro.user
*.directory
*.run
*.Debug
*.Release
*.old
moc_*.cpp
moc_*.h
qrc_resources.cpp
ui_*.h
windeploy.log
Makefile
build/*
dist/*
installer/template/packages/io.pgmodeler/data
installer/template/packages/io.pgmodeler/meta/package.xml
installer/template/config/config.xml
moc/*
obj/*
plugins
plugins/*
release/*
apps/pgmodeler/build/*
apps/pgmodeler-cli/build/*
apps/pgmodeler-ch/build/*
apps/pgmodeler-sce/build/* pgmodeler-0.9.4/CHANGELOG.md 0000664 0000000 0000000 00001003042 14160100006 0015277 0 ustar 00root root 0000000 0000000 Changelog
---------
v0.9.4
------
Release date: December 17, 2021
* [New] Added a fix step in CLI to reconstruct enum types XML code in new format.
* [Change] Changed the way XML code for enum types is generated and loaded.
* [Change] Minor improvement in reverse engineering to import enum types in the new format.
* [Change] Minor adjust in the demo version warning message.
* [Change] Minor adjustment in permission id generation. Now the object's signature is used instead of name.
* [Change] Minor refactor in the reconstruction of XML related to enum types in CLI.
* [Fix] Minor fix in deployment script to support new libicui versions.
* [Fix] Minor fix in order to set read/write permissions when copying configuration files with read-only permissions.
* [Fix] Minor fix in CLI to avoid the usage of '-platform offscreen' when calling the application.
* [Fix] Fixed a bug in file selectors on ModelExportForm that was not allowing to select output folders on Windows and macOs.
v0.9.4-beta1
------
Release date: November 08, 2021
* [New] Added extra PostGiS data types to PgSQLType.
* [New] Created the method PgSqlType::isPostGiSType() which returns true if the current type is a PostGiS one.
* [New] Created the method PgSqlType::reset() that clears some attributes of the type.
* [New] Added the built-in type pg_lsn in order to make databases using timescaledb extension to be imported correctly.
* [Change] Minor adjustment in windowsdeploy.sh to create zip packages.
* [Change] Minor adjustment in demo version warning messages.
* [Change] Adjusted the catalog query filters in ModelDatabaseDiffForm to retrieve system and extension objects according to the checkboxes "Import system objects" and "Import extension objects".
* [Change] Adjusted the reverse engineering in such a way that the table children will follow the SQL disabled state of their parent tables.
* [Change] Allowing importing pg_lsn attributes in usertype.sch.
* [Change] Allowing the use of commas in enum type labels.
* [Change] Improved the output of model fix operation in CLI.
* [Change] The constants DataSeparator, UnescValueStart, UnescValueEnd, WildcardChar, FilterSeparator, FilterWildcard, FilterRegExp were moved from CoreUtilsNs to UtilsNs in order to be used in the parsers module.
* [Change] In SchemaParser the meta char $ds (dollar sign) was renamed to $ms (money sign). Also, a new meta char $ds (data separator) was added and translates to the special data separator character UtilsNs::DataSeparator.
* [Change] Minor adjustments in table.sch and foreigntable.sch schema files.
* [Change] Improved DatabaseModel::getUserDefTypesReferences in order to get all references to postgis data types.
* [Change] Improved ModelValidationHelper in order to set postgis extension a default comment when automatically creating it.
* [Change] PgSQLTypeWidget now can be configured in such a way to disallow the configuration of type qualifiers like length, precision, interval, and some other. This is useful when configuring data types for objects that don't require such attributes in the data type like parameter, aggregates, transforms, casts, operators.
* [Change] Changed the behavior of Parameter::getCodeDefinition when generating SQL code. Now, any type qualifier (except dimension descriptor []) will be discarded.
* [Fix] Fixed the catalog query that lists policies.
* [Fix] Added a minor workaround in DatabaseImportHelper::getType in order to treat the "any" pseudo-type correctly.
* [Fix] Minor fix in DatabaseImportForm in order to disable option buttons when no connection is selected.
* [Fix] Fixed a segfault when importing domains with long expressions.
* [Fix] Fixed the broken SQL generation for tables with columns/constraints disabled.
* [Fix] Fix the name of the checkbox related to updates checking to avoid breaking the building when enabling NO_UPDATE_CHECK via qmake.
* [Fix] Fixed the shortcuts of Copy/Paste actions in DataManipulationForm.
v0.9.4-beta
------
Release date: September 20, 2021
* [New] Added the shortcut Alt+C to trigger the cancel action in DatabaseImportForm ModelDatabaseDiffForm and ModelExportForm.
* [New] Added support for the generation of GRANT/REVOKE commands to control roles memberships via the diff process.
* [New] Added a fix step to reconfigure roles membership considering the deprecation of Role:RefRole attribute.
* [New] Added support for included columns on indexes.
* [New] Added the ability to reference view columns on indexes.
* [New] Added support to use view's SimpleColumn in ColumnPickerWidget as well as Index.
* [New] Added .dtd extension to SchemaEditorForm::showFileDialog.
* [New] Created the widget ColumnPickerWidget by isolating the code that handles constraint columns in ConstraintWidget for reusing in other portions of the tool.
* [New] Added the method Constraint::addColumns().
* [New] Two buttons were added aside the date input fields in partial diff tab (ModelDatabaseDiffForm) in order to allow the quick assignment of the first and last modification dates.
* [New] Added support for toggling update notifications for alpha/beta versions.
* [New] Added support for save and restore the tree state in DatabaseExplorerWidget.
* [Change] Minor improvement in ModelsExportHelper by adding more breaking points related to export canceled.
* [Change] Minor improvement in ObjectRenameWidget in such a way to fill the new name field with the object's name in the first show when a single object is selected for renaming.
* [Change] Dropped the support for MemberOf (Role::RefRoles) in order to make the diff between two roles more precise.
* [Change] In RoleWidget the tab "Member Of" now works only as a convenience feature that adds the role being edited to the ones listed in that tab.
* [Change] Restored the file pgmodeler.appdata.xml.
* [Change] Refactored BaseObject::isCodeDiffersFrom (and its variants in children classes) to use QStringList instead of vector as parameters.
* [Change] Allowing swap cluster level object ids in SwapObjectsIdsWidget when the objects are of the same kind.
* [Change] Minor refactoring in RoleWidget, Role and DatabaseModel to use Role::RefRole, Role::MemberRole and Rele::AdminRole constants as loop indexes.
* [Change] Minor adjustment in demo features.
* [Change] Minor refactoring in Role::setRoleAttribute.
* [Change] Minor improvement in ModelExportHelper::exportToDbms to send the SQL command via a signal when creating roles and the database.
* [Change] Improvements in pgmodeler-se in such a way to control syntax highlighting settings per open editor.
* [Change] Avoided the use of a working dir in .desktop file when installing mime types system-wide.
* [Change] Improved the way layers rectangles are updated after undoing/redoing operations in OperationListWidget.
* [Change] Isolated SimpleColumn struct on its own file for reusing in other modules.
* [Change] Moved the constants ProtRowBgColor, ProtRowFgColor, RelAddedRowBgColor, RelAddedRowFgColor from BaseObjectWidget to GuiUtilsNs.
* [Change] Changed the default match type in foreign key constraint to MATCH SIMPLE.
* [Change] Minor adjustment in the ModelWidget::updateSceneLayers to force the update of all schemas.
* [Change] Avoided a lambda function call when checking updates to prevent segfaults.
* [Change] Exceptions raised in BugReportForm when the "lastmodel" file isn't found are now ignored.
* [Change] Minor change in ModelValidationHelper to use table's signature instead of name during the name validation process.
* [Change] Avoided calling the functions xmlInitParser() and xmlCleanupParser() more than once per app execution in XmlParser class to avoid unexpected behavior.
* [Change] Minor adjustment in viewport drawing mode in order to redraw objects by bounding rect changes.
* [Change] Minor improvements in the changelog widget in order to display the first modification date.
* [Change] Refactored Connection::requestCancel in order to avoid using PQrequestCancel which is deprecated.
* [Fix] Fixed a glitch when drawing StyledTextboxView instaces.
* [Fix] Fix the diff between columns using PostGiS datatypes.
* [Fix] The attributes Qt::AA_UseHighDpiPixmaps and Qt::AA_EnableHighDpiScaling are now correctly set before the instantiation of Application based classes.
* [Fix] Fixed a crash in diff process caused by the ModelExportHelper instance when canceling the export to DBMS when an exception was raised.
* [Fix] Fixed a crash in SwapObjectsIdsWidget when the user tried to swap objects using arrow keys.
* [Fix] Fixed the tab names in RoleWidget.
* [Fix] Minor fix in DatabaseExplorerWidget to display view's children source code.
* [Fix] Fixed the building of IndexWidget on Qt 5.14 and below.
* [Fix] Fixed the problem on ModelDatabaseDiffForm that was not accepting pressing Return/Esc to respectively run the diff and close the dialog due to a conflict with the event loop instance in ModelDatabaseDiffForm::exec().
* [Fix] Minor fix in the configuration of ObjectGroupId element in DatabaseImportForm::updateObjectsTree in order to avoid crashes when no root element is specified.
* [Fix] Fixed the generation of aggregate functions when they use functions that contain parameters in which data type have spaces (double precision, character varying).
* [Fix] Fixed a segfault that can happen when changing the number of parameters of a function already associated with an aggregate.
* [Fix] Additional fix for layers not being correctly loaded from dbm file.
v0.9.4-alpha1
------
Release date: July 19, 2021
* [New] The bulk editing form now can be confirmed by the Ctrl+Return shortcut.
* [New] The CLI now is capable of fixing models created before 0.9.4-alpha1 that have columns, functions, and other objects that reference extension types with simple names instead of schema-qualified names.
* [New] Added an option to GeneralConfigWidget to toggle the displaying of schema names of columns data types on design view. This option affects only the rendering of objects, the code generation will keep displaying user-defined type names in a schema-qualified way.
* [New] Created the DeletableItemDelegate which draws a delete button aside combobox items.
* [New] Added the ability to drop databases from the database listing in SQLToolWidget.
* [New] Added support to strikeout attribute in SyntaxHighlighter.
* [New] Created an auxiliary tool called pgModeler Schema Editor in order to help to edit *.sch files as well as validate their syntax.
* [New] GeneralConfigWidget now restores the sch-highlight.conf to default.
* [New] Added the environment variable name for schema editor app in GlobalAttributes.
* [New] Added a specific icon for CLI on Windows.
* [New] Added the methods SchemaParser::getCurrentColumn and SchemaParser::getCurrentLine.
* [New] Added signal s_hideRequested to FindReplaceWidget to notify connected slots that the close button on that widget was clicked.
* [New] Added an attribute capture-nearby to the word-separators tag that is read by SchemaParser to indicate if word separators must be capture altogether in the same word if they appear contiguously.
* [New] Added options to create only missing config files or recreate all config file in CLI.
* [New] Added support for saving SQL definition in split files.
* [New] Added support for split SQL generation in CLI.
* [New] Added the ability to cancel the SQL file export process in GUI.
* [New] Created the methods UtilsNs::saveFile and UtilsNs::loadFile in order to replace repetitive save/load code by them.
* [New] Created the function PgSqlVersions::parseString that checks the forced PostgreSQL version is valid, returning a fallback version when needed or raising an error if the version is malformed or is unsupported.
* [New] Added new metacharacter to SchemaParser: $hs for #, $ps for %, $at for @, $ds for $.
* [New] Added the option --force to the mime type handling operation on CLI.
* [Change] Changed the behavior of column click on DataManipulationForm. Now, the sorting is triggered by holding control and clicking the desired column. Clicking a column without holding control will select all the items in that column.
* [Change] Changed the behavior of extension types registration, now they will be forcibly registered with complete name (schema.name) in order to follow the same rule of user-defined data types so the reverse engineering can work properly for both types handled by extensions and those not.
* [Change] Improved the type searching on PgSqlTypeWidget in such a way to display a popup with the data types matching the text typed by the user.
* [Change] Improved TableObjectView to be rendered with/without schema names appended to user-defined data type names.
* [Change] Minor adjustment on icon size of QTreeWidget instances.
* [Change] Improved the NewObjectOverlayWidget in such a way to allow only one action to be executed at a time.
* [Change] Several clean-ups in the source code root. Removed unused files.
* [Change] The subproject libpgmodeler was renamed to libcore and now moved to libs/
* [Change] The subproject libpgmodeler_ui was renamed to libgui and now moved to libs/
* [Change] The subproject libobjrenderer was renamed to libcanvas and now moved to libs/
* [Change] The main executable subproject was renamed to pgmodeler and now moved to apps/
* [Change] The main-cli executable subproject was renamed to pgmodeler-cli and moved to apps/
* [Change] The crashhandler subproject was renamed to pgmodeler-ch and moved to apps/
* [Change] Created a subfolder called "assets" to store all deployed files that aren't libraries or executables: conf, lang, schemas, samples, etc.
* [Change] Refactored all .pro/.pri files in order to reference pgModeler libraries from variables $$LIB[LIBNAME] instead of relative paths.
* [Change] Renamed all icons that were in Portuguese to English.
* [Change] In SnippetsConfigWidget replaced the SQL highlight by Schema micro-language highlighting.
* [Change] Renamed BlockInfo class to TextBlockInfo and moved to a dedicated source file.
* [Change] Changed the workflows to build any *fix, *change, *support branches.
* [Change] Minor improvement on QMainWindow to resize general toolbar buttons.
* [Change] Widgets that were emitting the signal s_visibilityChanged(bool) only on hide event no emit s_hideRequested instead. The s_visibilityChanged(bool) is now reserved to widgets that need to notify visibility changes passing the current state to slots (hidden/displayed) in for of a bool parameter.
* [Change] Minor hint text typos fixes.
* [Change] Improved the syntax error messages in SchemaParser.
* [Change] Minor adjustment in the minimum width of the general toolbar when resizing the buttons.
* [Change] BaseForm::setMainWidget(QWidget *) version will use the same icon as the widget being inserted.
* [Change] Adjusting the general toolbar width according to the screen DPI.
* [Change] Renamed the namespace PgModelerUiNs to GuiUtilsNs.
* [Change] Renamed the namespace PgModelerNs to CoreUtilsNs
* [Change] Source files and ui files in libgui were reorganized by contexts (widgets, tools, settings, utils, dbobjects)
* [Change] Applied an automatic indentation to all schema files.
* [Change] pgModeler will now create missing config files in the startup.
* [Change] Replaced duplicated code that saves files and raises exception by UtilsNs::saveFile
* [Change] The class Schema now has its own id interval (4000 - 4999) in order to make the split code generation be done properly.
* [Change] Minor adjustment in AppearanceConfigWidget to enable scrollbars in the viewport so users on small screens can see the entire model.
* [Fix] Fixed the crash handler and bug report form in such a way to load the last modified model opened before their execution.
* [Fix] Fixed the column positions in ObjectDepsRefsWidget.
* [Fix] Fixed a crash when the database import process fails to create an inheritance relationship somehow.
* [Fix] Fixed a bug in the database import process that not correctly setting up the data type name of columns when the types were handled by extensions. Types handled by extension don't need to have the schema name prepended.
* [Fix] Minor fix in database import process in such a way to properly update the table rendering to hide schema names from title box.
* [Fix] Fixed a malformed SQL code when configuring timestamptz in PgSqlType.
* [Fix] Fixed the reference to libutils in deploy scripts.
* [Fix] Fixed doxygen references for libraries and executables.
* [Fix] Fixed the path to globalattributes.cpp in deploy scripts.
* [Fix] Added missing file windows_ico.qrc.
* [Fix] Fixed a bug in SyntaxHighlighter that was wrongly highlighting the entire document when a multiline group had a line break as the final expression.
* [Fix] Fixed the syntax highligting files (xml, sql).
* [Fix] Minor fix in CLI in order to associate .sch files to the scheditor.
* [Fix] Fixed a bug that was causing all layers to be active even if there was some inactive (invisible) when adding a new layer.
* [Fix] Fixed the method PgModelerCliApp::handleWindowsMimeDatabase to properly insert sch file association in Windows registry.
* [Fix] Fixed the "iCCP: CRC error" in PNGS at libs/libgui/res/icons
* [Fix] Minor fix in SyntaxHighlighter in order to return unformatted word when the group can't be forcibly defined in all exception cases when the word doesn't match any group.
* [Fix] Fixed the description of the option --output in CLI.
* [Fix] Fixed a bug in CLI that could lead to segfault when using diff option and a database model as input.
* [Fix] Fix broken build on Qt 5.11.x.
* [Fix] Minor fix in PgSQLTypeWidget to capture the text changing signal on data type combo so the type format input can be properly updated when the user types the desire data type.
v0.9.4-alpha
------
Release date: May 12, 2021
* [New] Added compatibility code that allows loading models created in versions before 0.9.4-alpha without losing layers and active layers information.
* [New] Added an option to the metadata handling operation that serves to indicate if duplicated objects (textboxes, tags, generic sql) must be merged or not.
* [New] Added support for configuration parameters and transform types on functions and procedures.
* [New] Added the compatibility method QtCompat::horizontalAdvance(QFont, QString).
* [New] Added the ability to rename the default layer.
* [New] DatabaseModel now stores in XML code all the new settings related to layers (rect and name colors, rect and names display status).
* [New] Added several methods in ObjectsScene to handle layer colors that helps to save and restore colors from database model files.
* [New] Add support for custom layer colors in LayerConfigWidget.
* [New] Added the class LayerItem to create custom items for displaying layout rects in canvas.
* [New] Added an option to toggle layers rectangles and names from LayerConfigWidget.
* [New] Added support for setup, in general settings, the custom color for grid lines, canvas area and page delimiter lines.
* [New] Added support for multiple layers on the model.
* [New] Added support for PARALLEL attribute to functions.
* [Change] Minor improvement on "Forced filtering" option on ObjectsFilterWidget in order to use a list widget instead of single actions for each object type.
* [Change] Adjusted the default Qt version to 5.15.2 in the deployment scripts.
* [Change] Minor adjustments on Messagebox resizing during first display.
* [Change] Minor improvement on Messagebox in order to display the stack trace toggle button in a more intuitive way.
* [Change] Changed the behaviour of the method ObjectsScene::removeLayers, now it'll allow the resetting or not the layers of the objects.
* [Change] Minor adjustment on QTableWidget vertical header size on DataManipulationForm, ObjectsTableWidget and SqlExecultionWidget.
* [Change] Minor size adjustment policy in the comboboxes in DataManipulationForm, ModelNavigationWidget and ModelValidationWidget.
* [Change] Minor improvement in DatabaseImportHelper::setBaseFunctionAttribs in such a way to discover the name of the functions transform types from their oids.
* [Change] Isolated the duplicated code in DatabaseModel::createFunction and DatabaseModel::createProcedure in the method DatabaseModel::setBasicFunctionAttributes.
* [Change] Adjusted the minimum size of the main window to 640x480 so it can fit in smaller screens.
* [Change] Minor refactoring on SchemaView::configureObject to avoid unecessary calculations when the layers are not visible.
* [Change] Added forced updates of schema rectangles after setting layers to children objects.
* [Change] Change on the search path for PluginsDir to use getPathFromEnv().
* [Change] LayersConfigWidget will now emit a signal when toggling layer rects/names so the overview widget on mainwindow is properly updated.
* [Change] DatabaseModel will now create a default layer in the constructor.
* [Change] The database model will add the default layer to the loaded model if there isn't a single layer identified.
* [Change] DatabaseModel when loading older database model files will generate random layer colors.
* [Change] The scene now will update layer rects when catching the signal s_objectDimensionChanged from tables and textboxes.
* [Change] Adjust the ObjectsScene to resize layer rects when one or more layers are removed.
* [Change] Improved the window title of DataManipulationForm in sucha a way to display the currently browsed table.
* [Change] Improved the selection of layers to be associated to object in context menu (Quick > Set layers). Now a floating widget is use to select multiple layers for the object selection in the canvas area.
* [Change] Updated the sample models to use "layers" attributes on graphical objects.
* [Change] Changed the value separator for attributes layers and active-layers on from semi-colon to comma.
* [Change] pgModeler CLI will now rename "layer" attributes to "layers" in order to reflect the multiple layers support for older models.
* [Change] Minor copyright updates.
* [Change] The option "Truncate before alter columns" in the diff process was removed since its use is discouraged and dangerous in some situations.
* [Fix] Minor fix in the table's catalog query in order to avoid setting up a partitioning strategy when the table is not a partitioned one.
* [Fix] Minor fix in database import in such a way to update scene layers info before adding it to the main window.
* [Fix] Fixed the layers configuration of example.dbm.
* [Fix] Minor fix in function.sch in order to generate transform types only for PostgreSQL >= 9.5.
* [Fix] Fixed DatabaseModel::getUserDefTypesReferences in such a way to detect that procedures and functions are referencing a user-defined type from their list of transform types.
* [Fix] Fixed ObjectsTableWidget in such a way to control whether the ResizeColsButton can be displayed or not via ObjectsTableWidget::setButtonConfiguration.
* [Fix] Minor fix to avoid black canvas when using settings from 0.9.3 or below on 0.9.4-alpha.
* [Fix] Minor fix in BaseObjectView in such way to avoid the adjustment of its position to the scene grid when the object is not selected. This can avoid undesired adjustment when moving a schema box and having only a portion of its children selected.
* [Fix] Minor fix in ObjectsScene in such a way to update layer rects when the grid alignment option is toggled.
* [Fix] Fixed the buttons shortcuts on LayerConfigWidget.
* [Fix] Minor fix on SchemaView to compute the last position any time the object is reconfigured.
* [Fix] Minor fix in BaseObjectWidget to avoid mark the object as modified in finishConfiguration() before adding it to the parent.
* [Fix] Fixed the key combination to trigger the magnifier tool.
* [Fix] Fixed LayerItem in order to build in Qt 5.9.
* [Fix] Minor fixes in ModelWidget, MainWindow to update scene layer settings correctly.
* [Fix] Fixed the CLI in such a way to update scene layer settings so the exporting processes can generate graphical files correctly.
* [Fix] Minor fix in LayersConfigWidget in such a way to mark the correct active layers when setting up the model to operate on.
* [Fix] Fixed a bug in the layers removal process that was causing objects to be placed in a incorrect layer index after the removal.
* [Fix] Fixed the "Fix" menu in main tool bar.
* [Fix] Fixed a bug in ModelWidget that was causing overlay to be displayed when a textbox object was selected.
* [Fix] Fixed wrong text in collationwidget.ui.
* [Fix] Fixed a bug during the loading of changelog entries.
* [Fix] Fixed the display of warnings during export in ModelExportForm.
* [Fix] Fixed the display of warning messages during export in ModelDatabaseDiffForm.
* [Fix] Fixed a malformed SQL code for triggers.
* [Fix] Fixed typos in README.md.
* [Fix] Fixed the broken build on Qt 5.9.x.
* [Fix] Fixed a bug that was preventing special PKs to be properly configured.
* [Fix] Fixed the SQL generation of functions based on internal language.
v0.9.3
------
Release date: December 30, 2020
* [New] Added support for deterministic and provider attributes in collations.
* [New] Added missing check constraints in the data dictionary.
* [New] Added support for selecting all relationships of a table at once via right-click on a table > select relationships.
* [New] Added extra search fields in ObjectFinderWidget. Now it's possible to search relationships by the involved tables (source and destination table), constraints by their columns (source and referenced columns), and relationships by the foreign keys related to them.
* [Change] The warning message about the unchecked option related to drop missing objects now pops up only when there are partial diff filters configured.
* [Change] Improved the extended fade in/out options for tables/views/foreign tables.
* [Change] The partial diff filters generated from changelog will ignore table children objects in order to avoid the wrong generation of diff code.
* [Change] Minor refactoring in DatabaseModel::addChangelogEntry in order to use new attributes to define changelog operations.
* [Fix] Fixed a crash when trying to select children objects of a schema that has no rectangle defined.
* [Fix] Fixed a crash during the importing of domain objects.
* [Fix] Fixed a crash during the importing of objects into the current model in very specific cases when the model had some tables/views referencing columns added by relationship.
* [Fix] Fixed the full diff switching when there are no filtered objects in ModelDatabaseDiffForm.
* [Fix] Fixed a bug in DatabaseModel::addChangelogEntry that was causing the registration of empty signature for some objects.
* [Fix] Fixed a bug in CLI that was not accepting the use of --list-conns parameter
* [Fix] Fixed the data dictionary generation in such a way to include nextval(sequence) calls in the "default value" column.
* [Fix] Fixed a bug when configuring spatial data types during reverse engineering/diff.
* [Fix] Fixed a bug in Catalog::parseDefaultValues that was causing ARRAY[] values to be wrongly split.
* [Fix] Fixed a bug that was causing infinite validation of imported sequences.
v0.9.3-beta1
------
Release date: October 5, 2020
* [New] Added the version descriptor for PostgreSQL 13.
* [New] Added support for procedures in design, import and diff processes.
* [New] Added support for transforms in design, import and diff processes.
* [New] Added an entry in NewObjectOverlayWidget for procedures.
* [New] Added a custom version of addParameter to Procedure in order to validate the usage of out parameters.
* [New] Added a tool button for transform objects in NewObjectOverlayWidget
* [New] Added a unit test to verify schema files syntax (sql, xml, alter).
* [New] Added the method Cast::setName to override the default behavior of BaseObject::setName.
* [New] Added the class PgModelerUnitTest that must be inherited so the child test class can have access to schema files path.
* [New] Added support for modifying attributes toggler colors from appearance settings.
* [New] Tag objects now include attribute toggler colors.
* [Change] Changed the behavior of the generation of SQL code for database object, now it'll respect the SQL disabled status of the object.
* [Change] The ModelExportHelper will abort the export process if the SQL code of the database object is disabled.
* [Change] The database model is now flagged as modified everytime the objects are swapped.
* [Change] Improved the ObjectSelectorWidget in order to save/restore the geometry of internal ModelObjectsWidget instances.
* [Change] Ajusted the Qt version check in QFontMetricsCompat and QPlainTextEditCompat in order to avoid deprecation warnings.
* [Change] pgModeler will alert about a possible data/work loss if the user is trying to save a model in which there're other instances loaded other tabs.
* [Change] Refactored FunctionWidget in such way to make it a subclass of BaseFunctionWidget.
* [Change] Removing unused method DatabaseModel::removeObject(unsigned,ObjectType).
* [Change] Moved the DTD defintion of parameter tag to a dedicated file to be shared betwen function.dtd and procedure.dtd.
* [Change] Making the class Function be a direct child of BaseFunction.
* [Change] Moved the common code between functions and procedures to a base class called BaseFunction.
* [Change] Replaced the attributes PhysicalTable::DataSeparator and DatabaseExplorerWidget::ElemSeparator usages by PgModelerNs::DataSeparator.
* [Change] Minor improvement on data dictionary in order to add the current year in the footer.
* [Change] ModelExportHelper now is capable of indetifying a transform and procedure objects being exported.
* [Change] Minor fields sizes adjustment in pgsqltypewidget.ui
* [Change] Improved the schema files syntax tests to include all folder under / schemas.
* [Change] Refactored the schema files in order to remove code duplication related to ddl-end token.
* [Change] Minor improvement in ConfigurationForm by adding a splitter between config items (left) and settings page (right).
* [Change] Minor improvements on objects rendering in order to consider screen dpi when configuring objects border sizes.
* [Change] Minor refactoring in the parameter/signature generation in class Function.
* [Change] Making the NewObjectOverlay less transparent in order to enhance reading.
* [Fix] Fixed a bug in constraint.sch that was avoiding the correct importing of exclude of constraints.
* [Fix] Fixed source file name for PgModelerCliApp.
* [Fix] Minor fix in the SyntaxHighlighter in order to highlight correctly multline blocks (specially comments).
* [Fix] Fixed a bug in DatabaseImportHelper that was causing failure when importing some objects' permissions.
* [Fix] Minor fixes on the CLI menu.
* [Fix] Fixed a bug on MainWindow that was wrongly showing the main menu bar in certain cases at startup.
* [Fix] Minor fix in BaseFunction::createSignature in order to remove OUT keywords from signature.
* [Fix] Fixed a bug when importing triggers in which functions arguments contain json/jsonb values. Now values are properly formatted.
* [Fix] Fixed a bug in XmlParser::convertCharsToXMLEntities that was not converting json/jsonb default values correctly breaking the entire XML code of the database model.
* [Fix] Fixed a bug in Parameter class that was causing default values to be ignored.
* [Fix] Fixed a bug in SchemaParser related to exceptions being raised wrongly in expressions evaluation.
* [Fix] Fixed the objects style template config files.
* [Fix] Removed some deprecation warnings when building on Qt 5.15.1.
* [Fix] Fixed a bug in ModelFixForm that was passing arguments to CLI in wrong format.
* [Fix] Minor fix in some project files to remove unnused include paths.
* [Fix] Fixed a bug in CLI that was ignoring input-db parameter when doing diff.
* [Fix] Minor fix in the graphical objects rendering in 4k screens when QT_AUTO_SCREEN_SCALE_FACTOR is set to. Now they are rendered in acceptable proportions.
* [Fix] Minor fix in ModelsDiffHelper in order to avoid generating ALTER...ADD COSTRAINT related to constraints (check and unique) in which parent table is also being created.
v0.9.3-beta
------
Release date: July 10, 2020
* [New] Added GitHub actions scripts in order to test the building on each platform. On Linux and macOs the build will occur on all Qt versions from 5.15 to 5.9, on Windows the build happens only on Qt 5.15 (due to the usage of msys2 that uses the most recent version of the framework).
* [New] Added default constructors in the form "Class(const &)" for Connection, Parameter and TypeAttribute in order to avoid deprecated-copy warnings on GCC9.
* [New] The CLI now validates the mixing of options of different operation modes.
* [New] Added support for partial diffs between a model and database or between two databases.
* [New] Created an internal changelog on DatabaseModel to register object's modification over time being useful for partial diff operations.
* [New] Added the widget called ChangelogWidget to control the model's internal changelog settings in the design view.
* [New] Added support for save/load changelog from model file.
* [New] The CLI now supports partial diffs too.
* [New] Create the method ModelsDiffHelper::getRelationshipFilters.
* [New] Added a warning message prior to the partial diff without using "Do not drop missing objects" option.
* [New] Created a method ObjectsFilterWidget::setModelFilteringMode that disables some options when the filtering widget is being used to filter database model objects.
* [New] Added cast and user mapping to the list of filterable objects.
* [New] Added a hint text in ObjectsFilterWidget to inform about exact match searching.
* [New] Added the methods Catalog::clearObjectFilter and Catalog::clearObjectFilters.
* [New] Added support for DatabaseImportHelper to create a sequence assigned to a column via default value if automatic dependencies resolution is enabled.
* [New] Created the namespace QtCompat that will reunite all the specific code that isn't compatible between different Qt versions. The goal of this namespace is to store in a central point all the code that uses QT_VERSION_CHECK to perform different operations depending on the current Qt version.
* [New] Added the method SchemaParser::getExpressionResult in order to perform comparisons between QVariant values correctly due to the QVariant operators deprecation in Qt 5.15.
* [New] Added the signal ObjectsFilterWidget::s_filtersRemoved that is emitted whenever all filters are removed.
* [Change] Modified the script wingetdate.bat in order to return the build number based on the current local date correctly and renamed it to getbuildnum.bat.
* [Change] Updated to 5.15 the Qt version used by default in linuxdeploy.sh and macdeploy.sh.
* [Change] Replacing verbose QString() calls by "" for string initialization purposes.
* [Change] Improved the sequences assignments to columns in DatabaseImportHelper::assignSequencesToColumns.
* [Change] Improved the method ModelsDiffHelper::setFilteredObjects in order to treat tables/view/foreign tables properly by appending their children objects to the creation order list of filtered objects.
* [Change] Adjusted the Catalog::setObjectFilters in order to configure exact match filters when any wildcard filter provided has no *.
* [Change] Adjusted the partial diff process between a model and a database in which there's one or more many-to-many relationships filtered.
* [Change] Minor adjustment on objects grids in SwapObjectsIdsWidget, DatabaseImportForm and ModelDatabaseDiffForm by changing the columns order.
* [Change] Improved the method ModelsDiffHelper::setFilteredObjects in order to detect the proper creation order of the provided objects.
* [Change] Minor change in ObjectsFilterWidget by making the action "Only matching" checked by default.
* [Change] Minor improvement on CLI to accept the value "all" for the paramenter --force-children in order to force all table children at once.
* [Change] BaseObject::configureSearchAttributes now configures the signature attribute as a formatted string.
* [Change] Minor improvement on ObjectFinderWidget::updateObjectTable in order to optionally create checkable items in the first column.
* [Change] Attributes related to object filters were moved from Catalog to PgModelerNs in order to be shared between Catalog and DatabaseModel classes.
* [Change] Minor improvement in Connection::getConnectionId in order to return an optional HTML formatted string.
* [Change] Isolated the method DatabaseImportForm::listFilteredObjects in a static one in order to reuse it on ModelDatabaseDiffForm.
* [Change] Improved the objects filtering in such way to allow filter by name or signature.
* [Change] Improved the UI of ObjectsFilterWidget by moving all options to a popup menu.
* [Change] Several changes in all catalog queries in order to support signature matching.
* [Change] Minor adjustemnt in Catalog::getFilterableObjectNames.
* [Change] Adjusted the appimages building process.
* [Change] Changing the default font size of graphical objects to 10pt in order to try to solve the intermittend issue of disappearing texts.
* [Change] Updated the French translation.
* [Fix] Fixed a regression in ObjectFinderWidget that was not opening objects form with double-click on an item on the results grid.
* [Fix] Fixed a bug when drawing relationships in FK to PK connection mode. Now when one of the tables is collapsed the center points of both are used as connection points to the relationship.
* [Fix] Fixed a crash in ModelDatabaseDiffForm while enabling/disabling the partial diff tab.
* [Fix] Fixed the diff process for inheritance relationships created for two existing tables.
* [Fix] Fixed a crash in LayersWidget when renaming a layer.
* [Fix] Minor fix in DatabaseImportHelper::assignSequencesToColumns.
* [Fix] Fixed a wrong comparison in Catalog::getObjectsOIDs.
* [Fix] Minor fix in ConstraintWidget that was trying to validate FK relationships for generated tables of many-to-many relationships.
* [Fix] Fixed a bug in Catalog::getObjectsOIDs that was executing a catalog query for a certain object when it was not being filtered.
* [Fix] Minor fix in ModelDatabaseDiffForm tabs enabling/disabling steps.
* [Fix] Fixed the QProcess usage in ModelFixForm due to QProcess::start() deprecation in Qt 5.15.
* [Fix] Fixed a crash when trying to move several objects to a layer from the object finder widget and in the selected set one or more objects aren't graphical ones.
v0.9.3-alpha1
------
Release date: May 20, 2020
* [New] Added support for creating initial configuration files from CLI.
* [New] The CLI is now capable of using the objects filtering in reverse engineering.
* [New] Added a warning message when trying to import a big database.
* [New] Added support for object filtering in reverse engineering dialog.
* [New] Adding support for AppImage building for Linux.
* [New] Added support for importing PostgreSQL 12 generated columns.
* [New] Adding support for PostgreSQL 12 generated columns.
* [New] The ModelNavigationWidget now will display a save icon if the current model is pending a save operation.
* [New] pgModeler now guesses if a FK relationship consists in a one-to-one based upon the foreign keys and unique keys settings.
* [New] Improved the rendering of FK relationships. Now it recognizes the minimum cardinality by using the right crow's foot descriptor o|< or ||< in the destination entity.
* [New] Added support for the conversion of 1-1 and 1-n relationships, allowing the user to perform modifications over objects generated by those relationships.
* [New] Added "virtual" keyword in classes that inherit others so the destruction order can be followed correctly.
* [New] Adding support for copy model validation widget output as text as well preview it as texts.
* [New] Added support for show/hide all layers in LayersWidget.
* [New] Added the paramenter application_name to Connection in order to indentify connections created by pgModeler when querying pg_stat_activity.
* [New] Added support for save/restore Z value attribute in MetadataHandlingForm.
* [New] Created an improved and reusable file selector widget.
* [Change] Improvements done in DatabaseImportHelper in order to speed up the listing of types as well the importing user-defined types on demand.
* [Change] Refactored the way default value fields states are setup by user's actions.
* [Change] Adjusted the default size of DatabaseImportForm.
* [Change] Avoiding retrieve all types (system and user defined) at once before the reverse engineering in DatabaseImportHelper (Experimental).
* [Change] Minor improvement on DatabaseImportHelper in order to display the correct message while assingning sequences to columns.
* [Change] Improved the catalog queries in order to retrive parent oids and type when using the list queries.
* [Change] Minor updates on windeploy.sh and macdeploy.sh
* [Change] Minor improvement on DatabaseImportHelper in order to speed up the objects creation.
* [Change] Improved the execution time for the catalog query of data types.
* [Change] Improved the catalog query for sequences.
* [Change] Avoiding the diff process to generate default value changes for generated columns.
* [Change] Minor improvement on DatabaseModel::validateRelationships.
* [Change] Improved the ModelWidget::convertRelationship1N() in order to avoid segfaults in certain cases.
* [Change] Minor adjustment in PhysicalTable::restoreRelObjectsIndexes in order to diminish memory usage.
* [Change] Minor improvement on update icon.
* [Change] Minor improvement in LayersWidget in order to allow manual resizing using the mouse.
* [Change] Improved the following classess in order to use the new file selector widget: ModelExportForm, ModelFixForm, MetadataHandlingForm, ModelDatabaseDiffForm, GeneralConfigWidget, PluginsConfigWidget, CsvLoadWidget, CrashHandlerForm and BugReportForm.
* [Fix] Minor fix in OperationList in order to update FK relationships related to FKs that contains the column being handled by the list.
* [Fix] Fixed a bug when retrieving the refs to some objects in DatabaseModel.
* [Fix] Minor fix in CLI menu and error messages.
* [Fix] Fixed the role importing process. Now referenced roles are auto resolved.
* [Fix] Fixed the dependency checking for user defined types in DatabaseModel.
* [Fix] Fixed a bug when loading extension that has no schema specified.
* [Fix] Minor fix in DatabaseImportHelper::createFunction in order to solve eventual duplicated parameter names when importing some functions.
* [Fix] Fixed a bug that was causing global name patterns for relationships to never be used even if they were properly configured.
* [Fix] Minor fix in ModelObjectsWidget and ModelWidget to provide the correct information about objects' selection in SceneInfoWidget.
* [Fix] Fixed a bug in RelationshipWidget that was causing the cursor never to be restored to its original icon when an exception occurred during relationship editing.
* [Fix] Fixed a crash in some situations when closing models.
v0.9.3-alpha
------
Release date: March 26, 2020
* [New] Added support for multiselection in ModelObjectsWidget.
* [New] Added an optional parameter in PgModelerNs::generateUniqueName to avoid comparing the input object.
* [New] Added support for objects' bulk renaming.
* [New] Added support for multiselection in ObjectFinderWidget.
* [New] Added support for middle button click on source code panel in order to paste the selected code in the current open SQL execution widget.
* [New] Using the CRTP (Curiosly Recurring Template Pattern) approach to create a template type based on BaseType in such way that the static member from that template but used on all derived classes of TemplateType can be unique for each derived class.
* [New] Added a "Stacking" action in popup menu that is used to control the z value of graphical objects.
* [New] Adding support for move objects on the Z stack up and down.
* [New] Added support for CLI to write system wide mime database on Linux and Windows.
* [New] Added a method GlobalAttributes::setSearchPath so the application can setup the path in which the internal folders (schemas, lang, etc) can be found.
* [New] Added the ability to remove owners from objects from Quick Actions > Change owner.
* [New] Added an fix step that removes IN keyword from functions signatures.
* [Change] Refactored the method DatabaseModel::getObjectDependecies by splliting it into small portions that handles specific object types dependecies.
* [Change] The DatabaseModel::getObjectReferences was splitted in other get[object]References() in order to facilitate maintainance.
* [Change] Minor adjustments in order to make the objects listing a bit faster for large databases.
* [Change] Minor improvement on ObjectRenameWidget in order to apply renaming in reverse id order of the object so objects invalidations (due to relationships revalidations) diminishes.
* [Change] In DatabaseModel the invalidated special objects are now stored in a list which is destroyed only when the model is destroyed too. This will avoid segfaults in some cases when the objects in that list are still being referenced in the operation list (Experimental).
* [Change] Minor adjustment in ModelObjectsWidget and ObjectFinderWidget in order to emit the signal ModelWidget::s_sceneInteracted so the left menu at MainWindow can be updated accordingly.
* [Change] Minor change in PgModelerNs::generateUniqueName in order to remove quotes from names before perform the comparison.
* [Change] Refactored ObjectRenameWidget in order to support multiple objects renaming.
* [Change] Refectored all the classes derivated from BaseType moving them to dedicated sources files in order to make them reuse TemplateType class isolating the related keywords, improving maintainance.
* [Change] Removed the class LanguageType since it was replaced by namespace DefaultLanguages namespace.
* [Change] Isolated the default language names into a namespace called DefaultLanguages and removed any reference to LanguageType in the code.
* [Change] Improved the DataManipulationForm in such way that the user can sort results by clicking the column names in the result grid. This will cause a new query to be performed by using the clicked column as sorting criteria.
* [Change] The current model's popup menu is now used as the "More" actions menu at MainWindow > general toolbar.
* [Change] Refactored the ModelWidget::configurePopupMenu separating some portions in new methods to make maintainance more easy.
* [Change] Moved the 'Fix model' and 'Objects metadata' actions to the general toolbar (left) at main window under the menu "Fix".
* [Change] The class HintTextWidget was removed and replaced by simple html QToolTips.
* [Change] Small change in the icon related to new tab opening in SQLToolWidget.
* [Change] Minor adjustment or rows resizing policy on datamanipulationform.ui.
* [Change] Minor adjustment on updatenotifierwidget.ui to allow link opening.
* [Change] Refined the installer wizard pages.
* [Change] Improved the installer script to work better on Windows.
* [Change] Improving the installer on Linux and Windows to select the installation for all users or current user.
* [Change] Improved the linuxdeploy.sh in order to remove the need to use the startup scripts by the binaries in the installer.
* [Change] Fixed the installscript.qs in order to correctly update the mime database on Linux.
* [Change] Minor improvements on the usability of swap objects ids form.
* [Change] Separated the code that handles mime db on linux and windows, using a #ifdef switch to call the correct method depending on the platform.
* [Change] Adjusting the linker options to make the executables search for libraries in PRIVATELIBDIR without forcing the usage of LD_LIBRARY_PATH.
* [Change] The class Application was moved to libutils and has a basic implementation of just initialize the search path on GlobalAttributes.
* [Change] Rename the classes Application and PgModelerCli to respectively PgModelerApp and PgModelerCliApp and they now inherits the new Application class in order to take advantage of the GlobalAttributes::setSearchPath.
* [Change] The crash handler application is now executed under a Application instance not a QApplication anymore in order to use GlobalAttributes::setSearchPath.
* [Change] Changed the namespace GlobalAttributes to a singleton in order try to solve problems with fallback paths.
* [Change] Updated deployment scripts to use Qt 5.14.x
* [Change] Changing the exposed main window from QMainWindow to MainWindow in PgModelerPlugin interface.
* [Change] Moved the method SchemaParser::convertCharsToXMLEntities to XmlParser.
* [Change] Minor buttons position adjustments on WelcomeWidget.
* [Change] Minor refactoring on OperationListWidget in order to show a more compact text when displaying operations done over objects.
* [Change] Removed the workaround code that disables the ALTER SET OWNER when the role associated to it is disabled and the object itself not. The best approach is to dissociate the role from the object so the ALTER instruction is not generated.
* [Fix] Fixed a shortcut duplication in DatabaseExplorerWidget
* [Fix] Fixed the shortcut for partitioning relationships in new object overlay
* [Fix] Fixed a minor bug in MainWindow that was causing the bottom widgets bar to be displayed even when object finder widget and model validation widget weren't visible.
* [Fix] Fixed a bug that was causing copy options to stay hidden for copy relationships in the relationship form.
* [Fix] Fixed the importing of extensions on PostgreSQL 9.4 and below.
* [Fix] Fixed the name uniqueness generation when the name is truncated when exceeding 63 bytes.
* [Fix] Fixed a bug that was preventing the recent menus cleaning to be persisted in the conf file.
* [Fix] Fix a bug in the validation of collation objects.
* [Fix] Fixed a crash in ObjectRenameWidget when renaming several objects in which there was the need to revalidate relationships;
* [Fix] Fixed the method PgSqlType::getTypes in order to avoid returning the first (null) type.
* [Fix] Fix the importing/diff of columns based on PostGiS data types.
* [Fix] Fix a crash in UpdateNotifierWidget when compiling pgModeler using Qt 5.14.x.
* [Fix] Minor fix in PgSQLTypeWidget to avoid show an error message box when the user types an invalid data type name.
* [Fix] Additional fix on XmlParser::convertCharsToXMLEntities in order to replace special char to xml entities correctly.
* [Fix] Minor fix in the update notifier widget display position.
* [Fix] Minor fix in diff regarding to the comparison on column/domain default values. Now the values are compared in insensitive case.
* [Fix] Fixed the Windows installer in order to create the start menu item correctly (system wide).
* [Fix] Minor fix on CLI in order to allocate export/import/diff helpers and config widgets only when they are required (when one of the options related are used).
* [Fix] Fixed a bug that was allowing the applying changes of the forms on relationship added objects by hitting ENTER causing crashes.
* [Fix] Fixed the bug that was causing model restoration to be displayed when the application was started from a double click on a model file.
* [Fix] Fixed a bug in the metadata handling that was not restoring the collapse mode of tables.
* [Fix] Fixed a crash on UpdateNotifierWidget after upgrading to 5.14. A wrong deletion was being performed where deleteLater() needed to be used instead
* [Fix] Removing lots of Qt 5.14 deprecation warnings in the code.
* [Fix] Fix a bug that was causing wrong replacements during the reverse engineering of functions.
* [Fix] Fixed the method XmlParser::convertCharsToXMLEntities in order to avoid chars replacements within Release date: December 26, 2019
* [New] Add support for data dictionaries generation in HTML format in ModelExportForm.
* [New] Added options to control data dictionary generation in CLI.
* [New] Plugins now can optionally be associated to a menu action or not. Generally, an plugin not associated to a menu action is automatilly executed during the startup (see PgModelerPlugin::initPlugin).
* [New] Added a missing model fix step on CLI that removes the IN keyword from functions signatures.
* [Change] Making BaseRelationship::getReferenceForeignKey() public.
* [Change] Isolated duplicated code in MainWindow::isToolButtonsChecked that checks if any tool button of the bottom or right widget bars is checked.
* [Change] Removing the plugins from core code.
* [Change] Modified pgmodeler.pro to include plugins folder when present in the source root (either in debug or release mode).
* [Change] Ignoring plugins folder in the core code.
* [Change] Minor improvement on ModelWidget::rearrangeSchemasInGrid in order to consider the amount of tables to determine the minimum grid size used to rearrange table.
* [Change] Minor text adjustments in CLI.
* [Change] Added an additional checking during relationship creation in order to avoid the creation of 1-* or n-n relationships involving partition tables.
* [Change] Removing the restriction to create 1-1, 1-n and n-n relationships in which the involved tables are partitioned ones.
* [Change] Disabling the SQL statment ALTER...OWNER TO in the object's SQL when the owner role has its SQL disabled but the object itself not. This will avoid reference errors when validating/exporting code.
* [Fix] Fixed the "Save" action enabled state according to the current model's modified state.
* [Fix] Fixed a crash when the user tried to edit connections in ModelDatabaseDiffForm and right after select a connection in the "Compare to" field.
* [Fix] Fixed the generation of escaped comments for columns.
v0.9.2-beta2
------
Release date: November 1st, 2019
* [New] Added support for foreign tables.
* [New] Added the method DatabaseModel::getObject(QString,vector) to return the first ocurrency in the lists related to the provided types.
* [New] Added support for select all foreign tables in ModelWidget.
* [New] Created the method BaseTable::isBaseTable to help determining if an object type is of Table, View or ForeignTable.
* [New] Added extra support for foreign tables on DatabaseExplorerWidget and DataManipulationForm.
* [New] Added the method DatabaseImportHelper::createColumns in order to isolate the code to create table/foreign table columns during reverse engineering.
* [New] Added support for foreign table importing as well its children objects (columns, constraints, triggers).
* [New] Added server and options fields on TableWidget for foreign table.
* [New] TableWidget now fully supporting the edition of foreign tables.
* [New] Added the ability to TableView to render ForeignTable objects.
* [New] Added support for swap objects ids using arrow keys by changing creation order between two close objects on the grid.
* [New] Added support for save diff settings in form of presets.
* [New] Added an option to BaseObject to force the comment escaping making multilined comments be presented as single lines but without changing their semantics.
* [New] Adding support for parse escaped text delimiters and value separators in CSVLoadWidget.
* [Change] Avoiding the usage of "Generate ALTER commands" option when the table is a partition or partitioned.
* [Change] Avoid unchecking PK checkboxes on TableWidget when adding a new column.
* [Change] Validating the dialogs geometry regarding to screens geometry in order to avoid their appearance in an invalid position (out of range).
* [Change] Limiting the size of the exceptions stack in 50 elements.
* [Change] Improved the GenericSQL::isObjectReferenced in order to check if, when a referenced object is a column, the provided object is the same as the parent of that referenced object.
* [Change] Restricting the usage of "Default partition" option for partitioning relationships when the partition table is a foreign table.
* [Change] Making ModelObjectsWidget update the foreign table subtree.
* [Change] Making ReferenceWidget to use foreign tables from referenced table selector.
* [Change] Improved the Relationship class to accept foreign tables.
* [Change] Improved the DatabaseModel::getObjectDependecies and DatabaseModel::getObjectReferences to include ForeignTable.
* [Change] Updated View class to accept reference foreign table columns.
* [Change] Moved the original implementation of DatabaseModel::createTable to a template method createPhysicalTable in order to reuse it to create tables and foreign tables.
* [Change] ForeignObject is not a BaseObject child anymore due to multi inheritance problem that it can generate in ForeignTable class.
* [Change] Minor ajustment in Relationship class to accept PhysicalTable in its constructor so relationships can be used by ForeignTable class as well.
* [Change] Isolated the code common to Table and ForeignTable classes in a parent class named PhysicalTable.
* [Change] Disabling mime type update on installers.
* [Change] Minor adjustment on SQLExecutionWidget::generateBuffer to escape line breaks and separators when generating CSV buffer.
* [Change] Removing unused code from NumberedTextEditor.
* [Change] Changed the way temp source file is handled by the tool in order to solve a sharing violation problem on Windows.
* [Change] Minor adjustment on HtmlItemDelegate to avoid creating local variables in paint() everytime the method is called.
* [Fix] Fixed an bug in SQL generation of columns that was wrongly removing a comma from decimal data types.
* [Fix] Fixed some catalog queries in order to support PostgreSQL 12.
* [Fix] Fixed ObjectsScene to remove foreign tables during destruction.
* [Fix] Fixed the View::getObjectCount in order to return 0 when the provided object type is invalid.
* [Fix] Fixed the ObjectFinderWidget in order to fade out correctly the listed/not listed elements.
* [Fix] Fixed the quick actions menu at ModelWidget in order to include the "Edit data" action for foreing tables.
* [Fix] Fixed the DatabaseImportHelper::assignSequencesToColumns in order to correctly assign sequences to foreign table columns.
* [Fix] Fixed a crash in ModelValidationHelper that was caused by wrong checking when validating generic sql objects.
* [Fix] Fixed the source code display for tables and foreign tables on DatabaseExplorerWidget.
* [Fix] Fixed the CodeCompletionWidget to display foreign table children.
* [Fix] Fixed the loading of generic SQL objects when a referenced object was a column.
* [Fix] Additional fixes to correctly reference foreign tables and tables in the portions were both classes are acceptable/desirable.
* [Fix] Fixed the diff process in order recognize partition foreign tables attach/detach.
* [Fix] Fixed the generation of XML code of partitioning relationships.
* [Fix] Fixed the Relationship::getAlterRelationshipDefinition to include foreign tables.
* [Fix] Fixed the preset.sch since it was not registering the "Reuse sequences" options correctly.
* [Fix] Improved the DataManipulationForm in order to restore the columns visibility when retrieving again the data of the current table.
* [Fix] Fixed the drop action in DatabaseExplorerWidget for user mappings.
* [Fix] Fixed the ModelWidget::rearrangeTablesInGrid to adjust position of foreign tables.
* [Fix] Fixed the generation of SQL code of partition tables in order to avoid the inclusion of partitioned tables columns on the code.
* [Fix] Fixed a crash on DatabaseImportHelper when destroying detached inherited columns.
* [Fix] Fixed the object duplication operation in model widget to accept duplicate foreign table children objects.
* [Fix] Fixed the creation of relationships involving foreign tables.
* [Fix] Fixed the permission object in order to support foreign tables.
* [Fix] Fixed the model export helper to support foreign tables.
* [Fix] Fixed ModelWidget to show missing popup actions for foreign tables.
* [Fix] Fixed the NewObjectOverlayWidget to display tool buttons related to foreign table children.
* [Fix] Fixed the SchemaView::fetchChildren to include foreign tables in the returned list.
* [Fix] Fixed the ModelValidationHelper to validate foreign tables and table-view relationships.
* [Fix] Fixed ColumnWidget and ConstraintWidget to accept foreign tables usage.
* [Fix] Fixed a regression when importing permissions related to functions.
* [Fix] Fixed the OperationList to handle foreign tables.
* [Fix] Fixed create methods in DatabaseModel related to table children object in order to accept foreign tables.
* [Fix] Fixed the SwapIdsWidget postion/size saving and restoration.
* [Fix] Minor tooltip fix in GeneralConfigWidget.
* [Fix] Minor fix in default conf files removing unused tag attribute.
* [Fix] Additional fix to the extension import to correctly indetify it as a data type handler.
* [Fix] Fixed a bug on Role's SQL generation due to a missing attribute.
* [Fix] Additional fix in GeneralConfigWidget to save correctly the settings of dockwidgets.
* [Fix] Minor fix in DatabaseModel to write ddl end token in the appended/prepended custom code.
* [Fix] Fixed a false-positive result when doing the diff between two fuctions that contains the same signature.
* [Fix] Fixed the diff generation for Role objects when setting up an blank password.
* [Fix] Fixed the "Prepend at the beggining of the model" option behavior on CustomSQLWidget.
* [Fix] Fixed the catalog query for extension in order to indetify correctly if this object handles a data type.
* [Fix] Fixed the Variadic option enabling on ParameterWidget.
* [Fix] Fixed the saving of validator widget settings. There was a conflict between pgsql-ver attributes present on the validator settings and the default attribute added by the schema parser. The solution was to use a different attribute (version) in the validator.
* [Fix] Fixed the "Clear items" action in popup menu at DataManipulationForm.
* [Fix] Fixed the importing of tables and views in such way to automatically create correctly the domains referenced by their columns.
* [Fix] Fixed a bug on ModelDatabaseDiffForm that was causing the form to be reseted on the middle of a diff process when the user minimize the diff dialog causing unexpected behavior (or even crashes sometimes).
* [Fix] Minor fix in AboutWidget.
* [Fix] Minor fix in ModelDatabaseDiffForm to avoid using uniform items height in output widget.
v0.9.2-beta1
------
Release date: September 2, 2019
* [New] Added a routine to write a backup file during the saving of model files in order to avoid data loss in some rare cases.
* [New] Added a new action on DataManipulationForm to clear the selected items by pressing Ctrl+R.
* [New] Enabling/disabling the save model action according to the model's modified status.
* [New] The main window instance is now exposed to plugins to make the extra features development more flexible.
* [New] Avoiding selecting table items in BaseTableView::mousePressEvent which doens't contain an underlying (source) object.
* [New] Adding support for duplicate several table objects at once.
* [New] Added support for table children multiselection by using Ctrl+Shift+Click on them.
* [New] Added support for load the generated diff code in the SQL tool and automatically browsing the destination server for manual diff applying.
* [New] Added a button to create a new data manipulation form from within another data manipulation form.
* [New] Added a confirmation message before closing a database explorer widget.
* [Change] Minor adjustments in PgModelerUiNs::createOutputListItem and PgModelerUiNs::createOutputTreeItem to better display formatted messages.
* [Change] Minor improvement on CSV text copying to exclude from the buffer the hidden columns.
* [Change] Adjusted the font weight on WelcomeWidget (only for Linux).
* [Change] Minor adjustment on tool buttons font size on DataManipulationForm.
* [Change] Improved the UI of the DataManipulationForm by rearranging the tool buttons to the left of the dialog.
* [Change] Improved the clipboard text pasting on DataManipulationForm in order to parse the text as CSV when Ctrl+Shift+V is pressed.
* [Change] The filter input on SQLExecutionWidget is now automatically focused when toggling the filter widget.
* [Change] Changed the default behavior of result set filtering to Qt::MatchContains on SQLExecutionWidget.
* [Change] Avoiding showing the "Swap ids" action in popup menu when we have only columns/constraints selected
* [Change] Minor adjustment on SceneInfoWidget to avoid display dimensions of selected columns/constraints on the canvas.
* [Change] Renamed the method BaseGraphicObject::getReceiverObject to getOverlyingObject (to make sense with its counter part BaseObjctView::getUnderlyingObject)
* [Change] Avoiding clear the whole scene selection when the table is already selected and the user requested popup menu.
* [Change] Renamed BaseObjectView::getSourceObject to getUnderlyingObject.
* [Change] Improved the object protection action in ModelWidget in order to accept the multi item selection on tables.
* [Change] Changed the way the PSVI attribute is handled in xmlparser to retrieve big line numbers on a xml document.
* [Change] Improved the diff code preview allowing the user to close the dialog without going back to previous tab and click 'Cancel'.
* [Change] Minor adjustment on buttons shortcuts/tooltips on DataManipulationForm.
* [Change] Changed the way the model saving timers are controlled to avoid infinity savings on the model (when the auto saving option is disabled) making the application unusable.
* [Change] Making the mime update operation return exit code 0 even if there was errors (still displayed in the console). This will avoid the installer to abort installation when the dbm mime update fails.
* [Change] Avoiding applying fillfactor to gin indexes.
* [Change] Moved the method DatabaseImportHelper::parseIndexExpressions to Catalog class.
* [Fix] Fixed a broken diff code generation for policies.
* [Fix] Fixed the object duplication action when only a single table object is selected.
* [Fix] Fixed a bug in ModelWidget::removeObjects that was causing the removal of relationship added columns
* [Fix] Fixed the ModelWidget::configurePopupMenu to consider the table's multi item selection.
* [Fix] Fixed a false-positive diff result when dealing with timestamptz.
* [Fix] Fixed the progress calculation of dbm files loading.
* [Fix] Fixed a bug that was causing the generation of broken view code.
* [Fix] Fixed the display of index expressions on DatabaseExplorerWidget.
* [Fix] Minor fix on SQLExecutionWidget to avoid results grid to overlap command execution history widget in certain cases.
v0.9.2-beta
------
Release date: May 31, 2019
* [New] Added support for user mapping.
* [New] Added support for foreign server.
* [New] Added support for foreign data wrapper.
* [New] Added support for reduced verbosity on diff, export and import processes in order to improve performance.
* [New] Adding missing tootip on ObjectFinderWidget.
* [New] Generic SQL objects now support dynamic references to objects which can be used in the definition code.
* [New] Added support for compare foreign servers on diff process.
* [New] Created a generic getAlterDefinition on ForeignObject.
* [New] Added ForeignServer toolbutton in NewObjectOverlayWidget.
* [New] Added support for the reverse engineering user mapping objects.
* [New] Added support for the reverse engineering foreign server objects.
* [New] Added code snippets for foreign data wrapper and foreign server.
* [New] Added support for diff user mapping.
* [New] Added support for diff foreign data wrappers.
* [New] Added support for set permissions to foreign data wrapper.
* [New] Added the WRAPPER, SERVER and MAPPING key words to sql-highlight.conf.
* [New] Added the method PgSqlType::isExactTo in order to do a full comparison (all attributes) between two data types.
* [New] Added the ability to view references to store referenced tables. This feature will cause relationships to be created between the view and the referenced tables. This is useful when we're using reverse engineering feature in which, in previous versions, couldn't determine the tables that were linked to a view. Now, with this feature a relationship is created between the view and all involved tables.
* [New] Added missing data type macaddr8.
* [New] Enabling quick clear button on several input fields.
* [New] Added support for result set filtering in the SQL execution widget.
* [New] Adding a column labeled "Comment" in TableWidget and ViewWidget to hold comments of children objects.
* [Change] Changed the shortcut of run SQL action in SQLExecutionWidget to F5.
* [Change] Changed the shortcut of tree update action in DatabaseExplorerWidget to F6.
* [Change] Change "New object" action in popup menu in order categorize object types when clicking the database object diminishing the amount of items displayed on the screen.
* [Change] Improved the object search mechanism in such way that various attributes of the object can be matched. New searchable attribute may be added in the future.
* [Change] Added missing code documentation.
* [Change] Minor adjustment on ForeignDataWrapper::getAlterDefinition.
* [Change] Minor improvement on ModelDatabaseDiffForm to show the connection id of the databases being imported in the output tree.
* [Change] Formatting server objects' attributes on DatabaseExplorerWidget.
* [Change] Minor adjustments on the icons of the buttons in ObjectsTableWidget.
* [Change] Improved the method DatabaseModel::getObjectReferences to detected foreign data wrappers as functions' references.
* [Change] Minor code refactoring on Table and View classes.
* [Change] Renamed the method Exception::getErrorType to Exception::getErrorCode.
* [Change] Improved the ModelValidationWidget in such way that is possible to operate over objects on the output list through their respective context menu (the same as in the ModelWidget).
* [Change] Now its possible to trigger the swap ids dialog for two selected objects, causing their ids to be swapped more quickly.
* [Change] Minor refactor on schema files.
* [Change] Minor attributes refactoring on several classes.
* [Change] Minor change in the PgSqlType constructor by turning some parameters optional in order to facilitate the creation of array only types.
* [Change] Minor update on disclaimer text at start of the source files.
* [Change] Allowing copied object to be pasted multiple times. This feature works only with copy/paste operation without remove the pasted objects from the clipboard, for cut/paste the behaviour is unchanged.
* [Change] Increased the maximum limit of SQL history.
* [Change] Updated the windeploy.sh and the installer scripts.
* [Change] Adjusted the installer scripts.
* [Change] Changed the windows deploy script to use Qt Installer Framework.
* [Change] Adjusted the deploy script to use Qt 5.12.
* [Change] Fixed the windows deploy script to use newer version of the compiler in 64 bits environment.
* [Change] Minor improvements in SQLToolWidget and SQLExecutionWidget to avoid segmentation faults when trying to close a execution tab while the command is still running.
* [Change] Adjusted the resize parameters in DataManipulationForm to avoid wrong dialog resizings mainly on Windows.
* [Fix] Fixed a bug in DataManipulationForm that was deleting new rows wrongly.
* [Fix] Fixed a bug that was causing domain constraints not to be extracted correctly during reverse engineering.
* [Fix] Fixed a bug that was causing a fk relationship not to be deleted if the fk tied to it was changed by the user.
* [Fix] Fixed a bug on CLI that was not fixing broken models correctly when they had no role declaration.
* [Fix] Fixed a bug that was causing tables not to be moved on the canvas using mouse.
* [Fix] Fixed a crash related to destruction of special objects on DatabaseModel::destroyObjects.
* [Fix] Fixed a bug that could crash the application when no language was specified to a funcion and the SQL/XML code was being generated.
* [Fix] Minor fix a bug on index importing.
* [Fix] Minor fix on View::isReferencingTable.
* [Fix] Fixed a crash when a query executed in SQLExecutionWidget was a DDL one or was not returning results.
* [Fix] Fixed a bug in CLI that was failing to fix model in certain cases.
* [Fix] Minor fix on buttons tooltips.
* [Fix] Fixed a bug that was causing syntax error if the last column of a table had the SQL code disabled.
* [Fix] Fixed a bug on diff process due to a missing attribute on the generation of diff code for inheritance relationships.
* [Fix] Fixed a bug when rendering several self relationships attached to the same table.
* [Fix] Fixed the CLI in order to restore the layers information when fixing a broken model.
* [Fix] Fixed a bug in object finder that was causing objects from a hidden layer to be displayed causing inconsistency on the layer state.
v0.9.2-alpha1
------
Release date: December 17, 2018
* [New] Added support for scene layers.
* [New] Added support for view's columns importing in DatabaseImportHelper.
* [New] Added the ability to load view columns from database model file in DatabaseModel::createView.
* [New] Added a tab "Columns" in ReferenceWidget where the user will be able to insert columns to be used as view columns.
* [New] Added support for pagination of tables and views columns pagination.
* [New] Added a pagination toggler action on context menu at ModelWidget.
* [New] Added a fix step on CLI to remove the deprecated attribute hide-ext-attribs from tables and views xml code.
* [New] Added a configuration option to control attributes per pages in tables and views.
* [New] Added support for save collapsing states and current attributes pages to the database model file.
* [New] Added constants to reference child objects of TableObjectView.
* [New] Added the class TextPolygonItem which can be used to draw a text over a background polygon.
* [New] Added support for OLD/NEW tables aliases on triggers.
* [New] Added a hint text on RelationshipWidget to document the correct usage of default partitions.
* [New] Added support for partition attaching/detaching detection in diff process.
* [New] Added auxiliary methods in Table class in order to add/remove and retrieve partition tables.
* [New] Added support for importing partitioned/partition tables on DatabaseImportHelper.
* [New] Added a missing validation in Relationship to avoid creating other types of relationships involving partitioned or partition tables.
* [New] Added support for specify partition bounding expression on partitioning relationships.
* [New] Added support for resize grid cells to fit contents on ObjectsTableWidget.
* [New] Added a tab "Partition keys" that will handle partitioning configuration on TableWidget.
* [New] Added a method in ObjectsTableWidget to hide some horizontal header sections.
* [New] Added some validations when creating partitioning relationships.
* [New] Added support for hide columns on data manipulation dialog.
* [New] Added a transient attribute to objects DatabaseModel, Table and View in order to give a hint on the maximum count of objects held. This attribute is used to preallocate the vectors which store the children objects in order to avoid excessive memory allocation/deallocation due to vector resizing.
* [New] Added a column labeled "Alias" on all objects tables in TableWidget so the aliases of children can be displayed.
* [New] Added support for adding tabs via shortcut or corner button in the SQL Execution panel.
* [Change] Minor adjustments on MainWindow to make the overview widget to update its contents whenever the active layers change on the current model.
* [Change] Minor adjusment in ObjectsScene::addItem to make the item (in)visible according to the visibility of its related layer.
* [Change] Minor fix in AttributesTogglerItem in order to consider the parent's opacity during painting.
* [Change] Minor fixes in OperationList in order to force views to be updated correctly when operating over a table which is referenced by those objects.
* [Change] Minor adjustments on SchemaView and BaseTableView (and its children classes) to update the geometry when they switch from invisble to visible state.
* [Change] Changed views in such way so they can use the struct SimpleColumn to represent their deduced columns.
* [Change] Improved the update of views when referenced columns and tables change their structure.
* [Change] Improved database model loading times by avoiding the rendering of tables while the children objects (indexes, trigger, rules, etc) are being added.
* [Change] Removed the several operators ~ overloading that statically cast enums to their underlying type and created a template function called enum_cast in C++14 syntax.
* [Change] The zoom in/out level is now sensible on how much the user rolls the mouse wheel.
* [Change] Move the default implementation of configureObjectShadow and configureObjectSelection from BaseObjectView to BaseTableView.
* [Change] Disabling configureObjectSelection and configureObjectShadow on TableObjectView and RelationshipView.
* [Change] Minor adjustment on protected icon position on TableTitleView and TextboxView.
* [Change] Minor performance adjustments in ModelWidget.
* [Change] Minor improvement in TextboxView to use only a TextPolygonItem to hold text and the object's rectangle instead of a box and a text items.
* [Change] Replaced the sql_info_txt and sql_info_box items by a single instance of TextPolygonItem to denote SQL disabled status.
* [Change] Replace the tag_body and tag_name elements on BaseTableView by the tag_item which is a instance of TextPolygonItem.
* [Change] Improved the TableObjectView to avoid adding extra scene items.
* [Change] Improved the TableTitleView to avoid adding children items. A custom paint() method now draws them.
* [Change] Removing unused fr_FR UI translations.
* [Change] Minor update on known issues sections at README.md.
* [Change] Renamed the namespace ParsersAttributes to Attributes and its attributes has been refactored.
* [Change] Refactored all static const attributes of the classes present in pgsqltypes.h.
* [Change] Renamed PgModelerNS to PgModelerNs.
* [Change] Renamed PgModelerUiNs to PgModelerUiNs.
* [Change] Renamed XMLParser to XmlParser.
* [Change] Removing uneeded temporary QString instance created from Exception::getErroMessage call before throwing exceptions.
* [Change] Refactored static const attributes of BaseObject.
* [Change] Refactored the items in the enum ObjectType by removing the prefix 'OBJ'.
* [Change] The enums ErrorType and ObjectType were transformed into scoped enums. Also the ErrorType enum was renamed to ErrorCode.
* [Change] Code refactoring done in order to make it more close to C++14 in order to take advantage of new features introduced by that standard.
* [Change] Removed unused labels and fixed warning frame on ModelWidget.
* [Change] Minor improvements on table's attributes displaying on DatabaseExplorerWidget.
* [Change] Improved the diff process in such way to avoid generating unnecessary/noise commands related to changing types of columns to integer and setting nextval() call as default value.
* [Change] Partition tables are now displayed in the "Tables" tab at TableWidget.
* [Change] Removed the cached catalog query test feature from Catalog.
* [Change] Fine tuning on the validation of the entities used in the partitioning relationship creation.
* [Change] Forcing the partitioning relationship to be invalidated when the reference table (partitioned) partitioning type is set to null (no partitioning).
* [Change] Move the FK settings, copy options and name patterns group boxes to a dedicated tab on RelationshipWidget.
* [Change] Improved the models destruction when closing the application.
* [Change] Improved the Index/Exclude/ParitionKey elements handling by creating a generic form/grid that handles these kinds of objects (ElementsTableWidget).
* [Change] Modified the RelationshipWidget in order to handle partitioning relationships.
* [Change] Modified RelationshipConfigWidget in order to write name partterns for partitioning relationships.
* [Change] Improved the column copying and validation on class Relationship to include partitioning relationship logics.
* [Change] Improved the reverse engineering performance by avoiding update relationships as they are being imported.
* [Change] Improved the object duplication feature in ModelWidget.
* [Change] When the model is loaded it is copied to the temporary models storage as a first version of the temporary dbm file.
* [Change] Simplified the temporary models saving process by removing the thread that was controlling it. Actually the thread was unnacessary because the process was being executed in the main thread no matter if there was another thread to control the saving.
* [Change] Minor adjustment on the hint text resizing.
* [Change] Increasing to 5 minutes the period in which the temporary model saving will be executed.
* [Change] pgModeler will now use the official docs url in the help buttons.
* [Fix] Fixed a minor bug that was preventing the copy action to be enabled in DataManipulationForm.
* [Fix] Fixed some sample models to remove deprecated attributes.
* [Fix] Fixed a crash while renaming view's children objects.
* [Fix] Fixed the rendering of views which contain only a single reference that is the whole object's defintion.
* [Fix] Fixed the column name deduction for recursive views.
* [Fix] Fixed a bug that was causing crashes while configure new constraints on tables.
* [Fix] Fixed the view's resizing.
* [Fix] Fixed a regression in schema's rectangle selection.
* [Fix] Fixed the StyledTextboxView bounding rectangle.
* [Fix] Fixed an artifact when user switched on and off the compact view.
* [Fix] Fixed the Linux deploy script.
* [Fix] Fixed the macOs deploy script.
* [Fix] Fixed some compilation problems on macOs due to the usage of C++14.
* [Fix] Fixed some compilation problems on Windows due to the usage of C++14.
* [Fix] Fixed a bug in DatabaseModel::destroyObjects that could lead to segfault when the destroyed model had permissions on it.
* [Fix] Fixed a bug when importing columns which data types is some user defined type in form of array, e.g., custom_type[].
* [Fix] Fixed a bug in SchemaParser that was causing only the first %set line in a if block to be parsed no matter that there were others %set below the same block.
* [Fix] Fixed the tooltip of some graphical objects by adding their comments and aliases.
* [Fix] Fixed the catalog query for tables to select partitioned tables correctly.
* [Fix] Fixed the catalog query for types to avoid selecting partitioned tables as being data types.
* [Fix] Fixed a bug that was causing special primary key configured on a relationship to make the original primary key of the table to disappear after disconnect the relationship. Now pgModeler stores in memory the original PK prior the connection of relationship and creation of the special PK. When disconnected the relationship, the original primary key is restored on its parent table.
* [Fix] Fixed the creation of elements (index, exclude, patition key) on DatabaseModel.
* [Fix] Fixed the class Relationship to reuse compatible columns when handling partitioning relationships.
* [Fix] Fixed the diff process in such way to create new columns with their respective COMMENT ON statement when present.
* [Fix] Fixed the detection of comment changes for columns on diff process.
* [Fix] Fixed the order of recent models saved on the file pgmodeler.conf.
* [Fix] Fixed a bug when creating a view reference as the whole view definition.
* [Fix] Minor tooltip fix on DatabaseExplorerWidget.
* [Fix] Making pgModeler honor the columns arrangement in primary keys.
* [Fix] Fixed a bug that was causing FK relationship deletion to crash the application sometimes.
* [Fix] Some fixes were done in the ModelOverviewWidget in order to support large models without exceed the screen size when configuring the size of the overall widget.
* [Fix] Fixes a bad erase in View::removeReference.
* [Fix] Fixed some bugs related to dialog size restoration in DataManipulationForm and TableWidget.
v0.9.2-alpha
------
Release date: August 20, 2018
* [New] Added the support for cancelling SQL execution in SQLExecutionWidget.
* [New] Added support for save/restore the dialogs sizes and positions.
* [New] Added support for truncate tables in DataManipulationForm.
* [New] Added support for aliases on some graphical objects that is used in the compact view mode.
* [New] Added support for save/load object's metadata containing aliases information.
* [New] Added support for compact view of the model where graphical objects can have a more friendly name for a reduced view as well for those who don't need to see details about tables (clients of the business, for instance).
* [New] Added support for sequence options for identity columns.
* [New] Added the ability to paste CSV text from clipboard into the TableDataWidget.
* [New] Added support for bulk data edit in TableDataWidget.
* [Change] Added missing copy options on copy relationships.
* [Change] Minor adjustments on the item delegates in order draw text in the right alignment.
* [Change] Minor adjustment on buttons style in DatabaseExplorerWidget, DataManipulationForm and SQLExecutionWidget.
* [Change] Minor adjustment on OperationList::removeFromPool to avoid throw an exception when an invalid index is passed.
* [Change] Changed the behaviour of the fade in/out of relationships linked to a table by applying the effect on the other tables that are related to the selected one.
* [Change] Refactored the view editing dialog by moving the references handling form to a dedicated modal dialog.
* [Change] Improved the model loading from file by blocking signals of relationships avoiding excessive/repetive rendering of objects. The whole model is fully rendered when the file was completely loaded.
* [Change] Minor adjustment on constraints rendering at extended attributes section of tables.
* [Change] French translation update.
* [Change] Updated the other lang dictionaries with the new text brought by new releases.
* [Change] Removing icons at the top of the dialogs: DatabaseImportForm, MetaDataHandlingForm, ModelDatabaseDiffForm, ModelExportForm, ModelFixForm.
* [Change] Minor adjustments in the features of the demo version.
* [Change] Minor adjustments in the UI stylesheet.
* [Change] In DatabaseExplorerWidget the root item will come automatically selcted when browsing a database.
* [Change] Minor performance tuning when handling big models.
* [Change] Added some statistics attributes for tables on DatabaseExplorerWidget.
* [Change] Minor adjustment in NewObjectOverlayWidget by putting the tool buttons under categories.
* [Fix] Fixed a bug in ObjectFinderWidget that was forcing schemas rectangles to appear even if the flag indicating them to be visible was set to false.
* [Fix] Fixed the editing form cancel operation. Now operations done when the form was active are undone correctly.
* [Fix] Fixed a bug that was preventing to create a view containing the same name as a table but in different schema.
* [Fix] Fixed a regression that caused notices not to be shown in the output panel at SQLExecutionWidget.
* [Fix] Fixed the query catalog for policies which was causing syntax error when combining import system objects and extension objects options.
* [Fix] Fixed the disabling of some actions related to design when switching to manage view.
* [Fix] Minor fix on stylesheet in order to display the extended button on general toolbar.
* [Fix] Fix a shortcut conflict in DataManipulationform.
* [Fix] Fixed the offset of strings composing the StorageType.
* [Fix] Minor form size adjustments.
* [Fix] Minor fix in sqlexecutionwidget.ui to force the exhibition of grid headers
* [Fix] Minor fix in SQLExecutionWidget allowing the output widget to be resized to a size lower than the default one.
* [Fix] Fixed the tab order in PolicyWidget.
* [Fix] Fixed the generation of Database object source in DatabaseExplorerWidget.
* [Fix] Fixed the method BaseObjectWidget::setRequiredField to make object selector fields as required correctly.
* [Fix] Minor fix in HintTextWidget to stay on top of all widget when being displayed.
* [Fix] Fixed a bug that was not quoting extension name when needed.
* [Fix] Fixed a crash when trying to remove a fk relationship when it was created from a foreign key which references protected columns (added by relationship).
* [Fix] Fix a crash when importing CSV files into DataManipulationForm.
* [Fix] Minor typo in TableDataWidget.
* [Fix] Minor fix on schema file sql/table.sch.
v0.9.1
------
Release date: May 14, 2018
* [New] Added support for line selection by clicking and moving the mouse over the line numbers widget in any source code field.
* [New] The validator now checks if the model has columns referencing spatial data types and creates the postgis extension automatically when fixing the model.
* [New] Added support for RESTART IDENTITY on truncate tables in DatabaseExplorerWidget.
* [New] Added an custom option checkbox in Messagebox for general purpose usage.
* [New] Added support for diff operation in CLI.
* [New] Added support for import database from CLI.
* [New] Adding missing types regrole and regnamespace.
* [Change] Improved the copy/duplicate operation in order to copy rules, index, trigger and policies together to their parents.
* [Change] Added column names to the code completion widget used in the filter widget at DataManipulationForm.
* [Change] Improved the SQLExecutionWidget in such way that it'll display large amount of data more quickly and consuming less memory.
* [Change] Minor improvement in SQLExecutionWidget to show the amount of time took to run a query.
* [Change] Minor improvement in the text find widgets in SQL tool in order to make them closable via dedicated button.
* [Change] Improved the set tag operation in ModelWidget in order to cleanup the assigned tags to a set of objects.
* [Change] Minor improvement on DatabaseExplorerWidget to show the rls attributes labels correctly in the attributes grid.
* [Change] Refactored all the CLI options.
* [Change] Minor change in Connection::generateConnectionString in order to put the dbname param in the start of the string.
* [Change] Improved the performance of the row duplication action in DataManipulationForm.
* [Change] Minor improvement in order to update the schemas boxes when the tables have their extended attributes box toggled.
* [Change] Improved the performance of "Move to schema" operation.
* [Change] Added an busy cursor while closing a model.
* [Change] Improved the object selection in object finder.
* [Change] Changed the behaviour of select and fade buttons in ObjectFinderWidget in such way to enable the user to select/fade the objects in the listing (or not included in the results).
* [Fix] Fixed a bug when import identity columns in certain cases when the identity column was followed by another column which data type was not accepted for identity, e.g, text after smallint.
* [Fix] Fixed the check boxes disabling when dealing with identifier relationships.
* [Fix] Disabled the drag & drop for items in the side listing at ConfigurationForm.
* [Fix] Fixed the tab behavior on comment box in all editing forms of database objects.
* [Fix] Fixed the catalog query for user defined types.
* [Fix] Fixed the import of user defined types which names contains uppercase characters.
* [Fix] Minor typo fixes in CLI.
* [Fix] Fix window scaling on HiDPI/Retina screens.
* [Fix] Minor fix in Connection::getConnectionId in order to omit port when that parameter is not configured in the connection.
* [Fix] Fixed a bug in ModelExportHelper that was failing to remane the database when the command appeared.
* [Fix] Fixed a bug in CollationWidget that was referencing the collation attributes LC_??? using the wrong constant.
* [Fix] Fixed the behaviour of the message box that warns about the need of validate the model prior to export, save or diff. Now rejecting the dialog (i.e. closing it) will be considered that the user wants to proceed with the pending operation even with an invalid model.
* [Fix] Fixed the import of comments for constraints,triggers, index and rules.
* [Fix] The value input in BulkDataEditWidget will be focused as soon as the widget appears.
* [Fix] Fixed a bug in the aggregate import process.
* [Fix] Minor fix in DataManipulationForm to avoid the generation of a where clause when the filter is filled only with spaces.
* [Fix] Minor fix in the magnfier tool to use the same render hints as the canvas viewport.
* [Fix] Fixed a bug in the diff process that was trying to recreate the whole database when the "Force recreation" option was set.
* [Fix] Fixed a bug when showing the source of tables in DatabaseExplorerWidget when these objects have permissions assigned.
* [Fix] Adjusting tables position when the parent schema is moved and the alignment to grid is enabled.
* [Fix] Minor fix in the CLI menu.
* [Fix] Fixed the saving process for large models by stopping the threads related to temp models saving while the model file is being written.
v0.9.1-beta1
------
Release date: April 6, 2018
* [New] Added the ability to create multiples one-to-many and many-to-many relatationships between the same pair of tables.
* [New] Added the ability to use more special ascii chars in the middle of object names.
* [New] Added missing SQL keywords into sql-highlight.conf
* [New] Added support for multi line comments in UI.
* [New] Added code snippets for CREATE and ALTER policy.
* [New] Added full support for row level security (RLS), including export, import and diff of this kind of object.
* [New] Added the method DatabaseExplorerWidget::formatPolicyAttribs in order to display some attributes values correctly.
* [New] Added support for bulk data editing in DataManipulationForm.
* [New] Added an option to diff process to force the generation of DROP commands for columns and constraints even if the missing objects need to be preserved. This is useful to work with partial models and the user need to remove columns/constraints and preserve the rest of objects.
* [New] Added the ability to generate diff code to Enable/Force RLS attribute of tables.
* [New] Added support for RLS on tables.
* [New] Added the support for detect identity columns in diff.
* [New] Added support for identity columns (PostgreSQL 10).
* [New] Added the support for BYPASSRLS option on roles.
* [New] Added support for IS_TEMPLATE and ALLOW_CONNECTIONS options in database object.
* [New] Added the procedures to fix old style domains in CLI.
* [New] Added support for multiple check constraint in domains.
* [New] Added support for sort items alphabetically (ascending) or by oid in DatabaseExplorerWidget.
* [Change] Changed the input mode of the password field in ConnectionsConfigWidget in order to hide the passwords in the form. NOTE: the passwords are still in plain text in the config file.
* [Change] Moved extensions from schema level to database level in order to reproduce better the PostgreSQL's behavior.
* [Change] The filter widget is now toggled in DatabaseExplorerWidget via filter menu.
* [Change] Minor adjustments on forms sizes.
* [Change] In GeneralConfigWidget when restoring default settings the default settings for syntax highlight are restored as well.
* [Change] pgModeler will not try to create the plugins path anymore. This will avoid constant error messages during startup. Now, it'll silently ignore the absence of that folder and skip the plugin loading.
* [Change] Minor improvements on catalog queries for index, trigger, rule, policy, constraint in order to use the comment catalog query.
* [Change] Removed an uneeded form adjustment code in Table::openEditingForm.
* [Change] Minor improvements on DatabaseModel::getCreationOrder.
* [Change] Improved the source editing in external application. The use is informed about the app running state and the contents for the source editor field are locked until the user closes the external app.
* [Change] Improved the model loading on macOs in such way to avoid showing the visual objects creation while they are being loaded from file.
* [Change] Improved the reverse engineering and diff process to accept the new attributes of database object.
* [Fix] Fixed the query catalog for built-in types to include the types related to domains.
* [Fix] Fixed the Extension::setSchema method to accept null schemas.
* [Fix] Fixed the generation of XML code for casts.
* [Fix] Fixed the extension creation, allowing only one instance of the named extension per database no matter the schema used to allocate its children objects.
* [Fix] Minor fix in ObjectDepsRefsWidget to correctly list the indirect references.
* [Fix] Fixed a bug when dropping Functions in DatabaseExplorerWidget.
* [Fix] Improved the import of sequences in such way to avoid unsolvable reference breaking.
* [Fix] Fixed a bug that cause the disabling of connections for database models created prior to 0.9.1-beta1.
* [Fix] Fixed a bug on import process that was wrongly creating types derivated from tables/sequence/views causing duplication problems during validation.
* [Fix] Fixed a crash on macOs when opening a second model.
* [Fix] Fixed the import of sequences which now assigns owner columns correctly. If the owner column is an identity one the SQL code of the sequence is disabled by default which will not cause confusion in the diff process trying to drop it in some cases.
* [Fix] Fixed an issue in diff process that was generating a malformed DROP command for extensions.
* [Fix] Minor fixed in the "Filter by OID" feature in DatabaseExplorerWidget and DatabaseImportForm.
* [Fix] Fixed the diff for domains which contain multiple check constraints.
* [Fix] Fixed a bug that was not selecting the correct spatial type in the widget.
* [Fix] Fixed a conflict of shortcuts in DatabaseExplorerWidget. Now F5 updates a leaf/subtree and Alt+F5 performs quick refresh of the tree.
* [Fix] Fixed a problem with sqlexecutionwidget.ui that is not building properly in Qt 5.10.
v0.9.1-beta
------
Release date: January 26, 2018
* [New] Added support for GROUP BY/HAVING clauses in Views by adding a new kind of reference. Proper changes done in ViewWidget to allow configuring those clauses.
* [New] Added the method Catalog::isSystemObject(oid) which indicates if the provided OID is related to a system object.
* [Change] Minor adjustment in the copy/paste operation to generate suffix in the pasted objects only when there're conflics.
* [Change] Removed the port range limitation in connection configuration dialog.
* [Change] Updated the default version of Qt and PostgreSQL to, respectively, 5.9.3 and 10.1 in deployment scripts.
* [Change] Changed the method PgSQLType::getTypeName by adding a bool parameter so the name can be returned with dimension descriptor (when dimension is > 0). Useful for configuring operator's signatures.
* [Fix] Fixed the drop action for materialized views in database explorer.
* [Fix] Fixed a crash when importing extension objects.
* [Fix] Fixed the generation of operator's signature that must consider dimensions of the arguments' types.
* [Fix] Fixed the bounding rect calculation for relationship instances when one or more labels are hidden.
* [Fix] Fixed the SVG & PNG export to properly determine the area to be drawn in the destination graphics file.
* [Fix] Fixed a crash when adding attributes into many-to-many relationships.
v0.9.1-alpha1
------
Release date: November 30, 2017
* [New] Added the ability to compare two databases, and not only a model and a database, in diff tool.
* [New] Added the relationship creation buttons on the object overlay when a single table is selected.
* [New] Added the "Relationship" action in "New" submenu on table's popup menu so the user can create relationships using the selected table as source. This avoids the need to use blank areas of the canvas to start creating relationships.
* [New] Improved the data manipulation dialog in such way that when dealing with deletes in tables without PK, tuples with NULL values can be correctly considered.
* [New] Improved the validations on ResultSet class.
* [New] Added a method to indicate if a column value is null in ResultSet.
* [New] Added support for fade in/out objects in object finder in order to highlight the graphical objects retrieved from the search.
* [New] Added an attribute in pgmodeler.conf to store the current status of the "Fade in" button in object finder widget.
* [Change] Minor improvement in the diff generated metadata.
* [Change] Increased the maximum allowed amount of lines in command history.
* [Change] Minor adjustment on diff tool so the connections combo can be correctly updated when the user edit connections from within that form.
* [Change] Improved the progress info of diff process so it can be more accurate.
* [Fix] Fixed the way PostgreSQL 10+ version is returned from Connection::getPgSQLVersion.
* [Fix] Fixed the sequence importing on PostgreSQL 10.
v0.9.1-alpha
------
Release date: October 20, 2017
* [New] Added support for crow's foot notation.
* [New] Added the crow's foot notation switch in RelationshipConfigWidget.
* [New] Added the grid arrangement in the arrangment menu at MainWindow.
* [New] Added the schema arrangement (scattered).
* [New] Added an action to toggle schemas rectangle on ModelWidget.
* [New] CLI now loads the relationship and general settings to reflect relationship styles in export modes.
* [New] Added support for connect relatinship on tables' edges when using classical notation.
* [New] Added support for apostrophes in the middle of object's name.
* [Change] Removed the controls related to arragement in DatabaseImportForm.
* [Change] Minor adjustments in tables' spacing in auto arrangement process.
* [Change] Minor improvement on SQLExecutionWidget and DataManipulationForm in order to make possible to paste csv buffer from SQLExecutionWidget to DataManipulationForm.
* [Change] Improvements done in the Spanish UI translation.
* [Change] Changed the position of the zoom info icon in SceneInfoWidget.
* [Change] Minor adjustments in the pen width of relationship lines and objects borders.
* [Change] Minor improvement when aligning objects to grid forcing the relationships updating.
* [Change] Minor arrangement of the connection modes in RelationshipConfigWidget.
* [Change] Improved the performance of (de)selection of several objects at once in ModelWidget and ObjectsScene.
* [Change] Removed unused attributes from BezierCurveItem.
* [Change] Improved the BezierCurveItem class to enable the drawing of inverted curve by inverting its bounding rect.
* [Change] Improved the import of index objects.
* [Change] Minor tweak to enable clipboard usage in macOS when copying data in DataManipulationForm.
* [Fix] Fixed a bug in ObjectsScene that was not emitting signals of deselection correctly.
* [Fix] Fixed a bug in SQLToolWidget that was not cleaning up the source code pane when all databases were disconnected.
* [Fix] Fixed a bug that was causing the diff process to try to remove the not null constraint of a primary key.
* [Fix] Fixed a bug that was causing relationship line to be wrongly constructed in case the tables bounding rects don't intercepted.
* [Fix] Fixed a bug that was recognizing the creation of a constraint but wasn't generating the SQL in diff process.
* [Fix] Minor fix in order to avoid the inheritance/dependency descriptor to be rotated to the wrong size when curved lines are being used.
* [Fix] Fixed the generation of sql comments for database and tablespace.
* [Fix] Minor fix in example.dbm
* [Fix] Fixed the configuration of bidirectional fk relationships when crow's foot is enabled.
* [Fix] Fix a bug in GeneralConfigWidget that was reverting the grid optins everytime the user applyed settings.
* [Fix] Fixed the genaration of index elements containing expressions.
* [Fix] Fixed the import of operators and operator classes.
* [Fix] Fixed the generation of operator signature by removing the length/precision of the types.
* [Fix] Minor fix in CSVLoadWidget::loadCsvFromBuffer in order to preserve the line breaks avoiding the creation of unecessary lines.
* [Fix] Fixed the import of exclude constraint.
* [Fix] Fixed the import of timestamp(0) type.
v0.9.0
------
Release date: September 1st, 2017
* [New] Added the ability to paste text from clipboard to data grid in DataManipulationForm.
* [New] Created the method CsvLoadWidget::loadCsvFromBuffer to make the code that extract csv document from string buffer reusable by other classes.
* [New] Added a new sample model donated by the maintainers of 3D City DB project.
* [New] Added the language "internal" to the set of system languages available when creating a new model.
* [New] Added support for override the default language settings via GeneralConfigWidget.
* [New] Added support for toggle curved relationship lines in GeneralConfigWidget.
* [Change] Improved the MetadataHandlingForm enabling user to only extract metada to a backup file.
* [Change] Small update on sample models.
* [Change] Minor adjustments in the graphical points when relationships are selected.
* [Change] Adjusted the calculation of the descriptor object.
* [Change] Fixed the rotation of the descriptor object for identifier relationship when curved lines are activated.
* [Change] Minor code documentation.
* [Change] Moved the class BezierCurve to its own source files.
* [Change] Improved the way bezier curves are generated for relationships.
* [Change] Changed the default action to reset label's position from middle button click to Alt + Ctrl + left click.
* [Change] Minor enhancement in auto arrange feature to avoid breaking lines when curved relationship lines are enabled.
* [Change] Minor size adjustment in GeneralConfigWidget.
* [Change] Minor update in README.md.
* [Change] Minor size adjustment for DatabaseImportForm.
* [Change] Minor adjustment in the methods which automatically resize dialogs depending on the resolution.
* [Change] Changed the default font for objects and source code.
* [Fix] Minor fix in RelationshipView to hide the circles at end of lines for self relationships.
* [Fix] Fixed the catalog query for event triggers.
* [Fix] Fixed the icons and labels of the "Select all" submenu in ModelWidget.
* [Fix] Fixed a rare crash when configuring self relationships.
* [Fix] Minor fix when rendering self n:n relationships.
* [Fix] Minor fix in the HintTextWidget to resize more properly according to the held text.
* [Fix] Minor adjustment in SceneInfoWidget.
* [Fix] Minor fix in default confs for source code font style.
* [Fix] Fixed the generation of objects style configuration file that was missing constraints settings.
* [Fix] Fixed a bug in the index / exclude constraint import which was not creating expressions of these objects correctly and sometimes trucating them.
v0.9.0-beta2
------
Release date: July 1st, 2017
* [New] Added an action to reset labels distance in BaseRelationship and ModelWidget.
* [New] Added a widget that shows some info about the canvas and the selected objects at the bottom of main window in design view.
* [New] Enabled the usage of snippets in other portions of the software like GenericSQLWidget, FunctionWidget, ViewWidget, CustomSQLWidget.
* [New] Added the ability to quickly jump to the tables related to a relationship.
* [New] Added support for select all objects in the canvas by type (table, view, textbox, schema, relationship).
* [New] Added support for bulk relationship points removal.
* [New] Added a magnifier tool so the user can visualize objects when the zoom is too small. This tool allows the user to click to select or activate the context menu over the objects.
* [New] Added support for generic sql objects that serve as an improved way to use custom SQL.
* [New] Added support for handle metadata related to generic sql objects.
* [New] Added the first object auto-arrange algorithm.
* [Change] pgModeler will now accept (connect) to a PostgreSQL server even if the version of the server is not supported falling back to the most recent supported.
* [Change] Minor improvements on DatabaseImportForm, ModelExportForm, ModelDatabaseDiffForm and MetadataHandlingForm to toggle uniformRowsHeight of the output tree at the start and the end of each process to avoid slowdowns and allow the items to be resized correctly when expanded.
* [Change] Changed the way color are stored in Tag.
* [Change] Minor adjustement on position info of objects in canvas.
* [Change] Improvements on import/diff/export performances by adjusting the way the output widget handles items height.
* [Change] Move the code from MainWindow::showEvent to the constructor of that class so all operations that load resources and restore configurations can be performed prior the window display.
* [Change] Improved the ModelOverviewWidget to handle huge models better.
* [Change] Improved the objects swapping by adding an objects grid where user can interact with it in order to choose which objects to swap.
* [Change] Improved the schema parser to allow comparisons forcing the cast of values to float or int in the expression by using special letters attached to logical operators.
* [Fix] Fixed the DatabaseModel::destroyObjects in order to include missing object types and avoiding leaks.
* [Fix] Several memory leaks removed in different portions of the application.
* [Fix] Minor fix in RelationshipView to show the line circles for n:n relationships.
* [Fix] Minor warning fixes related to unused variables/values.
* [Fix] Minor fix in Catalog that was trying to retrieve catalog info for generic sql objects.
* [Fix] Fixed a bug when zooming out using wheel that was causing duplicated zoom in a single wheel turn.
* [Fix] Minor fix in TableView and TableObjectView to present tables in a more compact fashion minimizing the space used in the canvas.
* [Fix] Minor typo fix in swapobjectsidswidget.ui.
* [Fix] Minor fix in lambdas slots usages.
* [Fix] Fixed a bug in generateTextBuffer method in SQLExecutionWidget.
v0.9.0-beta1
------
Release date: May 13, 2017
* [New] Added the ability to standalone dialogs like import, diff, export and others to be resized according to the screen dpi and resolution.
* [New] Added an experimental routine that will resize windows according to the current screen resolution and font dpi.
* [New] Added support for browse referrer and referenced in DataManipulationForm.
* [New] Added an item under table items that stores the referrer tables in the DatabaseExplorerWidget.
* [New] Added the method BaseObjectView::getScreenDpiFactor to help resize scene objects according to the screen dpi/resolution.
* [Change] Minor adjustment on readonly items regarding to referenced and referrer tables in DatabaseExplorerWidget.
* [Change] Improved the tabs handling in SQLToolWidget in order to avoid confusion related to which database is being managed or queried currently.
* [Change] Improvements done in the context menu at DataManipulationForm to include the key actions related to the control buttons at the top right portion of the dialog.
* [Change] Improved the external script handling in SQLExecutionWidget.
* [Change] Applied automatic resize for TaskProgressWidget.
* [Change] Improvement done in model restoration dialog that is now displayed after the main windows is exposed.
* [Fix] Fixed a problem in UpdateNotifierWidget that was receiving error 403 from the site.
* [Fix] Fix a bug in DataManipulationForm that was causing order by clause to be nullified by comments added in the filter field.
* [Fix] Fixed a regression in permission code generation.
* [Fix] Fixed a bug in the generation of grant/revoke commands for columns.
* [Fix] Fixed a bug that was causing the sorting options of index elements to be wrongly hidden.
* [Fix] Minor fix in the site url.
* [Fix] Minor fix in the filter toggling action in ObjectFinderWidget.
v0.9.0-beta
------
Release date: April 4, 2017
* [New] Added support for indexes in Views.
* [New] Added the support for edit/load the source code in NumberedTextEditor in external application.
* [New] Added the ability to save/load metadata related to fade out status and extended attributes display status.
* [New] Added the ability toggle the extended attributes area in tables and views. The toggle status is persisted in the model file and restores during loading
* [New] Added constraints to the extended attributes section in the tables at canvas area in order to improve the quick access to these objects.
* [New] Enabled the importing of view's indexes.
* [New] Fade status is now persisted in the dbm file and restored during loading.
* [New] Added the ability to control zoom factor from overview widget.
* [New] Added a shortcut for "Duplicate" action in design view.
* [New] Added support for (back)slash char in object's names.
* [New] Enabled the usage of NewObjectOverlayWidget for views.
* [Change] Changed the default characters used to escape values in DataManipulationForm and TableDataWidget from {} to // due to problems with json data.
* [Change] Improved the file manipulation in SQLExecutionWidget. Added option to save the commands to the current file or in another file (save as).
* [Change] Minor improvements done in Linux deployment script to support multiarch systems.
* [Change] View's children (indexes, rules, triggers) are now listed under their respective parent view in DatabaseExplorerWidget.
* [Change] Minor improvement in ElementsWidget to disable/hide columns combo when creating index elements for a index associated to a view.
* [Change] Improved the diff between the complete database and a partial model representing it.
* [Fix] Minor fix in AppearanceConfigWidget in order to set the font color correctly.
* [Fix] Minor fix in the default file objects-style.conf
* [Fix] Added the missing support for drop event triggers from database model.
* [Fix] Fixed the drop cast command generation.
* [Fix] Minor fix in windows deploy script to use newer PostgreSQL.
* [Fix] Minor fix in template connections.conf file.
* [Fix] Minor fix in config files related to installer generation (Linux).
* [Fix] Minor fix in paste operation to restore the viewport position in design view.
* [Fix] Minor fix in diff process to detect view's index changes.
* [Fix] Fixed a bug in EventTrigger that was causing unknown exception to be thrown.
* [Fix] Fixed a bug on RoleWidget that was preventing roles to be removed from "Members Of" tab.
* [Fix] Minor fix in mouse cursor override operations.
* [Fix] Fixed a bug when importing functions and composite types that somehow depend upon array types.
* [Fix] Fixed a bug in function importing that was causing default values of parameters to be placed in the wrong position.
v0.9.0-alpha1
------
Release date: February 07, 2017
* [New] Added support for object moving via arrow keys in canvas area.
* [New] Added support for easily create primary keys just by checking the desired columns in table's editing form.
* [New] Added support for use middle button to handle panning mode.
* [New] Added a more user friendly message at startup whenever a missing or corrupted configuration file is detected. The user is now presented to an option to restore default settings for the problematic file.
* [New] Now any default file restored in ConfigurationForm has a backup saved into the directory 'backups' inside the configuration storage.
* [New] Added support for hide the database explorer widget in SQL tool via splitter handler.
* [New] Added a method to disable the custom context menu of the class NumberedTextEditor.
* [New] Added support for object fading in ModelWidget.
* [New] Added the support for persist the object opacity factor in config file.
* [New] Added the method PgModelerUiNS::getIconPath() in order to retrieve icons from resource.
* [New] Added support for column, constraint, trigger, rule and index duplication in TableWidget.
* [New] Added support for item duplication in ObjectTableWidget.
* [New] Added a loading cursor when the user opens the DataManipulationForm.
* [New] The database explorer now creates the root item in the tree as the server itself which contains data related to this latter.
* [New] Added the support for parenthesis in the middle of objects' names.
* [Change] Improvements done in the SQL history at SQL execution widget. Now the command history is saved into a specific file and restored when the application starts.
* [Change] Minor improvement in DataManipulationForm to show a wait cursor while filtering results.
* [Change] Minor improvements in GeneralConfigWidget. Added an readonly input that exposes the path to the current user's configuration storage.
* [Change] Improvements done in the object duplication feature.
* [Change] Remove hardcoded icon paths in the code.
* [Change] Improved the PgSQLTypeWidget to enable the length, precision, dimension fields as the user types the desired datatype. This will avoid jumping to the wrong field when pressing tab.
* [Change] Updated the urls related to download and donation of the new site.
* [Change] Changed the url to check for updates in GlobalAttributes to point to the new site.
* [Change] Improvements done in the linux deploy script to use Qt 5.6.2.
* [Change] Minor tweaks done in order to minimize the diff detection related to default values of columns.
* [Change] Changed the default framework version used in the windows deployment script to 5.6.2.
* [Change] Dropped the automatic LC_COLLATE and LC_CTYPE generation in Database object. Since this was causing more problems than helping when import the database and validating/exporting it.
* [Change] In DataManipulationForm the filter input field is automatically focused when the filter toggle button is activated.
* [Fix] Fixed a bug when using diff to create columns and update constraints.
* [Fix] Fixed a bug that was duplicating the action "New" in the main window's side bar.
* [Fix] Fixed a problem when importing database that contains citext extension installed in pg_catalog.
* [Fix] Minor fix in ConnectionsConfigWidget that was causing duplicated connections to share de same host info wrongly.
* [Fix] Restored the input data type handling in AggregateWidget.
* [Fix] Fixed the oldsample.dbm model.
* [Fix] Fixed a crash when restoring objects' metadata from backup file.
* [Fix] Fixed a bug that was preventing inheritance relationships to be created when the same pair of tables existed in different schemas.
* [Fix] Fixed a bug that was causing column name patterns to be used wrongly in many-to-many relationships.
* [Fix] Fixed a bug that was preventing the automatic closing of tabs related to a dropped database in manage view.
* [Fix] Fixed a bug that was causing the duplication of permissions during the database import which was leading to the complete failure of the entire process.
* [Fix] Fixed the problem with invalid type error when trying to edit a 'timestamp with timezone' column.
* [Fix] Fixed a bug in Relationship that was not setting NOT NULL flag for columns of the multi-valued primary key of many-to-many relationships causing the diff process to fail in some specific cases.
* [Fix] Fixed a regression in RelationshipWidget that was not showing advanced object's form.
* [Fix] Fixed the constraint codes display in TableObjectView. Now self relationships do not mark the primary key field as foreign keys.
* [Fix] Fixed a regression that was not properly disabling the apply button in editing forms when the handled object was protected somehow.
* [Fix] Minor typos fixes in some widgets.
v0.9.0-alpha
------
Release date: October 18, 2016
* [New] Enabling pgModeler to connect to PostgreSQL 9.6 servers.
* [New] Added the option to ignore error codes during the export process in CLI.
* [New] Added the ability to ignore extra errors by their codes in ModelExportForm and ModelDatabaseDiffForm.
* [New] Added the ability to load data from CSV file into TableDataWidget and DataManipulationForm.
* [Change] Minor update in snippets.conf by adding a SELECT * command.
* [Change] Removed deprecated exception ERR_ASG_ZERO_LENGTH.
* [Change] Improvements done in CodeCompletionWidget so that the completion can be more accurate mainly when using the form [schema].[table].
* [Change] Methods responsible for dropping and exploring data were moved from SQLToolWidget to DatabaseExplorerWidget.
* [Change] Improved the error output in DatabaseImportForm, ModelDatabaseDiffForm, ModelExportForm and Messagebox.
* [Change] TableDataWidget widget now can have the column names changed freely not only when there are invalid ones.
* [Change] Removed codename from AboutWidget.
* [Fix] Fixed a bug in PgSQLType and PgSQLTypeWidget that was not properly setting length = 1 in character, varchar and numeric data types.
* [Fix] Fixed a bug that was leading to stack overflow when generating object's sql plus its dependencies in huge models.
* [Fix] Fix the structure of the sample model pagila.dbm.
* [Fix] Minor fix in diff proccess in order to permit the comparison between a column added by relatinship and other that is not but share the same name.
* [Fix] Fixed a bug that could cause crashes when editing connections in DatabaseImportForm or ModelDatabaseDiffForm.
* [Fix] Fixed a crash when the user modified a connection on the fly with the SQL tool activated and trying to resume his work in database management.
* [Fix] Fixed the tab order in ConnectionsConfigWidget.
* [Fix] Fixed a bug in ModelDatabaseDiffForm that was running the export thread several times.
* [Fix] Fix the generation of truncate commands in the diff when the types of columns are incompatible.
* [Fix] Fixed a bug that was generating broken sql for tables when these objects have no constraints.
* [Fix] Fixed a bug in diff that was not detecting column types length changes.
v0.8.2
------
Codename: Faithful Elephant
Release date: June 3, 2016
* [New] Created the PlainTextItemDelegate replacing the ReadOnlyItemDelegate where needed.
* [New] Added the ability to the table to create insert commands from the initial data buffer.
* [New] Added the support for interpret initial-data tag in DatabaseModel::createTable.
* [New] Create the attribute initial-data for Table in order to store the initial set of values in a CSV-like buffer.
* [New] Created the form to handle table's initial data.
* [New] Added the ability to duplicate rows in DataManipulationForm.
* [New] Added shortcuts to tabs in TableWidget.
* [New] Added the ability to clear and copy text from history to the sql command input field using middle mouse button in SQL tool.
* [New] Added the ability to set the default connection for operations import, export, diff and validation in ConnectionsConfigWidget.
* [New] Added the usage of default connections in ModelValidationWidget.
* [New] Added support for save/load default connections in the ConnectionsConfigWidget.
* [New] Added attributes to the Connection class in order to control wheter the connection is the default for export, import, diff or validation operations.
* [New] Added the ability to save the current grid options to the pgmodeler.conf file.
* [New] Added a reference the svg library to the deployment scripts.
* [New] Added support for export model to SVG file in UI and CLI.
* [New] Added the support for change case and identation of the selected text in NumberedTextEditor using context menu or shortcuts.
* [New] Added a method PgModelerUiNS::createOutputListItem which created list items with an icon and text.
* [New] Connections now can have a timeout between command executions. When this timeout exceeds the next command is not executed. This is a workaround to avoid the crash of the program due to connections being (unexpectedly or not) closed by the server.
* [New] Added the ability to show connections notice/warning in SQL tool.
* [New] Added an step during the connections.conf loading to fix the connection timeout attribute automatically.
* [Change] The class ReadOnlyItemDelegate was removed due to the introduction of PlainTextItemDelegate.
* [Change] Minor adjustments in queries generated in DataManipulationForm in order to use PostgreSQL like escaping E'' permitting user to use special chars in the middle of values.
* [Change] Simple quotes (') in DataManipulationForm and TableDataWidget will be automatically replaced by double quotes ('') in order to avoid broken commands.
* [Change] Updated all translation dicts with new terms to be translated by their mainterners.
* [Change] Changes in demo version enabling a limited usage of diff and import features.
* [Change] Improved the way QTableWidgets instances are emptied.
* [Change] Improvements done in order to correctly enable the column/row control buttons in DataManipulationForm according to the selected items.
* [Change] Improved the duplication/delete operation in DataManipulationForm. These operations will happen only if the user selects the entire row.
* [Change] Renamed the method DataManipulationForm::insertRow to addRow.
* [Change] Changed the icons for Add, Delete rows in DataManipulationForm.
* [Change] Improved the metadata handling form. Now the user just need to choose from which model to extract the metadata and the form will do the rest (extract and apply) in one step.
* [Change] Minor improvement in ModelsDiffHelper in order to avoid the generation of useless SQL code (SET statments) when no effective changes were found in the process.
* [Change] Minor improvement in ObjectSelectorWidget to change the object selection dialog title according to the handled object type.
* [Change] Minor improvement in ObjectSelectorWidget to adjust the size of input according to the installed syntax highlighter.
* [Change] Renamed the method Connection::setCommandExecTimeout to setSQLExecutionTimout.
* [Change] Minor improvements in SQLExecutionWidget to use the command execution timeout.
* [Change] Improvements on SQLExecutionWidget to enable the connection stay open in order to permit the usage of commands START TRANSATION, COMMIT and ROLLBACK.
* [Change] Changed the icon for info message boxes.
* [Fix] Minor typos fixed in UI components.
* [Fix] Fix a bug in the Catalog class that was generating broken catalog queries for PostgreSQL releases under 9.3.
* [Fix] Fixed a bug in DataManipulationForm that was not quoting columns in the generated UPDATE commands.
* [Fix] Fixed some tooltips and shortcuts.
* [Fix] Fixed a bug in import process related to permission creation. Now pgModeler removes extra backslash from role's name to avoid it not to be found in the model.
* [Fix] Fixed the doxygen 'brief' instructions in code documentation.
* [Fix] Fixed a bug that was generating broken table's SQL when the object has one or more inherited column.
* [Fix] Fix on the history text copy. Added the correct mouse button (middle) that triggers the copy from the history to the sql input field.
* [Fix] Escaping properly columns' comments.
* [Fix] Minor fix in RelationshipWidget input fields related to receiver and reference tables.
* [Fix] Minor fixes in QPlainTextEdit instances where the SyntaxHighlighter class is used to adjust the height of the field according to the font size.
* [Fix] Minor fix in NumberedTextEditor::showContextMenu to use the cursor's postion only when the menu is executed.
* [Fix] Fixed the way instances of ResultSet are copied.
v0.8.2-beta1
------
Codename: Faithful Elephant
Release date: March 31, 2016
* [New] Added missing PostGiS types.
* [New] Adding the ability to save/load more metadata from objects like model's last zoom and position, protection status, sql disabled status, tags, textboxes and others.
* [New] Created the method BaseGraphicObject::isGraphicObject.
* [New] Added the ability to show the object's source in the SQL tool.
* [New] Added missing encodings descriptors KOI8 and KOI8R.
* [New] Added the method PgSQLType::isPolymorphicType that indicates if the type is one of the any*.
* [New] Added a new method PgSQLType::canCastTo() that indicates if a type can be casted to another.
* [New] pgModeler now stores and restore the state of attributes grid and source pane in SQLTool.
* [New] Added the ability to load dummy items contents by clicking them in DatabaseExplorerWidget.
* [New] DatabaseExplorerWidget now loads the small set of object in order to improve performance. The user have the ability to load the full database by using the refresh button actions.
* [New] Added the ability to retrieve children objects of schemas or tables on demand (as their items are expanded) improving the performance.
* [New] Created an specific icon for refresh database tree.
* [New] Added a version of the method DatabaseImportHelper::getObjects that accepts a list of types and returns a list of attributes.
* [New] Added an new version of Catalog::getObjectNames that retrieve the names according to a list of object types.
* [New] Created a second version of PgModelerUiNS::configureWidgetFont that accepts a custom factor value.
* [New] Adding the ability to BaseForm to use a ScrollArea when the size of the widget exceeds the 2/3 of the user's screen.
* [New] Created template methods to show editing forms according to the kind of database object in ModelWidget.
* [New] Created a signal BaseObjectWidget::s_closeRequested to tell the parent form close after successfuly edit an object.
* [New] Created template methods in RelationshipWidget and ViewWidget to handle child object manipulation.
* [New] Created a template method TableWidget::openEditingForm to handle the editing form for children objects.
* [New] Added support for placeholder objects when moving graphical objects improving performance mainly when moving tables and relationships avoiding excessive update operations.
* [New] Added an option to protect schema's children when protecting the schema itself.
* [New] Added the abitily to diff partial models without drop the not imported ones from the original database.
* [Change] CentralWidget renamed to WelcomeWidget.
* [Change] Adjusted the build in Windows to use qt 5.5.1 and PostgreSQL 9.5.
* [Change] Changed the help action from Wiki to Support and pointing it to GitHub's issues page.
* [Change] Minor tweak in GeneralConfigWidget to permit current line to be highlighted even if the text preview field is readonly.
* [Change] NumberedTextEditor will not highlight the current line if it is readonly.
* [Change] Since label's dtd was moved to its own file the dtd for relationship now includes it.
* [Change] Sorting spatial types in PgSQLTypeWidget.
* [Change] Minor adjustments in central frame of the dialogs modelfixform.ui and modelrestorationform.ui.
* [Change] Replaced the taskprogress widget usage from undo/redo operations by a simple busy cursor.
* [Change] Removing duplicated alignment descriptors in generated warning frames at BaseObjectWidget.
* [Change] Minor improvements in DatabaseExplorerWidget. Now each operation that take some time the cursor will be changed to a "wait" icon.
* [Change] Minor improvements in table SQL generation. Inherited columns will be included in the table's code but in commented lines.
* [Change] Minor fix in catalog query for operators. Unary operators will come with NONE key work in the side that the type is missing.
* [Change] Minor update in sql-highlight.conf.
* [Change] DatabaseImportForm::updateObjectsTree now removes 'without time zone' type modifier from parameters.
* [Change] Minor adjustments on table headers in objectdepsrefswidget.ui.
* [Change] Improvement on DatabaseImportForm::listObjects method. Now user can opt in load the full database or load only the cluster level ones and creating dummy items as children of these ones.
* [Change] Minor size adjustments in AboutWidget.
* [Change] Added a default title for ConnectionsConfigWidget.
* [Change] Removed the static text 'pgModeler - ' from message box title.
* [Change] Changed the default Qt version to 5.5.1 in linuxdeploy.sh.
* [Change] Minimum size adjustments for toolbuttons and icons in DataManipulationForm, ModelValidationWidget and SQLExecutionWidget.
* [Change] Minor improvement on DatabaseModel::getCreationOrder in order to include generated relationship constraints instead of the relationship themselves (useful in diff process)
* [Change] Removed the forced frame shape for BaseForm central widget (Windows only).
* [Change] Several size adjustments in all editing forms and dialogs.
* [Change] Forcing the usage of Fusion style if the user does not provide a custom style.
* [Change] Refactored the usage of SwapObjectsIdsWidget instance in ModelValidationWidget. The aggregate BaseForm instance in SwapObjectsIdsWidget was removed and locally created in ModelValidationWidget.
* [Change] Removed the default window title from database objects widgets.
* [Change] Decoupled the BaseForm instance from all BaseObjectWidget and their subclasses. Now editing forms are constructed in ModelWidget::showObjectForm.
* [Change] Changed the attribute that controls connection timeout in connections.conf from 'connect_timout' to 'connection-timeout'.
* [Change] Minor adjustment on connection configuration dialog size.
* [Change] Remove the maximum size restrictions from all editing forms in order to better adapt the user's font settings.
* [Change] Minor adjustments on bottom margins at mainwindow.ui.
* [Change] Adjustments on warning and hint messages in editing forms.
* [Change] Changed the size constraints for tool buttons.
* [Change] Done modifications in order to avoid the usage of fixed font size and fixed colors in some widgets.
* [Change] The option to control render smoothness in canvas now does not requires application restart.
* [Change] Improved the CLI fix mode when dealing with broken operator classes, index and exclude constraints.
* [Change] Improving the presentation of operator classes and families. Now the index access mode comes attached to their names in tree views.
* [Change] Added a message to export progress when an object is renamed due to the option 'use temp. and uniq. names'.
* [Change] Moved the "save model" button from "Report" tab to "Database model" tab in CrashHandlerForm.
* [Change] Forcing the tree item update in model objects widget when activating some of actions in the popup menu.
* [Change] Added colon character (:) as a valid one to appear in the middle of object's names.
* [Fix] Added missing dtd file label.dtd.
* [Fix] Fixed the label for inheritance relationship action in ModelWidget.
* [Fix] Fixed the object schema file for metadata generation.
* [Fix] Fixing the splash screen display in MacOSX.
* [Fix] Fixed the tooltip of toggle buttons in SQLTool.
* [Fix] Minor fix when generating the database source code for visualization in SQLTool.
* [Fix] Fixed a bug in import process that was not properly creating dependency objects when auto resolve deps was checked.
* [Fix] Fixed the fonts of hint boxes in datamanipulationform.ui.
* [Fix] Fixed the conversion catalog query and import process.
* [Fix] Fixed the aggregate validations related to assigned functions in order to permit the import of system aggregates.
* [Fix] Minor fix in catalog query for triggers.
* [Fix] Fixed the import of triggers, index, rules to automatically create their parent table if they are not yet created (when using auto resolve deps).
* [Fix] Fixed the reference to "any" type.
* [Fix] Fixed the attribute used as function for casts in DatabaseImportHelper::createCast.
* [Fix] Additional fixes to cast code generation.
* [Fix] Minor fix in the cast SQL schema file.
* [Fix] Fixed the OID filtering in DatabaseExplorerWidget.
* [Fix] Fixed the code display in SourceCodeWidget.
* [Fix] Fixed the drop command generation for extension objects.
* [Fix] Fixed a bug that was not updating relationships when importing objects to the current database model.
* [Fix] Fixed the deployment script linuxdeploy.sh making it to copy additional Qt libs.
* [Fix] Fixed the path to Qt installer framework in linuxdeploy.sh.
* [Fix] Additional fix in linuxdeploy.sh to retreive the current compiled version.
* [Fix] Fixed a bug when initializing PgSQLType instances when the provided type name is a user defined one. Random precision/dimension is not created anymore.
* [Fix] Changed the font factor used by WelcomeWidget buttons.
* [Fix] Minor fix in deployment script (Mac OSX).
* [Fix] Fixed the object search when using exact match option.
* [Fix] Fixed a bug that was not creating new columns in cases when the option to keep missing objects was set.
* [Fix] Fixed the diff process that was not processing 1-1 or 1-n relationships correctly.
* [Fix] Minor fix in ConnectionsConfigWidget setting up the correct buttons of the parent form in method openConnectionsConfiguration.
* [Fix] Minor fix on message box default size of buttons.
* [Fix] Fixed some signal connection warnings in BaseForm.
* [Fix] Disabling the apply button correctly when the object is protected.
* [Fix] Fixed a bug when pressing ESC key in the middle of object's movement that was canceling it.
* [Fix] Fixed a bug when selecting a protected object using right button. The parent object is not selected incorrectly anymore.
* [Fix] Fixed a bug when importing operator classes that was generating incorrect XML code for this kind of object prior the creation in the output model.
* [Fix] Additional fix in SchemaParser::convertCharsToXMLEntities to correctly replace char in operator's names.
* [Fix] Fixed the sample files to use the new way to reference opertor classes and families.
* [Fix] Additional fix for code generation of operator classes.
* [Fix] Fixed the loading of index, exclude constraint and operator classes when referencing some operator class or family.
* [Fix] Fixed the code generation for operator classes to use 'signature' attribute.
* [Fix] Fix a bug in the method SchemaParser::convertCharsToXMLEntities that was not replacing char by entities in certain cases.
* [Fix] Minor fix in SourceCodeWidget to correctly show the progress dialog in the right position on screen.
* [Fix] Added a validation in enum types avoiding user to include enum ids with invalid chars.
* [Fix] Added a validation when creating operator classes that references an operator family by the name instead of signature.
* [Fix] Minor fix in operator class form to install syntax highlighter in the operator family selector.
* [Fix] Improved the method DatabaseImportHelper::getObjectName in such way to be able to return the operator families signatures.
* [Fix] Fixed operator class code generation to use operator family's signature instead of name.
* [Fix] Fixed the code generation for Operator family. Reduced form code (XML) is generated with "signature" attribute instead of "name"
* [Fix] Fixed the object search in DatabaseModel. Now duplicated operator families are accepted, the desambiguation term will be the indexing mode.
* [Fix] Fixed the creation of operator classes. Now operator families are referenced by their signature not the name.
* [Fix] Fixed a bug when importing functions with unamed parameters.
* [Fix] Minor typos fixes in PgSQLType source.
* [Fix] Fixed some leaks and crashes when canceling the creation of new tables, views or relationship from their editing forms and closing the application.
* [Fix] Fixed a bug related to quoted name validation that was wrongly raising errors related to long names. The validation of name size now discards the quotes from the count.
v0.8.2-beta
------
Codename: Faithful Elephant
Release date: January 12, 2016
* [New] Added version descriptor for PostgreSQL 9.5 enabling pgModeler to connect to it.
* [New] Added access method BRIN for indexes, operator classes and operator families as an initial support for PostgreSQL 9.5.
* [New] Added event "table_rewrite" for event triggers as an initial support for PostgreSQL 9.5.
* [New] Added "Diff" action to File menu.
* [Change] Minor improvement in DataManipulationForm adding the shortcut of "Copy selection" button to its tooltip.
* [Change] Improvements on DataManipulationForm on how pk columns are handled and used in the generated DML commands for UPDATE and DELETE.
* [Change] Minor improvement on ModelRestorationForm when listing temp models.
* [Change] Changed the hint text for "Disable render smoothness" option.
* [Change] Changed the hint text for "Validate before save, export and diff".
* [Change] Minor improvements on SQLExecutionWidget and DataManipulationForm to scroll items in the results grid by pixel not per item.
* [Fix] Fixed a bug in operations that convert integer to serial and vice-versa.
* [Fix] Fixed some header items text alignment.
* [Fix] Fixed a crash when loading a broken model. Instead of show the error message related to corrupted file pgModeler was being aborted.
* [Fix] Minor fix in hint text in SourceCodeWidget and ModelDatabaseDiffForm.
* [Fix] Fixed shortcut conflicts in MainWindow.
v0.8.2-alpha1
------
Codename: Faithful Elephant
Release date: November 13, 2015
* [New] Added an additional step in import process to validate inheritance relationships to avoid incomplete tables.
* [New] Added an additional relationship validation in model loading process when there are inheritances. This will avoid incomplete columns and validation errors related to "permanent invalidation state".
* [New] Created an exclusive exception code when a parent table is not found in the imported set. This error is raised during inheritances creation.
* [New] Added the signal s_connectionsUpdateRequest in DatabaseImportForm, ModelExportForm, ModelDatabaseDiffForm, ModelValidationWidget and SQLToolWidget in order to inform the main window that user has changed connections in those forms.
* [New] Added the ability to configure connections without using the main configuration form. Now the user is able to do this task by using the "edit connections" option in any combo related to connections.
* [Change] Minor adjustments in diff process messages.
* [Change] Minor adjustments on ModelValidationWidget, ObjectFinderWidget and SQLExecutionWidget resize event to change the shape of toolbuttons in order to avoid truncate texts when the window size is too small.
* [Change] Replaced the explicit hint texts from ModelValidationWidget by HintText instances.
* [Change] Minor adjustment on widgets that are used to set connections.
* [Fix] Fixed the way objects are destroyed when a model is closed diminishing the time consumed by that operation and the chances of crashes after their destruction.
* [Fix] Additional fix in database import feature. Inheritances will be automatically created when "auto resolve dependencies" is checked.
* [Fix] Fixed a crash when importing a database that contains big tables that handles multiple inheritances.
* [Fix] Fixed a crash in Windows version. A missing initialization in OperatorClassElement was leading to segmentation fault.
* [Fix] Fixed a bug in table and view editing form that was permitting to confugure permissions to new objects before create them in the model.
* [Fix] Fixed a problem in UpdateNotifierWidget when the server returns http status code 302.
v0.8.2-alpha
------
Codename: Faithful Elephant
Release date: October 05, 2015
* [New] Added a toggle button in SQL Execution to show/hide the output pane.
* [New] Added the method Permission::isSimilarTo that returns true when a provided permission has the same semantics as the caller permission.
* [New] Added missing keywords CASE, ELSE, QUERY, ELSIF, RAISE, EXCEPTION, TG_OP to sql-highlight.conf
* [New] Columns that compose primary key and unique key are exposed as children of the constraint in the object tree at DatabaseExplorerWidget.
* [New] Foreign key objects selected in DatabaseExplorerWidget now expose, in two children items, the source and referenced tables/columns.
* [New] Added a confirmation message in DataManipulationForm to avoid lose uncommited changes before retrieve data.
* [New] NumberedTextEditor now is able to set a custom tab width.
* [New] Added a configuration option for custom tab width in GeneralConfigWidget.
* [New] Added a nl_NL (Dutch - Netherlands) UI translation.
* [New] Created a mechanism to make default values of columns in the form nextval(sequence) be transformed in a link between the sequence and the column in the import process. This will diminish the divergences raised by the diff process.
* [New] Added a readonly item delegate for attributes grid to permit user to copy contents or navigate through values using keyboard.
* [Change] Changed the initial data limit in DataManipulationForm from 100 to 1000.
* [Change] Removed the default protected status of public schema in sample models.
* [Change] The system schema public now can be protected/unprotected as well moved through the canvas area.
* [Change] Changed the method DatabaseModel::getPermissionIndex to search permissions looking into their contents and not only by their internal references.
* [Change] Improvements on diff process to avoid include already existent permissions.
* [Change] Improvement in diff process to avoid generate code for an unmodifiable object when its code doesn't differs from the same object in database.
* [Change] Added an option to DatabaseImportHelper to avoid the fk relationship updates. This will reduce the time to perform the import step in diff process.
* [Change] The diff is now capable to detect differences in functions source code and recreate them.
* [Change] Minor enhacement in DataManipulationForm to show the query time when retrieving data.
* [Change] Minor adjustments on tooltips of buttons in SQLToolWidget and DatabaseExplorerWidget.
* [Change] Minor size adjustment in ColumnWidget.
* [Change] Minor improvement on SyntaxHighlighter to optionally use the same tab size as NumberedTextEditor.
* [Change] Minor improvement on BaseObjectWidget to avoid install event filter in QPlainTextEdit and NumberedTextEditor.
* [Change] Replaced the QPlainTextEdit instance for source code input in FunctionWidget by a NumberedTextEditor instance.
* [Change] Minor message adjustments on SQLExecutionWidget.
* [Change] Minor adjustment on relationship invalidation message in ModelValidationWidget.
* [Change] Removed unused code from ModelValidationHelper.
* [Change] If a 1:1 or 1:n relationship is removed from the model the receiver table will have its fk relationships updated. This is useful to recreate fk relationships that were replaced by the removed relationship.
* [Change] Minor forms adjustments to resize command buttons depending on the size of texts.
* [Change] More improvements in the diff process when dealing with foreign keys creation.
* [Change] Changed the characters used to specify function call or any unescaped values in DataManipulationForm from <> to {}
* [Change] When using snippets in the SQL execution field the current code will not be cleaned up, instead the snippet will be appended to the current code.
* [Change] Removed the automatic view switching when saving the model.
* [Change] Minor adjustment on buttons positions at NewObjectOverlay.
* [Change] Minor message update in MainWindow::saveModel.
* [Change] pgModeler now indicates the name of unsaved models before quit.
* [Fix] Fixed a regression in trigger drop action in DatabaseExplorerWidget.
* [Fix] Fixed a severe bug that was not configuring the connection correctly when adding a new SQL input field from the current browsed database in SQL tool. The bug could cause user to manage a different database other than the one desired.
* [Fix] Fixed the "Find" button tooltip in SQLExecutionWidget
* [Fix] Minor fix when showing system objects in ModelObjectsWidget.
* [Fix] Fixed the view's SQL generation trimming the SQL that defines it to avoid differences between the model's view and the one generated after export. This will cause less divergences in when diff'ing the model and database.
* [Fix] Minor fixes in the *::getAlterDefinition() methods do avoid crashes due to null objects handling.
* [Fix] Fixed a crash when generating SQL code for recursive views.
* [Fix] Minor fix to correclty show the temporary models save progress at the bottom of main window.
* [Fix] Minor fixes in the validation process to force graphical objects updates and object's tree updates to reflect the new ids.
* [Fix] Minor fixes in the object naming. Now pgModeler will accept dollar signs in any portion of the string or even numbers as object's name but this will automatically quote the name to avoid errors.
* [Fix] Fixed the generation of DROP commands for triggers and rules.
* [Fix] Fixed a bug in Index and IndexWidget that was permiting btree index elements to have sorting attributes which is not valid according to PostgreSQL rules.
* [Fix] Fixed a bug in CodeCompletionWidget that was not retrieving objects with quoted names.
* [Fix] Minor fix in DataManipulationForm to clear the changed rows list after save the modifications.
* [Fix] Fixing the tab index in generalconfigwidget.ui.
* [Fix] Added a workaround to avoid crashes and leaks related to relationship disconnection and validation.
* [Fix] Minor fix in ModelsDiffHelper to avoid diff generation errors related to the missing 'fk-defs' attribute.
* [Fix] Fixed a crash when trying to create a new foreign key after connect two tables using a 1:1 or 1:n relationship.
* [Fix] Translated the pt_BR (Brazilian Portuguese) word found in the code.
* [Fix] Minor fix in BaseObject to permit the usage of swapObjectsIds method from ModelWidget class.
* [Fix] Fixed a bug that was duplicating some foreign key creation code in diff process.
* [Fix] Fixed a bug in the diff process that was dropping columns linked to sequences when these ones were dropped.
* [Fix] Fixed a bug when disabling table's SQL code from model widget. The FK constraints are now enabled/disabled correctly.
* [Fix] Fixed a bug in import process that was wrongly prepending schema's name in types related to tables.
* [Fix] Minor fixes in doxygen.conf.
* [Fix] Fixed the feature to convert to sequence a serial column in order to diminsh breaking references between the column's parent table and the newly created sequence.
* [Fix] Spelling fixes in es_ES (Spanish) UI translation.
* [Fix] Fixed a bug that was not setting up the object's schema correctly when creating new table or view inside a selected schema.
* [Fix] Fixed a bug in DatabaseModel::storeSpecialObjectsXML that was causing crashes when closing a model.
* [Fix] Fixed the model loading from recent list in order to expose the "fix model" message box in case of errors.
* [Fix] Minor adjustment on the generated diff code to include foreign keys definitions at the end of the script.
* [Fix] Minor adjustment on ui-style.conf to minimize the problems with dark themes.
* [Fix] Fixed a problem with validation that was trying to validate foreign keys without need.
* [Fix] Fix a bug that was preventing "deferrable" attribute for constraint triggers to be used in SQL definition.
v0.8.1
------
Codename: Faithful Elephant
Release date: July 30, 2015
* [New] Added the ability to create objects from within the object selectors to shorten up the time spent to create a new objects in the model. The only exception of for selectors in SwapObjectsIdsWidget and table/column selectors in ViewWidget.
* [New] Added a new method OperationList::isObjectRegistered to check if an object is registered in the list.
* [New] Created a test class for SyntaxHighlighter.
* [Change] Code optmizations done in SyntaxHighlighter removing duplicated or unused code.
* [Change] Minor adjustments on splitters at DatabaseExplorerWidget and SQLExecutionWidget.
* [Change] Changed the way the s_objectAdded signal is captured in ModelObjectsWidget::selectObject in order to work properly in Windows.
* [Change] Removed unnecessary message box in BaseObjectWidget.
* [Change] Changed the connection mode of the procedures to clear the operation list when a fix is applied in the model by the validation.
* [Change] More improvements related to the operation list management when editing/creating objects through forms.
* [Change] Improvements on BaseObjectWidget when canceling the creation/edition of objects and there are chained operations in the operations list.
* [Change] Additional improvements on TableWidget removing unneeded connection to signals.
* [Change] Improvement in TableWidget to register a new table in the operaions list after the user create a dependency object (schema, tag, role, etc) to avoid undo/redo errors.
* [Change] Additional improvements on ObjectSelectorWidget and ModelObjectsWidget to automatically set focus on the created object.
* [Change] Enhanced the generated view code. Now it should be more readable.
* [Fix] Fixed a bug related to unlogged tables exporting.
* [Fix] Fixed a small bug in SyntaxHighlighter that was not highlighting properly new lines and text after multline comments.
* [Fix] Fixed a bug that was preventing comments to be properly quoted (issue #710)
* [Fix] Fixed the SyntaxHighlighter constructor call throught the classes.
* [Fix] Minor fixes on xml-highlight.conf
* [Fix] Minor fix in the import process to remove quotes from enum type attributes to avoid erroneous modification of attributes when diff a model and database.
* [Fix] Fixed the disabled close button on editing forms (Windows only)
* [Fix] Fixed a bug in the object selector that was preventing the selector dialog to be shown when user click in the input field.
* [Fix] Fixed a regression in method DatabaseModel::getObject(QString,ObjectType) when dealing with operator class or family.
* [Fix] Fixed the configuration of Quick menu for relationship added objects. The disable/enable sql action is not visible anymore.
* [Fix] Fixed possible memory leaks when creating new objects through editing forms.
* [Fix] Fixed a bug on the object name validation that was permitting user to specify object names containing only numbers.
* [Fix] Fixed a bug when generating ENUM types without enum attributes.
* [Fix] Fixed the generation of DROP command for trigger and rules.
* [Fix] Fixed a crash when closing the model. This crash was related to removing permissions from special objects and right after destroy the remaining permisisons.
* [Fix] Fixed the method Permission::getSignature to avoid generating the same signature for different objects (permissions must be unique).
v0.8.1-beta1
------
Codename: Faithful Elephant
Release date: June 30, 2015
* [New] Objects can be now renamed in database explorer except for databases and casts.
* [New] Added an initial Spanish (es_ES) UI translation (review needed).
* [Change] Dropped the startapp script in Mac OSX. All executables now are able to run without explicitly use that script.
* [Fix] Fixed the snippet related to object renaming in snippets.conf.
* [Fix] Fixed a small bug in schema parser that was ignoring the usage of '$oc' metacharacter in some cases.
* [Fix] Fixed shortcut for delete command in data manipulation form.
* [Fix] Fixed the deployment script on Mac OSX to make the CLI and crash handler find the core libraries properly.
* [Fix] Fixed a bug that was generating ALTER ROLE commands without the semicolon.
v0.8.1-beta
------
Codename: Faithful Elephant
Release date: June 04, 2015
* [New] Added the ability to handle databases in different connections at once without the need to disconnect from a server and connect to another.
* [New] Added an option to preserve database name (do not rename) in diff process.
* [New] Added a numbered code editor in ModelDatabaseDiffForm.
* [New] Created a basic structure to start building unit tests based upon Qtest for new features and fixes.
* [New] Added an automatic quotation mechanism for PostgreSQL's reserved keywords when they are begin used as object's name.
* [New] Created the function createNumberedTextEditor in PgModelerUiNS to be used as a factory of NumberedTextEdit instances.
* [New] Added a font preview widget in GeneralConfigWidget.
* [New] Added the ability to configure line numbers font/bg colors and highligt color in GeneralConfigWidget.
* [New] Created a class ReadOnlyItemDelegate to avoid the edition of items in data grid / tree widgtes.
* [New] Added a donate widget in MainWindow.
* [New] Created a new class NumberedTextEdit which goal is to display source code with line numbering and highlight color.
* [New] Created a html based delegate item in order to render tree items with html format.
* [New] Added a fallback value for environment values not set during startup.
* [Change] Minor improvement on ConnectionsConfigWidget when user left a connection open for editing and don't save it. The software will ask for save the connection.
* [Change] Improvements done to DataManipulationForm in order to avoid let connections open leading to application crash when the connection timeout is reached.
* [Change] Added a new constructor to Connection class that accepts a map of connection params.
* [Change] Removed the installation of PGMODELER_TMP_DIR environment variable in installer.
* [Change] Removed the usage of TEMPDIR variable in pgmodeler.pri
* [Change] Moved the code to create temp dir to Application class.
* [Change] Temporary folder now is isolated in pgModeler's configuration dir at user's home (platform specific) to avoid a user to see temp files from another.
* [Change] Removed the "stay on top" behavior on ModelOverviewWidget to avoid the blocking of application dialogs is some systems.
* [Change] Minor improvement on DataManipulationForm when creating the window title based upon the connected database.
* [Change] Disabled the cascade drop for roles and tablespaces (not supported) in DatabaseExplorerWidget.
* [Change] Minor improvement on SQLToolWidget to remove the excessive usage of buttons to connect and browse databases.
* [Change] Removed the "connect" button from ModelDatabaseDiffForm. Now the databases are listed when the connection is selected in combo.
* [Change] Removed the "connect" button from DatabaseImportForm. Now when selecting a connection the databases will be listed.
* [Change] Minor improvement on DataManipulationForm to load the first 100 rows of the current table each time the index of combobox changes.
* [Change] Moved the database drop button from SQLToolWidget to DatabaseExplorerWidget. Now each instance of the latter class emits a signal to SQLToolWidget to perform the db drop.
* [Change] Removed the mothod ModelsDiffHelper::setDiffOptions and create setDiffOption and a set of OPT_xxx constants to access the diff options.
* [Change] Minor improvement on SQLToolWidget to force focus of the current SQLExecutionWidget instance.
* [Change] Replaced the QPlainTextEdit instance in SnippetsConfigWidget by NumberedTextEditor.
* [Change] Added instances of NumberedTextEditor to CustomSQLWidget to be used as appended/prepended code input.
* [Change] Changed the default font size of source code editors to 10pt.
* [Change] Minor size adjustments on aboutwidget.ui and donatewidget.ui
* [Change] Improved the windeploy.sh to build binaries in x86 and x64 at once.
* [Change] Minor improvement on linuxdeploy.sh to build demo and full versions at once.
* [Change] Avoiding the copy of ui-style.conf during startup.
* [Change] Attributes and general functions in namespaces are now declared as extern in .h and defined in .cpp to force them to be initialized once.
* [Fix] Minor fix on windeploy.sh when building all releases at once.
* [Fix] Fixed the demo version build error.
* [Fix] Fix a crash when recreating Views that have child objects (rules or triggers) in DatabaseModel::storeSpecialObjectsXML.
* [Fix] Fixed a typo when displaying column default values as nextval(seqname).
* [Fix] Fixed a bug on DatabaseExplorerWidget that was selecting the wrong database when opening the data grid.
* [Fix] Fix a bug on DataManipulationForm that was preventing user to delete rows in tables with no primary key.
* [Fix] Minor signal message correction in DatabaseImportHelper.
* [Fix] Minor hint text correction in ModelDatabaseDiffForm.
* [Fix] Fix a bug on diff process that was not detecting precision/length changes in column types.
* [Fix] Fixed a bug in CLI that was not considering the PWD when dealing with input/output files.
* [Fix] Fix a crash in PgModelerCLI when exporting model to PNG.
* [Fix] Minor fix in SyntaxHighlighter to apply font changes in live objects instead of only apply font changes in new objects (requires the use of rehighlight())
* [Fix] Fixed a bug on SyntaxHighlighter that was rehighlighting endlessly a document leading to application crash.
* [Fix] Minor adjust on pgmodeler executable to find libs at runtime (Mac OSX).
* [Fix] Fixed a crash when creating a new table containing a new index.
* [Fix] Fixed a bug that was permitting to set precision/scale to a user-defined type.
* [Fix] Minor fix on catalog query that retrieve types. Now types derivated from materialized views are not listed.
* [Fix] More fixes related to inherited columns and check constraints. Now diff infos containing modification for these kind of objects are discarded.
* [Fix] Fixed the import of inherited check constraints.
* [Fix] Minor fixes on DatabaseImportForm, ModelDatabaseDiffForm, ModelValidationWidget to use the html item delegate.
* [Fix] Minor fix on model export and validation progress.
v0.8.1-alpha1
------
Codename: Faithful Elephant
Release date: April 20, 2015
* [New] Added the ability to import objects from an existent database to a currently working model.
* [New] Improvements on DatabaseImportHelper to dump the objects attributes in debug mode or to the log file when "ignore errors" is checked.
* [New] Added a fix step in CLI to fix functions signatures that includes OUT parameters.
* [Change] Minor adjustment on model validation progress and output.
* [Change] Minor adjust on model export progress on CLI.
* [Change] Minor improvements on objects validation process when dealing with broken relationship config as well with FKs referencing a column created before it.
* [Change] Minor improvement on object selector widget to show the constraint name correctly.
* [Change] Change in user's configuration copy process. Now only configuration files are copied, folders are not copied anymore.
* [Change] The CLI now references template configuration files instead of user's when configuring file association.
* [Change] The settings related widgets now references template configuration files in order to load defaults or save settings.
* [Change] Improved the way threads are handled in ModelDatabaseDiffForm.
* [Change] Changed the way thread is used in ModelValidationWidget. Now it'll be created in each time the "Validate" button is clicked.
* [Change] Removed unused actions in MainWindow.
* [Change] Removed sleepThread method from ModelExportHelper, ModelValidationHelper and DatabaseImportHelper.
* [Change] Disabled the tabChangeFocus property of sql input field in SQLExecutionWidget.
* [Change] Minor adjust on tag objects positioning.
* [Change] Fixed the generation of function's signature in Function. Now OUT parameters aren't included.
* [Change] Fixed the generation of function's signature in DatabaseImportHelper. Parameters signaled with 't' in their modes aren't included.
* [Change] Restored the old behavior of Connection class to append only error code as extra info in exceptions to avoid break other features that need that code.
* [Fix] Added a proper quotation to the command used to trigger the crash handler.
* [Fix] Minor fix when displaying the row amount for the selected table on database explorer.
* [Fix] Added a patch into swap id dialog when dealing with broken relationships.
* [Fix] Minor fix on relationship line configuration when redrawing them during the relationship validation process.
* [Fix] Minor fix when drawing views with extended attributes.
* [Fix] Minor fix when enabling/disabling zoom buttons when the current zoom reaches the minimum or maximum values.
* [Fix] Minor fix on thread operations on Windows system.
* [Fix] Fixed the export to SQL and PNG in thread mode.
* [Fix] Added missing breaking points in ModelsDiffHelper to help the thread to shutdown.
* [Fix] Fixed the UI hang up when exporting a huge model by using BlockingQueueConnection in some slots to avoid thread consume all CPU resources.
* [Fix] Fixed a endless loop in PgModelerUiNS::formatMessage.
* [Fix] Minor fix in the generation of ALTER TABLE .. ADD COLUMN command.
* [Fix] Fixed current tab index in AboutWidget.
* [Fix] Minor fix on SwapObjectsIdsWidget to invalidate the database forcing the validation process.
* [Fix] Fixed the operator name validation.
* [Fix] Adding missing flag icons in AboutWidget.
v0.8.1-alpha
------
Codename: Faithful Elephant
Release date: April 02, 2015
* [New] Added a "Contributors" section in "About pgModeler" dialog.
* [New] Introduced the NO_UPDATE_CHECK variable in qmake to turn off update verification code specifically for package maintainers usage.
* [New] Generated installers has the ability to install .dbm file association (Windows and Linux).
* [New] Introduced a new env var PGMODELER_TMPL_CONF_DIR to override the template configuration location.
* [New] The "plugins" folder is created automatically at startup if does not exits.
* [New] Added the ability to show original SQL code, dependencies and children's code for test purposes in source code preview dialog.
* [New] Added the method DatabaseModel::getCreationOrder(BaseObject *) that retrieves all objects needed to create a certain object.
* [New] Added an action to save SQL code to file in source code preview dialog.
* [New] Added an option to list indirect refereces to an object in ObjectDepsRefsWidget.
* [Change] Minor adjust on Windows installer script.
* [Change] Deployment scripts on all platforms now uses PostgreSQL 9.4 and Qt 5.4.1 by default.
* [Change] Replaced float data types to double in libobjrenderer and libpgmodeler_ui classes to avoid lost of precision mainly when handling graphical objects.
* [Change] File association procedures were moved to CLI. Now the user can install/remove file association by using '--dbm-mime-type' option (Windows and Linux).
* [Change] Minor adjustments in PgModelerCLI menu.
* [Change] Removed unused variables and commented code throughout the code.
* [Change] The build process now uses libxml2 from PostgreSQL installation (Windows).
* [Change] Minor adjustment on how the duplicated elements are removed from lists in the methods __getObjectDependencies(), __getObjectReferences(), findObject() in DatabaseModel class.
* [Change] Removed uneeded "using namespace" statements.
* [Change] Adjustment on start-pgmodeler.sh script to use pgmodeler.vars as source of needed environment variables (Linux).
* [Change] Improvements on how objects are recreated using the "recreate unmodifiable" option on Diff process.
* [Change] Enhanced the control of database explorer widgets and the SQL execution panes related to them.
* [Change] Added a clear error message when required fields are not set when creating/updating object.
* [Change] Installation folder/files arrangement reverted to previous settings in order to avoid "DLL entry point errors" errors (Windows).
* [Change] Minor change in pgmodeler.pri to set default output paths according to FSH standard (Linux).
* [Fix] Minor fixes and adjustments on the deployment script and installer configuration file (windows).
* [Fix] Minor fixes when dealing with CLI and crash handler calls inside code (MacOSX).
* [Fix] Minor fix on range based loops using auto keyword.
* [Fix] Fixing invalid shebang in shell scripts (Linux).
* [Fix] Fix tab order in ConnectionsConfigWidget.
* [Fix] Minor fix when resizing HintTextWidget instances.
* [Fix] Fixed a bug when importing constraint triggers.
* [Fix] Minor bug fix when dropping table children objects in database explorer.
* [Fix] Minor fix when generating XML code for permissions.
* [Fix] Minor bug fix on database explorer at manage view to avoid left opened connections.
* [Fix] Added a patch in model fix process to correctly move indexes/triggers/rules from within tables to outside their xml definition.
* [Fix] Fixed a bug when configuring encoding for database. Now the "Default" value can be used normally.
* [Fix] Fixed a bug on model fix process that was removing empty lines (only with breaks) from functions definitions as well from other objects.
* [Fix] Fix crash when converting a serial column which is not assigned to a primary key.
v0.8.0
------
Codename: Faithful Elephant
Release date: February 28, 2015
* [New] Added support for multiple SQL execution widget instances for the same browsed database in SQL tool.
* [New] Added truncate table actions on DatabaseExplorerWidget.
* [Change] Minor adjustments on ModelValidationHelper.
* [Change] Minor adjustments on CustomSQLWidget.
* [Change] Included the delete cascade action to Edit menu in MainWindow.
* [Change] Minor widget adjustments on ModelDatabaseDiffForm.
* [Change] Minor improvements when saving temp models. Now the saving thread will not run if the diff/export/import dialogs are focused avoiding (rare) race conditions.
* [Change] Improved the update notifier to display a recover link and purchase link on the "Get binary package" button menu.
* [Change] Minor adjustment on output icons at ModelExportForm.
* [Change] Improvement on DatabaseModel::getObjectReferences to retrieve indexes as references to columns. This solve the bug related to import and diff processes that was causing detached columns to be dropped even if there were indexes referencing those columns.
* [Change] Added a more friendly error message when the user try to undo/redo an invalid operation at operations history.
* [Change] Minor improvement on ConnectionsConfigWidget adding the ability to make the configured initial database to be auto browsed when using the connection to manage objects on Manage view.
* [Fix] Fixed the output of SQL commands on diff, import and export. The commands now does not comes without original line breaks.
* [Fix] Fixed unexpected dialog blockings and form resetting on diff and export dialogs when minimizing and restoring the application.
* [Fix] Fix a crash when converting a serial column to sequence in which the first is not assigned to a primary key.
* [Fix] Minor fix on crash handler startup. Now exceptions occurred during the process are printed to stdout.
* [Fix] Fix a crash when pasting objects right after closing the source model (from where the objects were copied/cut).
* [Fix] Minor fix on ModelWidget::showObjectForm to correctly show permissions details.
* [Fix] Minor fix on the import process. Now the majority of problems related to objects that are created before their dependencies are solved.
* [Fix] Fixed some bug related to object duplication error treatment on ModelExportHelper.
* [Fix] Fixed a crash on connections config dialog when user removed a single connection and close the application, causing segmentation fault.
* [Fix] Minor fix on SQLToolWidget to avoid the disabling of SQL command input and controls when a database is dropped and there is at least one database being browsed.
* [Fix] Minor fix on session saving process.
* [Fix] Fixed a bug that was causing relationship points to be moved twice when multiple objects were selected on the canvas area.
* [Fix] Fixed some syntax errors on snippets.conf file.
* [Fix] Fixed a bug that was preventing global settings for relationships to be persisted.
* [Fix] Fixed a bug when importing permissions related to functions.
* [Fix] Minor fix on signal/slot connection order in NewObjectOverlayWidget.
* [Fix] Minor improvements on swap objects ids dialog.
v0.8.0-beta2
------
Codename: Faithful Elephant
Release date: February 07, 2015
* [New] Added the method Connection::getServerInfo that returns some informations about the connected server.
* [New] Added an attribute to DatabaseExplorerWidget to show the estimated rows amount for selected table.
* [New] Added the ability to cascade delete objects from database model.
* [New] Created missing getters and setters for Operation class.
* [New] Added the ability to set owner, schema and tag for several objects at once through the quick actions menu.
* [New] Added an option to diff process to reuse sequences if the source model has serial columns in which the generated sequence name matches a sequence's name on the imported model.
* [New] Added the support for per-user configuration. Now each user on the system will have his separated configuration folder.
* [New] Added a bug report form on main window to give user the chance to report a bug without use crash handler.
* [New] Added action to enable/disable an object's sql from quick actions menu at ModelWidget.
* [New] Created a new namespace PgModelerUiNS to store shared constants and function in libpgmodeler_ui subproject.
* [New] Added the ability to execute the DROP statements attached to object's SQL when exporting model to DBMS.
* [Change] The method PgModelerNS::formatString was moved to PgModelerUiNS::formatMessage.
* [Change] Simplified the layout of DataManipulationForm making the Advanced tab (filter) be moved to the same tab of result set facilitating the access to filtering features.
* [Change] Restored previous behavior of ModelWidget::cancelObjectAddition and ModelWidget::enableModelActions methods.
* [Change] Removed empty destructors from classes TableView and GraphicalView.
* [Change] Minor changes on destructors of classes that represents graphical objects on libobjrenderer to correctly undo the link between the graphical object and the source object.
* [Change] Improvements on ModelExportHelper adding the ability to ignore certain error triggered by PostgreSQL referencing their codes.
* [Change] Improvements on crash handler to reuse the code from bug report form.
* [Change] Changed the default PREFIX on pgmodeler.pri to /opt/pgmodeler when building on Linux.
* [Change] Several adjustments on deployments scripts to use the new build variable settings.
* [Change] Minor adjustments on main.pro, pgmodeler.pro and pgmodeler.pri files.
* [Change] Additional improvements on start-pgmodeler.sh and startapp.
* [Change] Crash/bug report files now have extensions .bug instead of .crash
* [Change] Removed the unused class Utf8String. This class was used in earlier versions of pgModeler and Qt 5x to fix some issues related to UTF8 string handling. After removed any reference of the class from code the issue seems fixed. In any moment this class can return if we have regressions.
* [Change] All literals throughout the code were replaced by QString() construction.
* [Change] Adjustments done in .pro file in order to correctly compile under Windows.
* [Change] Modifications done on .pro files that will permit custom output paths when building pgModeler from source, enabling it to be package to several linux distros.
* [Change] Moved the method disableReferencesSQL from BaseObjectWidget to PgModelerUiNS.
* [Change] Modifications done on DatabaseImportForm in order to be in the same standard as ModelExportForm and ModelDatabaseDiffForm.
* [Change] Minor improvements on ModelExportHelper in order to show the correct actions (commands) being executed.
* [Change] Improvements on ModelExportForm by including an output tab in order to display all actions taken during the export process.
* [Change] Adjustments on PgModelerCLI, ModelExportForm and ModelExportHelper to accept the "drop objects" option.
* [Change] Minor adjustment on ModelDatabaseDiffForm in order to lower the chances to crash the app if user try to repeatedly cancel and start over the diff process.
* [Change] Minor change on the generation of DROP statements attached to object's SQL.
* [Fix] Minor fixes on html formatted messages.
* [Fix] Fix on GeneralConfigWidget that was not saving code completion enabling status.
* [Fix] Fixed some bugs on libobjrenderer classes that was causing crashes in some models arrangements. Now graphical objects are effectively deallocated only when the whole scene is destroyed.
* [Fix] Minor improvement on OperationList::removeOperations to avoid crashes if a pool object is destroyed outside the operation history (e.g. relationship invalidation).
* [Fix] Several fixes on OperationList to minimize the crashes when undoing/redoing operations.
* [Fix] Minor fix on validation process that was failing sometimes to use temporary names feature.
* [Fix] Minor fix on ModelsDiffHelper to correctly recreate foreign keys that references recreated primary keys.
* [Fix] Minor fix on Table::removeObject to change not-null state of columns only when the removed object is a primary key.
* [Fix] Fixed a bug when converting many-to-many self-relationship and trying to undo the operation.
* [Fix] Fixed the query to retrieve the last_value field of sequences on DatabaseExplorerWidget.
* [Fix] Minor fix on CLI that was wrongly considering tag attributes default-* as xml code for database objects causing errors on fix process.
* [Fix] Minor fix on diff process that was ignoring column's data type changes.
* [Fix] Minor fix on column SQL generation that was removing quotation on sequences names when using nextval() function call as default value.
* [Fix] Minor fix on ModelFixForm to correctly find the startapp script on MacOSX.
* [Fix] Fixed bug when import/diff user defined types that contains $ in the middle of their names. Now the names are quoted to avoid errors when referencing those types.
* [Fix] Minor fix when saving/restoring sessions. Now, empty sessions (without loaded files) are correctly saved.
* [Fix] Fixed a crash when importing a database in a second time after some error has occurred previously.
* [Fix] First version of a fix to solve problems related to inheritance diff/import. Now pgModeler does not try to drop inherited columns on diff process.
* [Fix] Fixed a crash when destroying constraints stored on operation history.
* [Fix] Fix on the import process to correctly identify and create inherited columns that aren't linked to constraints or other objects. For those referenced by other objects they will be created as detached columns.
* [Fix] Fixed a bug on rule.sch catalog query.
* [Fix] Minor fix on generation of DROP commands.
* [Fix] Fixed some catalog query schema files and the Catalog class itself in order to correctly select/discard objects linked directly or not to extensions.
* [Fix] Minor fix on generation of commands related to extensions. According to the rule, extensions names can't be schema qualified.
v0.8.0-beta1
------
Codename: Faithful Elephant
Release date: January 10, 2015
* [New] Created the widget SnippetConfigWidget in order to handle SQL snippets on SQLTool and DatabaseExplorerWidget.
* [New] Introduced a new expression %unset on SchemaParser to clear the named attributes.
* [New] Added support for permission on objects Type and Domain.
* [New] Added the method SchemaParser::extractAttributes that is capable to extract the attributes used in a loaded buffer.
* [New] Added methods to handle snippet selection in DatabaseExplorerWidget and SQLToolWidget.
* [New] Created the hint text for code completion option on GeneralConfigWidget.
* [New] Added an option to enable/disable code completion widget on sql code input fields (linked to CodeCompletionWidget instances).
* [New] Created a method Connection::getConnectionId that returns a string to identify that connection.
* [New] Created the constant GlobalAttributes::SNIPPET_CONF to store the default name for code snippet config file.
* [New] Added some basic code comments on DatabaseExplorerWidget.
* [New] Created the global constant SQL_HIGHLIGHT_CONF_PATH and XML_HIGHLIGHT_CONF_PATH on GlobalAttributes in order to avoid code repetition when loading syntax highlight conf files.
* [New] Added a method to parse rule commands on Catalog.
* [New] Added the method Catalog::getObjectAttributes to retrieve object attributes by its oid.
* [New] Introduced a new step on model validation: relationship configuration checking.
* [New] Added "properties" action on context menu at DatabaseExplorerWidget.
* [New] Added a panel related to object's properties on database explorer widget.
* [Change] The operation history is erased whenever a fix is applied to the model by the validator.
* [Change] Minor change on ColorPickerWidget in order to change color of pickers using stylesheet instead of QPallete.
* [Change] Minor adjustments on AppearanceConfigWidget.
* [Change] Minor copyright update on source files.
* [Change] Renamed the instruction %define to %set at SchemaParser.
* [Change] Removed unused methods from Messagebox.
* [Change] Minor improvements on Messagebox class by adding a simple show() method that receives only trhee parameters.
* [Change] Minor improvements on SchemaParser::translateMetaCharacter()
* [Change] Minor fix on DatabaseExplorerWidget::handleSelectedSnippet()
* [Change] Removed duplicated code to handle snippets on SQLToolWidget.
* [Change] Methods setIgnoreEmptyAttributes and setIgnoreUnkownAttributes at SchemaParser were renamed to ignoreEmptyAttributes and ignoreUnkownAttributes.
* [Change] Minor improvements on ModelNavigationWidget to show the filename associated to a hovered item on combobox.
* [Change] Simplified the syntax for attributes on .sch files from @{attrb} to {attrib}.
* [Change] Updated all .sch files with the new attribute syntax.
* [Change] Minor improvements on configuration widgets in order to detect if the settings was changed, this will avoid the unecessary load/save of the configuration files in ConfigurationForm.
* [Change] Replaced ternary ifs like "1" : "" by ParsersAttributes::_TRUE_ : ""
* [Change] Extensive changes in BaseConfigWidget and its subclasses in order to remove the use of extern keyword on other libs when there is the need to get the current config params. Now, user must call * [class]::getConfigurationParams() where class must be one of the derivates of BaseConfigWidget.
* [Change] The extern pointer configuration_form on mainwindow.cpp was moved into MainWindow class as a subwindow of it.
* [Change] Improvement on BaseConfigWidget and its children classes in order to use polymorphism in ConfigurationForm when needing to save or load confs.
* [Change] Moved the constants PGSQL_VERSION_xx from SchemaParser to a namespace called PgSQLVersions in order to avoid the "static initialization order" problem.
* [Change] Additional constants were created on PgSQLVersions namespace: ALL_VERSIONS and DEFAULT_VERSION.
* [Change] Improvement on XMLParser::hasElement method in order to permit user to check if the current element has a child of the specified XML node type.
* [Change] Minor improvements on BaseConfigWidget.
* [Change] Moved the method DatabaseModel::getObjectType(QString) to BaseObject as a static one.
* [Change] Minor updates on sql-highlight.conf
* [Change] Updated the version info on platform specific installer files.
* [Change] Removed unused constructor on Connection class.
* [Change] Minor improvement on DatabaseImportForm::listObjects, now it's possible to include a database root item.
* [Change] Minor improvements on class DatabaseImportHelper.
* [Fix] Fixed a bug that was crashing application when using special pks in relationshps.
* [Fix] Minor fix on windeploy.sh to copy the correct libs.
* [Fix] Minor fix on macdeploy.sh in order to use Qt 5.4.
* [Fix] Fixes done in order to build pgModeler on Windows using Qt 5.4.
* [Fix] Fixed a bug on SchemaParser that was wrongly reading %define instructions inside if's and creating attributes when it was not need to create them.
* [Fix] Modifications done on attributes initialization at RelationshipWidget in order to fix some crashes. Now pgModeler runs without crashing when compiled in release mode using g++.
* [Fix] Minor fix on aggregates listing on Catalog class. Now the handled types are attached to aggregates' names.
* [Fix] Minor fix on config pages indexes on ConfigurationForm.
* [Fix] Minor fix on MainWindow when there are errors during configuration files loading.
* [Fix] Minor fix on object name formatting at DatabaseExplorerWidget.
* [Fix] Minor fix on SQLToolWidget to set the current database explorer instance properly.
* [Fix] Minor fix on rule catalog query.
* [Fix] Minor fix on table.sch schema file.
* [Fix] Fixed the object filter on database explorer.
* [Fix] Typo correction on ModelExportHelper.
* [Fix] Additional fix to remove g++ warnings.
v0.8.0-beta
------
Codename: Faithful Elephant
Release date: November 29, 2014
* [New] Introduced the first version of model database diff feature.
* [New] Created the method Constraint::isCodeDiffersFrom in order to correctly generate the xml code and compare it with another object's code.
* [New] Created the method PgModelerNS::formatString in order to avoid repeatedly replace special chars by html tags.
* [New] Added the method PgSQLType::isEquivalentTo in order to check if a type is equivalent to another. This method helps to avoids unnecessary recreation of columns or type attributes on diff process.
* [New] Created the class DatabaseExplorerWidget in order to permit user manage several database instances on the sql tool.
* [New] Enabled the usage of cached catalog queries on Catalog class in order to increase the performance of the whole import process.
* [New] Added the method PgSQLType::isRegistered that indicates if a type is already registered or not.
* [New] Added the method BaseObject::acceptsAlterCommand to indicate if an object type can be changed through ALTER commands.
* [New] Added the method BaseObject::acceptsDropCommand to be able to identify which kind of object accepts DROP commands.
* [New] Added the method Column::getAlterDefinition in order to get the ALTER definition based upon the differences of two columns.
* [New] Added the ability to schema parser to create attributes from within the parsed schema files or buffer.
* [New] Added the method Table::getTruncateDefinition to return the proper TRUNCATE command.
* [New] Added method Sequence::getAlterDefinition.
* [New] Added method Role::getAlterDefinition.
* [New] Added method Index::getAlterDefinition.
* [New] Created the getAlterDefinition method for Extension and Function.
* [New] Created the custom implementation for getSignature() for Aggregate, Cast, Constraint, Index, Operator Class, Operator Family, Rule, Trigger.
* [New] Created the own versions of getDropDefinition for Function and Index.
* [New] Added to schema parser the ability to evaluate simple comparison expressions in the form (@{attribute} [operator] "value").
* [New] Added a special attribute pgsql-ver when generating code definition to store the currently used pgsql version.
* [New] Introduced a new method BaseObject::getSignature() that returns by default the object's name (formatted or not) and with the schema name prepended (when available).
* [New] Introduced a new name pattern PK_COL_PATTERN which is used to generate the single pk column name for many-to-many relationships.
* [New] Added method getAlterDefinition for Aggregate, Collation and EventTrigger.
* [New] Created a styled text box object.
* [New] Created the new class RoundedRectItem in order to generate rounded corner rectangle items on scene.
* [New] Added a sql disabled info item for relationships.
* [New] SQL disabled status are now displayed as a textbox on top of tables and schemas. Other objects will continue to have their names striked out to denote the deactivation of SQL code.
* [New] Added the ability to copy text from validation widget output.
* [Change] Minor change on Connection class. Added the method Connection::setSilenceConnError in order to silence connection errors in certain cases.
* [Change] Major changes on sql tool. Now it's possible to manage several database instances on the same server connection.
* [Change] Moved the code that was handling database objects tree from SQLToolWidget to DatabaseExplorerWidget
* [Change] Improvements on DBMS export process. Now the process detects when a object is being created, changed or dropped returning the correct message to the user.
* [Change] Minor fix on Role::getAlterDefinition.
* [Change] Removed the generation of inheritance command from Table::getAlterDefinition and moved to Relationship::getInheritDefinition.
* [Change] Minor update on sql highlight configuration file.
* [Change] Minor adjustments on schema files for CREATE commands.
* [Change] Minor update on sql-highlight.conf.
* [Change] Several changes on schema files related to comment command formatting.
* [Change] Removed the attribute ParsersAttributes::DIF_SQL due its deprecation.
* [Change] Improvements on all schema files that makes use of @{pgsql9x} attribute. Those attributes were deprecated and replaced by comparison expressions.
* [Change] The method SchemaParser::storePgSQLVersion was removed due to the deprecation of attribute @{pgsql9x}.
* [Change] Minor change on the Connection class to return the full version or only the major one of the server.
* [Change] Code blocks where there was a special treatment to get object's name filtering by object's type (specially function and operator) were replaced by a single call to BaseObject::getSignature().
* [Change] Improved the way many-to-many relationships can be configured. Now the generated table can have a single column as primary key or a multi-valued one.
* [Change] The ModelWidget::convertRelationshipNN method was improved in order to correctly convert many-to-many relationships with single or multi-valued primary key.
* [Change] Removed the restriction from Catalog and DatabaseImportForm to hide the "postgres" database.
* [Change] Minor change on how drop command is generated for collations.
* [Change] Minor fix on fields which accepts expressions to show scroll bars as needed.
* [Change] Changed the order of actions on left control bar at main window.
* [Change] Minor improvement on export to png process. The output image is generated with a margin.
* [Change] Minor change on sample models and asset images.
* [Change] Minor changes on TextboxView.
* [Change] Changed the style of graphical resentation for schemas, views, tables. Now they are drawn with rounded borders.
* [Change] Minor improvements on how sql disabled info item is generated and managed.
* [Change] Change the relationship cardinality pattern from (1,n) to 1:n.
* [Change] Minor label adjustment for many-to-many relatinships.
* [Change] Minor adjustments on textbox resizing.
* [Change] Minor adjustments on relationships custom points descriptors in order to give better selection and movement.
* [Change] Minor improve when moving a schema object. Relationship points will be moved together.
* [Change] Minor editing forms size adjustments.
* [Change] Changed the layout of modeldatabasediffform.ui and added hint text widgets.
* [Change] Changed the hint texts on general config, relationship config and model restoration form.
* [Change] Minor change on relationship editing form, by default random line colors are enabled.
* [Change] Minor fix on temporary models saving process.
* [Change] Explicit hint texts were moved to the instances of the new class HintTextWidget.
* [Change] Minor improvement on database editing form. LC_COLLATE and LC_CTYPE can be freely modified.
* [Change] Minor improvement on primary key constraints. Columns added to them will be marked as not-null by default. This is done to avoid false-positive changes on the model db diff process.
* [Change] Improvements on main window in order to give more visibility to SQL tool and central widget. Now there are three different views (welcome, design and manage).
* [Fix] Minor fixes throught the code in order to remove g++ warnings.
* [Fix] Minor fix on table's SQL schema file.
* [Fix] Minor fixes on demo version code. Remove the execution time limit and increased the maximum objects count.
* [Fix] Fixed a bug when generating XML code for materialized views that was causing these objects to break DTD rules.
* [Fix] Minor fix on code generation of permissions.
* [Fix] Minor fix on permissions editing form.
* [Fix] Fixed a bug on database import process that was crashing the application whenever importing a composite type.
* [Fix] Minor fix on reverse engineering process when importing columns which reference user defined type that are in pg_catalog.
* [Fix] Minor bug fix on database import process that was causing some crashes.
* [Fix] Minor improvements on "move to schema" feature on model widget. The references to moved object are now correctly updated.
* [Fix] Minor fix on SyntaxHighlighter that was not correctly applying the default font to the parent object.
* [Fix] Minor fix on index class and editing form to accept FILLFACTOR no matter the indexing method used.
* [Fix] Minor fix when removing table children objects and restoring them from operations list.
* [Fix] Fixed a crash when reverse engineering a model. The crash was due to trying to handle a not existent graphical object for pg_catalog schema.
* [Fix] Fixed the resizing of schema objects.
* [Fix] Minor fixes on schema editing form.
* [Fix] Additional fixes for export model to png. Now the correct bounding rect is calculated.
* [Fix] Fixed a bug when exporting model to png that was exporting unnecessary blank areas.
* [Fix] Fixed the click on the object selector input field. When the control is disabled the object selection dialog will not be opened.
* [Fix] Minor fix on domain class and editing form that was not resetting the constraint name attribute.
* [Fix] Minor fix on model validation helper to avoid include the database as a referer of other objects.
* [Fix] Fixed a bug when renaming objects and invalidating their references.
* [Fix] Fixed a bug on schema parser when converting chars to xml entities.
v0.8.0-alpha2
------
Codename: Faithful Elephant
Release date: September 30, 2014
* [New] Added an option on general settings to disable ask to validate model before save, export and diff.
* [New] If the user try to save, export or diff a model and it is invalidated, pgModeler will first validate and then proceed with the pending operation.
* [New] Added an entry on general settings to control how graphical objects are created.
* [New] Added an option to disable render smoothness to improve performance on large models.
* [New] Added the method Catalog::getObjectsOIDs in order to retrieve all database objects oid and store them in maps. This method is used as an auxiliary for model-database diff process.
* [New] Added the method ConnectionsConfigWidget::fillConnectionsComboBox() in order to reuse the code that fills up a combobox with configured connections.
* [New] Added the ability to create special primary key on many-to-many relationships.
* [New] Added the ability to save the dock widgets configuration on the main configuration file.
* [New] Added methods to retrieve objects by their names on DatabaseModel class.
* [Change] The configuration form was reestrucured decreasing the size occupied on the screen.
* [Change] Minor improvement on model fix dialog.
* [Change] Minor improvement on constraint import. Fillfactor attribute now is correcly retrieved.
* [Change] Removed extern directives referencing configurations from SyntaxHighlighter and ModelWidget converting the used attributes to static ones.
* [Change] Changed the way threads are created, as well the import and diff helpers instances to avoid race conditions and crashes.
* [Change] Schemas by default will be created to show the bounding rectangle.
* [Change] Minor improvement on BaseObject::getTypes() in order to exclude some types from the resulting vector.
* [Change] Minor widgets adjustment on modeldatabasediffform.ui, modelexportform.ui and databaseimportform.ui.
* [Change] Updates on several resource images.
* [Change] Minor change on example.dbm file.
* [Change] Minor change on DatabaseImportHelper to accept a DatabaseModel instance instead of ModelWidget.
* [Change] Minor adjustments on deployment scripts.
* [Fix] Fixed issue with Inno Setup invalid bitmap error (Windows).
* [Fix] Fixed a bug that was preventing encrypted password to be configured for roles.
* [Fix] Fixed a crash whenever user quit the application on Mac OSX.
* [Fix] Minor fixes in order to compile using Qt 5.3.2.
* [Fix] Fixed a bug when starting the creation process of relationships on model widget.
* [Fix] Fixed a bug related to individual permission exclusion and object removal error when there are permissions attached to it.
* [Fix] Fixed typos on demo version warning messages.
* [Fix] Fixed a bug that was not generating FILLFACTOR attribute for constraints.
* [Fix] Minor fix on object naming rules. Now the dollar sign ($) is accepted in the middle of object's name.
* [Fix] Fixed a bug when import domains which have the same name as some tables.
* [Fix] Fixed a bug on trigger class and editing form that was preventing the "FOR EACH ROW" attribute to be saved.
* [Fix] Fixed a infinite loop on operation list class when calculating the chain size.
* [Fix] Fixed a crash when creating relationships. Apparently this crash was caused by a faulty access on some threads right after close the relationship dialog.
* [Fix] Fixed the bug that was preventing a sequence to be assinged to a column.
* [Fix] Fixed a bug on relationship validation process that was causing errors mainly related to generalization relationships.
* [Fix] Fixed a bug on xml parser when reading DTD files from paths that contains accentuated chars.
* [Fix] Minor fix on Messagebox class when replacing
tags on message text.
* [Fix] Minor fix on conditional compilation macros entries for demo version.
v0.8.0-alpha1
------
Codename: Faithful Elephant
Release date: August 15, 2014
* [New] pgModeler now is capable to handle table's data through the new data manipulation form.
* [New] The SQL tool received a basic find/replace widget.
* [New] Created a new environment variable for samples directory, PGMODELER_SAMPLES_DIR.
* [New] Source code dialog now optionally appends the SQL of permissions for the current object.
* [New] Added an option to the source code privew dialog to include table's children objects' SQL.
* [New] Added a field on all object's editing form to expose the object's internal id.
* [New] Added an option on the database import process to generate random colors for relationships.
* [New] The model objects widget gained a filtering field that is capable to list objects by their name or internal id.
* [New] Added support for custom SQL for rules, indexes and triggers.
* [New] Added two new sample models.
* [Change] Changed the shortcut for "About pgModeler" to F4 key.
* [Change] Minor update on shortcuts and tooltips of buttons on bottom control bar at main window.
* [Change] Minor improvement on model validation. Now the DDL executed for any object is shown on the output field.
* [Change] Minor change on object's id interval generation.
* [Change] Minor adjust on model export process to force the code cache invalidation when using the unique name generation option.
* [Change] Message box objects are now used on demand and no more as class attributes.
* [Change] The software startup was hugely improved by removing singleton dialogs from main window's constructor, now they are used on demand.
* [Change] Minor update on sql-highlight.conf file.
* [Change] Sample models can be now loaded direclty from the main windows's central widget.
* [Change] Enhancement on the messages of model validation output.
* [Change] Minor fix on object's schema files to correctly generate the appended/prepended SQL code.
* [Change] Major improvement on all core classes (resposible to represent database objects) in order to keep their cache syncronized with the current configuration.
* [Change] Object finder now highlights the parent table if the user selects a child object of the first.
* [Change] Minor improvement on CLI. Added a routine to change a table structure, moving the tags rule, index and trigger to outside of it.
* [Change] Changed the way on how the relationship connection points are determined. Now they depends on how the tables' center points are distant from each other.
* [Change] More improvements done on database model objects classes in order to give more speed on the code generation.
* [Change] Update for French (fr_FR) translation.
* [Chage] Minor improvements on swap objects ids dialog.
* [Change] Huge improvement on validation process mainly for reverse engineered models. Now pgModeler honors the imported structure and in a few cases there will be inconsistencies.
* [Change] The objects rule, index and trigger will have the SQL/XML code generated outside of table's definition due to validation process that sometimes needs to swap id's of those objects.
* [Change] The object selector will trigger the object selection if user click the input field.
* [Change] Changed the 'line color' attribute of relationships to 'custom color'.
* [Fix] Fixed a crash provoked by the constraint editing form when switching the constraint type on the second time the form is opened.
* [Fix] Minor fix on database import process that was wrongly checking all tables as unlogged.
* [Fix] Minor fix on sample models pagila.dbm and usda.dbm to remove the unlogged attribute.
* [Fix] Minor fix on class CodeCompletionWidget to make it persistent as well to remove duplicate items from listing.
* [Fix] Minor fix on message box instances to resize according to the height of the current message.
* [Fix] Fixed a crash whenever the user cancelled the changes on settings and tried to connect to a server using the SQL tool.
* [Fix] Minor fix on SQLToolWidget to disable controls in some situations.
* [Fix] Minor fix on BaseRelationship and Relationship classes to correctly invalidate envolved object's when connecting or disconnecting.
* [Fix] Fixed a crash when closing the last model and the object finder was visible with result list filled.
* [Fix] Object finder now doesn't show duplicated items.
* [Fix] Minor fix on model objects widget when assigning a null model.
* [Fix] Fixed the problem with function parameter name not being generated due to cached code.
* [Fix] Minor fix on index editing form layout.
* [Fix] Fixed the import of rule object on DatabaseImportHelper class.
* [Fix] Fixed a bug when displaying the cardinalities for fk relationships.
* [Fix] Fixed a bug on the reverse engineering process that was wrongly migrating 'timestamp with time zone' data type as 'timestamp' only.
* [Fix] Fixed a bug on the reverse engineering process that was preventing the migration of operator classes / indexes that contains duplicated elements.
v0.8.0-alpha
------
Codename: Faithful Elephant
Release date: July 21, 2014
* [New] Added support for using global settings for relationships on the editing form of those objects.
* [New] A new section was created on settings dialog to manage global configurations for relationships.
* [New] Enabled the movement of schema objects without the need to select their children. This operation does not applies to protected or system schemas like public, pg_catalog.
* [New] Created a more elaborated central widget with some basic operations like create, load, load recent models and restore previous session.
* [New] Reletionships 1:1, 1:n and fk now supports a new style of link between tables. The foreign key columns will be directly linked to primary key columns.
* [New] Created a class called ColorPickerWidget to handle operations where the user need to configure colors for objects.
* [New] Relationship objects now supports custom line colors.
* [New] Added the static methods setPgSQLVersion and getPgSQLVersion on BaseObject class in order to override the PostgreSQL version used to generate code for all instances of that class.
* [New] Introduced a method DatabaseModel::getXMLParser() in order to return the xmlparser of the model to permit user create new objects from xml code within the current database model.
* [Change] Minor adjustment on central widget buttons style on MacOS X.
* [Change] Disabled the collapsed main menu on MacOS X due to particularities on GUI of this system.
* [Change] Minor adjustment on main menu construction on Linux/Windows.
* [Change] Major change on main UI style in order to make a cleaner interface and gain more space on canvas to handle models.
* [Change] Minor model objects style refreshment.
* [Change] Minor optimization on class AppearanceConfigWidget by adding color pickers in order to select color of the elements.
* [Change] A significant code optimization was made on TagWidget by changing the tool buttons that was handling color configuration by color pickers.
* [Change] Added a color picker on RelationshipWidget to permit the configuration of custom line color.
* [Change] Minor layout adjustment on update notifier widget.
* [Change] Important change on SchemaParser class which is not a singleton anymore in order to minimize crashes due to race conditions on running threads.
* [Change] Important change on XMLParser class which is not a singleton anymore in order to minimize crashes due to race conditions on running threads.
* [Fix] Fixed a bug related to partial command execution on SQL tool.
* [Fix] Minor fix on model navigation widget when closing a model.
* [Fix] Fixed a bug that was crashing pgModeler when switching models with the overview widget opened.
* [Fix] Fixed a bug that was eventually making pgModeler enter on a endless looping when calculating the chained operations length.
* [Fix] Fixed a regression related to special objects recreation after rename a primary key column. The problem was that the relationship was wrongly storing the old name of the columns at connection time.
v0.7.2
------
Codename: Brave Mastodon
Release date: June 27, 2014
* [New] Added the missing attribute BUFFERING for Gist indexes.
* [New] Added an experimental installer for Linux based upon the Qt Installer Framework.
* [New] Added an file called RELEASENOTES.md. This file will be read by the update notifier on server in order to return to the GUI the change log and additional release info.
* [Change] Minor change on MacOS X deployment script to generate the dmg file with a custom icon.
* [Change] Restored the start-pgmodeler.sh file due to difficulties that some users are having when running pgModeler on Linux systems.
* [Change] Created the folder "installer" to store all files related to installers of all platforms
* [Fix] Fixed a regression related to sequences not being included on database model XML code.
* [Fix] Fixed deployment on Linux. Now start-pgmodeler.sh is correclty copied.
* [Fix] Fixed the display of relationship actions on NewObjectOverlayWidget
v0.7.2-beta1
------
Codename: Brave Mastodon
Release date: June 21, 2014
* [New] Added support for event trigger objects. The export and import processes were adjusted to handle this kind of object.
* [New] Added support for UNLOGGED tables.
* [New] Enabled PostgreSQL 9.4 export and import processes.
* [New] Enabled the jsonb datatype for PostgreSQL 9.4.
* [Change] Rolled back to Qt 5.2.1 the version used by the macdeploy.sh script due to crash reported in issue #494 and #482.
* [Change] SQL tool improvement. Added a "drop cascade" action and fixed a bug when refreshing a specific item on database tree.
* [Fix] Minor fix on ColumnWidget, disabled the line breaking in the field "Expression".
* [Fix] Fixed the model fix dialog on MacOS X and Windows platforms.
* [Fix] Schemas names are now correctly striked out on the rectangle when their SQL code is disabled. The system schemas public and pg_catalog will continue not to have their names striked out.
* [Fix] Fixed a bug that was preventing default values of domains to be loaded from file.
v0.7.2-beta
------
Codename: Brave Mastodon
Release date: June 06, 2014
* [New] Added an option to convert integer type to serial ones on columns which default value is a nextval(seq::regclass) call.
* [Change] Changed the MacOS X deployment script to use Qt 5.3.
* [Change] Minor size adjustment on the new object overlay.
* [Change] The model objects widget now clears the selection when it lost the focus.
* [Change] Minor change on new object overlay behavior. The overlay will be hidden when any tool button on it is pressed or the ESC key is pressed.
* [Change] The partial database import was improved. Now pgModeler is capable to resolve dependencies of foreign key constraints, creating the needed tables automatically. Additionally, domains are automatically imported when referenced by columns.
* [Fix] Fixed compilation process on Windows system.
* [Fix] Fixed the crash handler call inside the main program.
* [Fix] Minor fix on "object's deps. & refs." dialog that was triggering an error when trying to open a table child object from there.
* [Fix] Added a entry on DatabaseModel::getObjectDependecies() to get the sequence that a column depends on.
* [Fix] Fixed a bug column editing dialog that was wrongly removing the sequence assigned to a column.
* [Fix] Fixed sample plugins compilation when using a LIBDIR value other than the default.
* [Fix] Fixed the build number generation at compilation time.
* [Fix] Minor fix on TableTitleView class to correctly strikeout the schema name only when the schema rectangle is not visible.
* [Fix] Minor adjustment on databaseimportform.ui size.
* [Fix] Fixed the custom page size bug due to patches provided by Qt 5.3. A conditional compilation statement was added on portions where the custom page size is used. This way the code can be build on any Qt version but the fix will available only on 5.3.
* [Fix] Minor fix on the Linux deployment script.
v0.7.2-alpha1
------
Codename: Brave Mastodon
Release date: May 30, 2014
* [New] Introduced a "new object" overlay widget which gives user a quick access to actions that create objects.
* [New] Added a step to fix indexes with old tag on command line interface.
* [New] Added support for item interaction on "object's dependencies and references" dialog.
* [New] Added support for generate temporary names for database, roles and tablespaces when running validation process. This will avoid errors if the original database and the other objects already exists on the server.
* [New] Updated the CLI to include the option to generate temporary object's names.
* [New] Added suppport to save and restore the last position and zoom on the canvas. This behavior can be deactivated on general settings.
* [New] Added support for prepend SQL commands on object's definition.
* [New] Added zoom info popup that appears whenever the user changes the current zoom factor.
* [Change] Renamed the methods setCheckExpression and getCheckExpression methods to setExpression and getExpression because the expression is used either for check and exclude constraints.
* [Change] Renamed the attribute "condition" to "predicate" on index class.
* [Change] Improved the way SQL code is disabled/enabled on editing forms. User now is asked to apply the same disabling/enabling status to object's refereces.
* [Change] Minor size adjustment on SQL append dialog.
* [Change] Changed the order of the tabs on user-defined type editing form.
* [Change] Minor appearance improvement on textbox editing form.
* [Fix] Made visible the field related to predicate expression on exclude constraint editing form.
* [Fix] Added reference checking between an exclude constraint and operators.
* [Fix] Minor fix on copy operation that was not resetting the copied objects list if the user clicked several times the "copy" command without paste.
* [Fix] Minor fix on the model object widget when disabling the controls.
* [Fix] Minor fix on ModelWidget::createSequenceForColumn() operation. The generated sequence is now correctly assigned to the column.
* [Fix] Minor fix on pgModeler command line interface menu text.
* [Fix] Minor fix on permission.dtd file. Attribute "index" was incorreclty marked as required when its optinal.
* [Fix] Minor fix on semantics of one-to-one relationship. When one of the tables are of mandatory participation the foreign key columns must not accept null values.
* [Fix] Minor fix on Windows and Linux deployment scripts.
v0.7.2-alpha
------
Codename: Brave Mastodon
Release date: May 06, 2014
* [New] Added a basic routine to check if there is some new version available on pgModeler site.
* [Change] Custom indexes for columns and constraints added by relationships are now stored on tables. In previous version the relationship was the responsible for that but this approach was provoking the bug related on issue 449.
* [Change] Remove unused parser attributes and commented old code.
* [Change] Removed attributes and methods from relationship which were responsible to control columns, attributes and constraints indexes.
* [Fix] Fixed a bug that was changing the columns positions whenever a relationship was edited on the model.
* [Fix] Minor fix when generate the string that denotes the assigned constraints to a column.
* [Fix] Minor fix on function editing form when handling the result table columns. The variadic field is disabled on the parameter form.
* [Fix] Fixed a crash when removing a view linked to tables.
* [Fix] Minor fix on view reference code generation.
* [Fix] Minor editing form size adjustments.
* [Fix] Minor compilation fix on Windows system.
v0.7.1
------
Codename: Brave Mastodon
Release date: April 15, 2014
* [New] Added option to invert panning mode and range selection triggers.
* [New] Added support for use relationship attributes as special primary keys.
* [Change] Improvement on unique name generation for columns and constraints when connecting relatioships.
* [Change] Improvement on copy / paste operations.
* [Change] Minor workaround in order to try to fix the crash due to thread conflict mainly on Windows system.
* [Fix] Minor fix on custom columns positioning.
* [Fix] Input and output files are now correctly escaped on the model fix form and the process works fine.
v0.7.1-beta1
------
Codename: Brave Mastodon
Release date: April 8, 2014
* [Change] Minor change on project's description text on about dialog.
* [Fix] Workaround for the slow editing of function's definition. Disabled the automatic syntax highlighting.
* [Fix] Minor fix on reverse engineering process. In some cases the process was aborted due to duplication of relationships caused by an incorreclty name generation for this kind of object.
* [Fix] Minor fix on model objects widget when changing the visible object types.
* [Fix] Fixed the conflict with panning mode and graphical object addition operation.
* [Fix] Fixed a regression introduced by 0.7.1-beta on model fix process.
v0.7.1-beta
------
Codename: Brave Mastodon
Release date: April 6, 2014
* [New] Created a small interface to pgmodeler-cli that enables the user to fix a broken model inside pgModeler GUI.
* [New] Added support for assign a sequence as default value of a column. The sequence will be converted to "nextval('seqname'::regclass) and the validation process will check if the sequence is correctly referenced by the table that owns the column.
* [Change] Changed the default behavior of left click on blank areas of canvas. Instead of create a range selection the user will move the viewport (panning mode). To enable range selection user must press SHIFT and click/move to draw the selection rectangle.
* [Fix] Minor fix on connection class in order to accept empty passwords as well passwords that contains spaces.
* [Fix] Fixed the column listing on constraint editing form after remove one or more columns.
* [Fix] Fix a crash when canceling the model saving dialog on Windows.
* [Fix] Minor patch on the model fix process.
* [Fix] Fixed wrong default values for relationship added columns.
* [Fix] Fixed a bug related to file paths with ampersand on config files.
* [Fix] Fix the broken sql for inheritance when a child table don't have columns but only constraints.
v0.7.1-alpha1
------
Codename: Brave Mastodon
Release date: March 29, 2014
* [Change] Major model validation improvement. Now special objects are correctly validated.
* [Fix] Fixed a crash when closing a model that contains a view that references columns added by relationships.
* [Fix] Fixed wrong working directory handling on CLI.
* [Fix] Fixed a bug on file loading process that could left behind some objects depending on size and arrange of the loaded model.
* [Fix] Fixed the undesired behavior when moving a table to another schema.
v0.7.1-alpha
------
Codename: Brave Mastodon
Release date: March 21, 2014
* [Fix] Fixed connection config. Empty passwords are now accepted.
* [Fix] Fixed schema object code generation.
* [Fix] Fixed the usage of PGMODELER_SCHEMAS_DIR environment variable on import process.
* [Fix] Fixed "ALTER ... SET OWNER" DDL for materialized views.
* [Fix] Fixed duplicated semicolon at end of permissions defintion.
v0.7.0
------
Codename: Brave Mastodon
Release date: February 25, 2014
* [New] Addded a catalog attribute "hide-postgres-db" in order to avoid listing "postgres" maintainance DB on import operations.
* [New] Added options to hide system/extension objects on SQL tool improving the object listing performance.
* [New] Added support for custom compilation output directory through qmake variables BINDIR, LIBDIR and RESDIR.
* [New] Added support for deferrable unique, exclude and primary key constraints.
* [New] Added support for custom colors on tables and views through tag objects.
* [New] Added support for export models to png image page by page.
* [New] Canvas can now be moved using Control + Arrow keys. If the shift is pressed the movement factor is increased.
* [New] Introduced the SQL tool that permits the execution of arbitrary SQL commands direclty on a server.
* [New] Added methods getType, getTypeId to BaseType and getSQLTypeName to PgSQLType as an alternative to call operators ~, ! and *.
* [New] Added a commented DROP command at start of each object definition (CREATE or ALTER TABLE ADD)
* [New] Added a "Code Preview" tab on permissions dialog.
* [New] Enabled SQL code visualization for FK relationships.
* [New] Added a build number on about dialog. This number is the compilation date in format yyyymmdd.
* [New] Added support for materialized and recursive views (PostgreSQL 9.3 feature).
* [New] Added pgModeler version information on generated sql scripts as well .dbm files for debugging purpose.
* [New] Added support for custom delete/update actions for relationship generated foreign keys.
* [New] Added support for move the canvas by positioning the mouse over corners.
* [New] Added a configuration parameter to control font style for any source code highlight field.
* [New] Added additional PostGiS types: geomval, addbandarg, rastbandarg, raster, reclassarg, unionarg, TopoGeometry, getfaceedges_returntype, validatetopology_returntype.
* [Change] Added support for on-demand updates on sql tool object's tree.
* [Change] Improved the tab navigation experience on editing forms.
* [Change] Minor change on SQL tool to ommit binary data values.
* [Change] Dropped the navigation through object using Alt + due to the difficulty to understand the order in which objects are highlighted.
* [Change] Minor change when generate .stacktrace file for crash handler to include pgModeler build number.
* [Change] Minor adjustments on DatabaseImportForm's import execution progress.
* [Change] Minor enhancements on operation list when removing last operations.
* [Change] Minor enhancements on table and relationship dialogs on error control flow.
* [Change] Changed Z-value for relationship labels in order to avoid that name labels don't overlaps the cardinality labels.
* [Change] Removed the translation installing from within plugin loading method at PluginsConfigWidget.
* [Change] The Application class constructor now loads at once all translation files available for the current language including language file for plugins.
* [Change] Minor changes on deploy scripts on all platforms. The parameter '-with-build-num' was introduced in order to generate a package with build number.
* [Change] Relationship dialog enhanced. Now participant tables are described in what role they make part.
* [Change] Minor improvement on model export process.
* [Change] Minor improvement on model validation widget.
* [Change] Minor improvement on crash handler report generation message. Full path to crash file is now shown.
* [Change] Improved the message displayed when user try to save an invalidated model.
* [Change] Minor adjustment on model export dialog size.
* [Change] Minor improvement on model overview widget.
* [Change] Minor adjustments on window title buttons for model export and database import forms.
* [Change] Improvement on connection config form. pgModeler now ask to save/update unsaved connection if the user forgot to.
* [Change] Minor update sql syntax highlighting configuration file.
* [Fix] Fixed bug that was permitting paste already formatted text (html) on source code input fields.
* [Fix] Fix broken range type generation.
* [Fix] The DELETE privilege is now correclty saved on model.
* [Fix] Fixed drop object command on SQL tool.
* [Fix] Fixed bug that was crashing pgModeler when a error was raised on view edit form.
* [Fix] Fixed a bug that was crashing the application when deleting relationship attributes or constraints.
* [Fix] Fixed bug related to the range selection weird behavior when finishing creating a object.
* [Fix] Minor fix on OperationList undo/redo methods to update types names on tables that references a modified type.
* [Fix] Minor fix on View assignment operator to correctly rename the type associated with "this" object.
* [Fix] Minor fix on DatabaseModel to correctly return the references to a view type.
* [Fix] Fixed bug that was causing indexes/triggers that references columns added by relationship have the sql code generated twice.
* [Fix] Minor fix on ResultSet class to identify bytea columns.
* [Fix] Minor fix on CLI menu to add new export modes.
* [Fix] Fixed a crash dealing with duplicated columns on a table.
* [Fix] Fixed bug when deleting tables and fk relationships together.
* [Fix] Fix bug related to geometry type.
* [Fix] Minor fix on logical expressions evaluation on SchemaParser.
* [Fix] Minor fix on model export when showing the name of objects being exported.
* [Fix] Minor fix on list/view advanced objects of a relationship.
* [Fix] Minor fix on form resizing when showing the protected object alert.
* [Fix] Fixed a minor bug that was crashing pgModeler when visualizing many-to-many relationships.
* [Fix] Fixed some warnings triggered by clang compiler.
* [Fix] Fixed a crash when loading plugins on MacOSX.
* [Fix] Fixed the issue related to import roles from database. pgModeler will not query pg_shadow anymore since this view is a very restricted object. Now role passwords will be imported as ***** (according to docs).
* [Fix] Fixed the object name validation. pgModeler now accepts spaces within names.
* [Fix] Fixed the function editing form resizing.
* [Fix] Fixed a bug that was not loading "sql disabled" state for relationships.
* [Fix] Fixed incorrect behavior of "Zoom In" action on MacOSX.
* [Fix] Trying to fix the infinite loop of the Validation confirm dialog on Windows (more tests needed).
v0.6.2
------
Codename: Daring Mammoth
Release date: December 20, 2013
* [Change] Update Qt version to 5.2.0 on build scripts (Windows only).
* [Change] Linux binaries are now bundled with all needed Qt libs.
* [Change] Important change on the way that special primary keys are created for generalization/copy relationships. Now there is the need to create the relationship first, close the dialog and open it again in order to generate the columns that will be used on the primary key.
* [Fix] Fixed a bug on model loading and relationship validation that was causing pgModeler to ignore some special objects (constraints referencing columns generated by relationships).
* [Fix] Workaround done on the sql append widget when handle a lot of code avoiding slowdowns on the syntax highlighting.
* [Fix] Fixed the incorrect creation of foreign keys on many-to-many relationships.
* [Fix] Fixed the conversion of self many-to-many relationships.
* [Fix] Fixed a bug that was causing some constraints to be destroyed when the relationship was connected to the table that owned the constraint.
* [Fix] Comments that contains apostrophes now are correctly escaped in order to avoid SQL related errors.
* [Fix] Fixed the incorrect generation of SQL code of check constraint associated to many-to-many relationshps.
* [Fix] Minor fix on crash handler when trying to read an stack trace file that doesn't exists.
* [Fix] Minor typos fixes on CLI menu.
* [Fix] Minor fix on the about form positioning.
v0.6.2-beta
------
Codename: Daring Mammoth
Release date: November 29, 2013
* [New] Added an option to drop database before a export process.
* [New] Disabling SQL code now disables the code of all referrer and child objects (experimental!).
* [New] Added support for columns to reference "table types".
* [Change] Object names are trimmed on editing forms to avoid unnecessary error triggering.
* [Change] Minor improvement on crash handler form.
* [Change] Minor change on SQL validation message.
* [Change] Minor improvement on operation list.
* [Fix] Fixed a crash when adding foreign keys to a new table.
* [Fix] Fixed the import of foreign key constraints from PostgreSQL 9.3.
* [Fix] Fixed the creation of fk relationships when the involved tables has too long names. pgModeler no more complains about "already existent object".
* [Fix] Minor fix when showing self fk relationships.
* [Fix] Minor fix on pgmodeler-cli: working directory is now set correctly.
* [Fix] Minor fix when retrieving advanced (generated) objects from relationships.
* [Fix] Fixed a bug that was not properly removing table objects when the user was canceling the table's editing.
v0.6.1
------
Codename: Daring Mammoth
Release date: November 3, 2013
* [New] PostgreSQL version 9.3 activated on code base. Now import and export operations works with this new version.
* [Change] Changed the way inheritance is created. Now the INHERIT command is appended in the table's definition.
* [Change] Update on model validation. Generalization and copy relationships have the participant tables' id's validated in order to check reference breaking.
* [Change] Version info upgraded on MacOSX app bundle configuration file (Info.plist).
* [Change] Minor change on "pgmodeler.vars". Included environment variables for custom Qt installation.
* [Fix] Fixed a bug related to INSTEAD OF/ON UPDATE triggers on views.
* [Fix] Fixed a bug related to incorrectly error raised when setting a owner table in the same schema as the sequece.
* [Fix] Fixed a bug related to importing sequences which name has uppercase characters.
* [Fix] Fixed misspelled "Connetion" word on configuration form.
* [Fix] Typos correction on model validation message box.
* [Fix] Fixed incorrect objects removal after cancel the edition.
* [Fix] Minor fix on disconnection of generalization relationships.
* [Fix] Minor fix on updating table's graphical representation when importing primary keys.
* [Fix] Minor change when displaying the columns' types on table/relationship editing form.
* [Fix] Fixed the compilation process on MacOSX 10.9 (Mavericks).
* [Fix] Minor change on macdeploy.sh to use Qt5.2-beta by default.
v0.6.0
------
Codename: Daring Mammoth
Release date: September 30, 2013
* [New] Added a validation when removing protected FK relationships.
* [New] Added a progress info (at bottom widgets bar) for temporary model saving.
* [New] User can now restore the last session via File > Restore Session. Sessions will not be restored at startup anymore.
* [New] Added a "zoom" option when exporting to PNG image.
* [Change] Disabled the model loading via command line on MacOSX due to bundle particularities.
* [Change] Remove option "Save session" from general config widget.
* [Change] Improved the way schema's children objects are selected/unselected.
* [Change] Improved the printing operation. Now custom paper size has a separated field to assign it's coordinates.
* [Change] The import errors now are written on a log file when "ignore import errors" is checked.
* [Fix] Fixed an inconsistence when removing a table before the fk relationship linked to it. From now on (to avoid crashes) user must remove the relationship first and then remove the table.
* [Fix] Fixed a minor bug on column's graphical representation that was incorrectly configuring the column descriptor for self-relationship fk's.
* [Fix] Minor fix on model overview widget when showing large models.
* [Fix] Fixed bug on pgmodeler-cli that was generating errors when running it outside the executable's directory.
* [Fix] Fixed the calculation of pages to be printed.
* [Fix] Fixed the type enumeration validation to accept space on the names.
* [Fix] Minor fix for GiS types. Spatial auxiliary type name can null.
* [Fix] Minor pgmodeler-cli typos corrections.
* [Fix] Fixed a bug related to XMLParser and threads that was crashing pgModeler on Windows.
* [Fix] Fixes on DatabaseImportHelper to correctly handle extension created types.
* [Fix] Minor fix on PgSQLType::parseString() when creating datatypes from strings.
v0.6.0-beta
------
Codename: Daring Mammoth
Release date: September 16, 2013
* [New] Added experimental reverse engineering support.
* [New] Added an experimental option --fix-model to pgmodeler-cli to permit the user to fix the structure of an older model (generated in pgModeler < 0.6.0) or a corrupted file.
* [New] Added an option to debug the import process printing any generated code to stdout.
* [New] Added support for bidirectinal FK relationships.
* [New] Added a statement "SET search_path [schemas]" on database model SQL code.
* [New] Added missing PostgreSQL built-in types.
* [New] Configured connections now can be duplicated in order to reuse it's attributes.
* [Change] Minor change on main compilation script. The subproject "tests" are included only when compiling in debug mode.
* [Change] Major change on validation widget. Fixes are now applied using a thread and can be aborted any time user want.
* [Change] Change on model saving process. pgModeler will not deny to save invalidated anymore. Now it will ask the user to validate the model or save an invalidate one anyway.
* [Change] Changed the behavior of the operation list. In the first exception the entire list are emptied.
* [Change] Changed the way foreign keys are generated. They always will be generated at end of database definition to avoid reference breaking.
* [Change] Minor improvements on model code generation and copy operations.
* [Change] Removed deprecated "rtree" indexing type.
* [Fix] Minor fixes on PgSQLType class. User types aren`t removed instead they are deactivated to avoid reference breaking.
* [Fix] Minor fix on selecting the children objects of a schema.
* [Fix] Minor fixes on scene and relationship avoiding crashes when destroying the whole graphical scene.
* [Fix] Fixed bug on deleting self relationships.
* [Fix] Minor fix on model export process. The last line of the SQL code now is correctly extracted and executed.
* [Fix] Minor fix on sequence class to accept owner.
* [Fix] Minor fixes on the splash screen control code.
* [Fix] Fixed a bug that was crashing pgModeler at startup.
* [Fix] Fixed a bug that was causing pgModeler to crash when loading operators which name contained '&' char.
* [Fix] Fixed bug related to sequence values assignment.
* [Fix] Fixed "Operation with not allocated object" error on applying validation fixes.
* [Fix] Fixed relationship label position saving.
* [Fix] Minor fix on main window. pgModeler now is not closed while the validation is running.
v0.6.0-alpha1
------
Codename: Daring Mammoth
Release date: August 05, 2013
* [New] Added catalog query for triggers.
* [New] Added catalog query for rules.
* [New] Added indexing method to exclude constraint.
* [New] Added catalog query for constraints.
* [New] Added catalog queries for tables and columns
* [New] Added catalog queries for view, domain, sequence and user defined types.
* [New] Added catalog query for collation.
* [New] Added catalog query for operator family.
* [New] Added catalog query for operator class.
* [New] Object dependencies form now can list indirect dependencies.
* [New] Added an environment variable to set a different location for crash handler executable.
* [New] Objects that has SQL disabled now is shown with name striked out.
* [Change] Minor change on MainWindow::closeEvent()
* [Change] Moved app_style variable to GlobalAttributes::DEFAULT_QT_STYLE.
* [Change] Minor improvement on Exception::getExceptionsText method.
* [Change] Improvements on copy/paste operations.
* [Change] Removed unused linker parameters.
* [Change] Crash handler executable renamed to "pgmodeler-ch".
* [Fix] Fixed possible leak when destroying a ModelWidget instance. Objects from scene were not being deleted correclty. Fix tests in progress.
* [Fix] Fixed the "Save current session" option on GeneralConfigWidget that wasn't doing it's job correctly.
* [Fix] Fixed a bug that was crashing pgModeler at startup when restoring previous sessions or temporary models.
* [Fix] Minor fix on trigger code generation.
* [Fix] Fixed incorrect loading of multiple triggers/rules on views.
* [Fix] Minor fix on model validation. Operator classes are now checked during the validation process.
* [Fix] Fixed generation of constraints in form of ALTER command. In some cases the constraint code wasn't appended to table's definition.
* [Fix] Minor fixes on cast object.
* [Fix] Minor fixes on databasemodel on retrieving dependencies/references for objects.
* [Fix] Fixed crash handler path variable on MacOSX.
v0.6.0-alpha
------
Codename: Daring Mammoth
Release date: July 19, 2013
* [New] Added the widget to swap objects IDs on model validation form.
* [New] Added indexing type "spgist" to IndexingType class.
* [New] Model validation and export now works with threads.
* [New] Functions now have a "leak proof" attribute.
* [New] VARIADIC key attribute added to function parameters.
* [New] User now can completely disabled UI stylesheets by calling executable with param "-no-stylesheet".
* [New] Added the class Catalog to handle the basis of reverse engineering by reading the pgcatalog/information_schema.
* [New] System tablespaces pg_global and pg_default are now automatically created as new models are added.
* [Change] Minor change on schema area selection. The entire schema area and children can be selected (and moved) by using "Select children" action or SHIFT + left-click.
* [Change] Improved the transition between opened models. The problem was solved putting the temporary models saving in a separated thread.
* [Change] Minor improvement on model restoration operation. Models that fails to be restored can be kept so the user can try to fix them manually (until pgModeler is closed).
* [Change] Minor adjustments on model loading progress.
* [Change] Minor chages on model export form. Export to DBMS is the default option.
* [Change] Minor improvements on pgmodeler-cli. Added "--simulate" option to export dbms.
* [Change] Disabled notice output to console for Connection class. User can re-enable it by calling Connection::setNoticeEnabled() [recompile source needed].
* [Change] Minor changes on PgSQL base types. "[NO] LEAKPROOF" removed from FunctionType class.
* [Change] Minor improvements on SchemaParser, now its possible to make parser ignore empty attributes.
* [Change] libdbconnect renamed to libpgconnector for semantics reasons.
* [Change] Minor improvements on CrashHandler. Added buttons to load report and save embedded model when in analysis mode.
* [Fix] Minor fix on linuxdeploy.sh script related to grep command execution.
* [Fix] Fixed some leaks when destroying objects that are registered as PgSQLType (table, sequence, extension, domain, view, type). Now these type are correctly remove from user type listing.
* [Fix] Fixed bad sql code generation when disabling sql of columns/constraints.
* [Fix] Fixed dependency retrieving for operator classes.
* [Fix] Fixed incorrect reference to "replicate" option on Roles.
* [Fix] Fixed the "ignore duplicity" bug for columns when exporting model.
* [Fix] Fixed library build order now libpgmodeler is built before libpgconnector.
* [Fix] Minor fix on UI stylesheet related tooltips when using Fusion theme.
* [Fix] Fixed the assignment of LC_COLLATE, LC_CTYPE and template db to database instance on DatabaseWidget.
v0.5.2
------
Codename: Lovely Duda
Release date: June 27, 2013
* [New] User now can append free SQL commands to database objects via "Append SQL" command.
* [New] Introduced an experimental code completion on fields that permits code input.
* [New] User can create default sequences from serial columns. This feature does not apply to columns generated by relationships.
* [New] Introduced a feature to break relationship lines in straight angles and to remove all user added points.
* [New] Added support for change font size on textboxes.
* [Change] Removed the code "OIDs=FALSE" from table's SQL.
* [Fix] Minor fix on Mac OSX deployment script.
v0.5.1_r1
---------
Codename: Lovely Duda
Release date: June 13, 2013
* [New] Added deployment scripts on all platforms to compile and pack pgModeler. Note: On Windows the script must run on GNU environment port like Cygwin or MingW.
* [New] Added an special field to columns to easily identify which relationship generated it. (only for columns added by relationship)
* [Change] Model overview widget is now shown always stay on top.
* [Change] Minor improvements on syntax highlighter.
* [Change] Improvements on model validation widget. Output panel now shows the currently validated object (SQL validation).
* [Fix] Removed from user defined type DTD the mandatory use of collation object.
* [Fix] Collation's SQL generation corrected. Encoding is appended to LOCALE keyword.
* [Fix] Corrected the wrongly used COLLATION keyword on user defined type.
* [Fix] Corrected a bug that was crashing pgModeler when selecting relationship created objects on object finder result list.
* [Fix] Extension object naming corrected.
* [Fix] Extension object removal corrected.
* [Fix] Corrected a bug on CLI that was not finding dependencies paths correctly.
* [Fix] Minor fix on task progress widget on MacOSX.
* [Fix] Splash screen corrected on MacOSX
* [Fix] Corrected a bug on relationships that was crashing pgModeler when specifying column name pattern.
v0.5.1
------
Codename: Lovely Duda
Release date: June 1, 2013
* [New] Code base ported to C++11 and Qt5.
* [New] MacOSX compilation now generates an application bundle: pgmodeler.app
* [New] pgModeler is now capable of associate dbm files to its executable being possible opening a model from file manager by clicking it (except for MacOSX, see MacOSX notes).
* [New] Added support for loading models by calling pgModeler gui executable from terminal (e.g. pgmodeler model1.dbm model2.dbm)
* [New] pgModeler logo redesign.
* [New] Added special primary keys support for one-to-one and one-to-many relationships.
* [New] Relationships now supports patterns to define generated objects names. The manual suffix and auto-suffix generation are deprecated.
* [New] Columns/constraints generated by relationship can have position changed on parent table.
* [New] Added smallserial built-in datatype.
* [Change] Improvements on model validation tool. pgModeler will not save the model while isn't completely validated.
* [Fix] minor fix on point insertion on relationships.
* [Fix] Corrected the wrongly displayed interval fields.
* [Fix] Corrected self relationship validation.
* [Fix] Corrected a bug on editing numeric data types.
* [Fix] Minor fixes on build scripts (All platforms).
* [Fix] Added the missing directive CONFIG+=console to main-cli.pro
* [Fix] Minor fixes on task progress exhibition on quick tasks.
* [Fix] pgmodeler-cli output fixed on Windows system.
* [Fix] Table inheritance now copies columns with NOT NULL attribute correclty configured.
* [Fix] Plugin build scripts fixed. Now generated libraries are correctly copied to build directory.
* [Fix] Editing a column with 'numeric' datatype does not generate errors anymore.
v0.5.0
------
Release date: May 17, 2013
* [New] Complete main window restyling.
* [New] Added a model validation tool to prevent reference break and name conflicts.
* [New] Added an object navigation using keyboard on model widget. Pressing Alt + [left|right] keys will switch between graphical objects.
* [New] Introduced the pgmodeler-cli. A command line tool to handle model export without loading the graphical interface.
* [New] Added an option to list available configured connections on pgmodeler-cli.
* [New] pgModeler now alerts the user when he try to save an invalidated model.
* [New] pgModeler now aborts app closing when the user wants to do a last saving on modified models.
* [New] Added support for hide relationship labels and table extended attributes on configuration dialog.
* [New] Added "Recent Models" menu.
* [New] Introduced the Xml2Object plugin to help on develpment testings.
* [New] Added partial support for PostgreSQL Extensions objects.
* [New] Added JSON datatype.
* [New] Added support for rules and trigger on views.
* [New] Added support for user defined range types.
* [New] Added support for collations on composite types (user defined).
* [New] Added built-in range types.
* [New] Added support for INCLUDING/EXCLUDING options when dealing with copy relationships.
* [New] Added support for EXCLUDE constraint support
* [New] Added NO INHERIT option to check constraints.
* [New] Added REPLICATION option to roles.
* [New] Added FOR ORDER BY option and removed Recheck from OperatorClassElement.
* [New] Added collation support for index elements.
* [New] Added [NOT] LEAKPROOF key word to functions.
* [New] Added collation attribute to domains.
* [New] Required fields are now highlighted on editing forms.
* [New] pgModeler creates system objects (e.g, public schema and SQL, C, plpgsql languages) when adding a new model.
* [Change] Minor improvements on when showing Views.
* [Change] Relationship points are moved when the parent relationship is being moved together with other objects.
* [Change] Simplified the model loading operation. pgModeler will not try to recreate objects with unsatisfied dependencies instead errors will be raised.
* [Change] Minor changes on FK relationship creation.
* [Change] User-added foreign-keys had code generation changed.
* [Change] Minor improvements on PgModelerPlugin structure.
* [Change] DummyPlugin renamed to Dummy.
* [Change] Improvements on building process for all supported systems.
* [Change] Removed "Save widget positions" from configuration form.
* [Change] Removed fullscreen mode from main window.
* [Change] Removed unused/deprecated error messages.
* [Change] Removed deprecated files COMPILING.md and PLUGINS.md.
* [Change] Subproject libutil was renamed to libutils due to some conflicts on Linux systems.
* [Change] Startup scripts removed. Since the environment variables are set by the installer on Windows and for Unix the variables are set using the new pgmodeler.sh script.
* [Change] "Disable SQL code" option added for all types of objects. Except for textboxes and base relationships (view-table relatioships and fk relationships).
* [Change] Fixed permissions for views.
* [Change] PostgreSQL 8.x support completely removed.
* [Change] Schema files (for SQL code) aren't organized in folders anymore. All code (for different PostgreSQL versions) will be in the same .sch file for each object.
* [Change] Spatial types had SRID digit count upgraded to 5.
* [Change] One-to-one relationships now generates unique names for UNIQUE constraints.
* [Change] Several class improvements, performance tunings and forms readjustments.
* [Fix] Minor fixes on connection configuration form.
* [Fix] Corrected a bug that was crashing pgModeler when adding new schemas.
* [Fix] Corrected a bug that was crashing pgModeler when validation model.
* [Fix] Corrected a bug that was preventing the popup menu to be configured correctly on model widget.
* [Fix] Menu bar style correctly applied on Windows system.
* [Fix] Now relationship labels' position are restored when loading the model file.
* [Fix] Minor fixes on database model code generation.
* [Fix] Corrected the glicthy wheel scroll/zoom on model widget.
* [Fix] Corrected the visual update of schema's rectangle when adding a column on a child table.
* [Fix] Corrected a bug that was preventing a new model to be saved correctly.
* [Fix] Minor fixes on model widget copy/paste operations.
* [Fix] Models now are correclty auto saved when modified.
* [Fix] Corrected operator's signature generation.
* [Fix] Corrected a bug on textbox with unicode texts.
* [Fix] Index and Rule editing forms now handles correctly unicode expressions.
* [Fix] Corrected a bug that was avoiding the name "remembering" during relationship loading.
v0.4.1_r1
---------
Release date: March 19, 2013
* [Change] user can now prepend a CTE (commom table expression, a.k.a "with queries") on view's definition.
* [Change] user can now create a single reference containing a expression that defines the entire view.
* [Change] improvements on permissions, user now can control GRANTs and REVOKEs via permission editing form.
* [Fix] fixed invalid UTF-8 chars on function definition.
* [Fix] fixed unavailable "nocreatedb" role option.
v0.4.1
------
Release date: March 16, 2013
* [New] introduced the "Disable SQL code" option for roles/tablespaces.
* [New] user now can add objects by right-clicking group items on "Model Objects" dockwidget tree.
* [New] added the abbreviation for time and timesptamp data types both with timezone: timetz and timestamptz.
* [New] introduced a object highlight action on "model objects" dockwidget.
* [Change] major changes on SQL code generation/export. Introduced a token to help export process to identify the end of each DDL command.
* [Change] minor improvements on role editing form.
* [Change] when generationg XML code empty tags that stores pure texts are now created with a tag in order to avoid malformed xml code.
* [Change] index FASTUPDATE and FILLFACTOR params is now activated according the indexing type.
* [Change] index fill factor now is optional.
* [Change] chinese, portuguese and french translations update.
* [Fix] pgModeler no longer crash when in error state (showing an exception) and try to auto save the models.
* [Fix] minor size adjustments on forms.
* [Fix] corrected a bug related to one-to-many relationship validation (endless looping) when changing to automatic suffix generation.
* [Fix] corrected the "apply button disabled" bug on constraint edit form.
* [Fix] IN/OUT keywords now appears on functions signature.
* [Fix] corrected translation bypassing on index edit form.
* [Fix] pgModeler no longer crash when triggering the print action.
* [Fix] triggers no longer complains about assigning a function without parameters.
* [Fix] corrected the loading process for indexes.
* [Fix] corrected some bugs related to GiST and index sorting.
* [Fix] minor fix on quick rename action when renaming a column with primary key.
* [Fix] corrected a bug that was causing pgModeler to complain about duplicated elements when loading indexes.
* [Fix] corrected a bug related to main window title when save a model with a different filename.
* [Fix] fixed a bug related reload a model file after editing a foreign key.
* [Fix] corrected a bug related to invalid chars at task progress.
v0.4.0_r1
---------
Release date: March 04, 2013
* [New] introducing the "pgModeler Wiki" as the main project's support resource.
* [Fix] when main windows is closed the overview widget is closed too.
* [Fix] corrected a bug on operation list widget that was converting an item name to UTF-8 twice.
v0.4.0
------
Release date: February 27, 2013
* [New] introduce a "New object" submenu when activating the schema context menu (right-click)
* [New] tables and view are now graphically separated by colored rectangles representing its schemas.
* [New] compiling pgModeler now works perfectly on Mac OSX system.
* [New] introduced the 'Quick actions' menu that permits: rename, move to another schema, change onwer and edit permissions.
* [New] the relationship editing form gained an "advanced" tab which shows the objects generated and/or represents the relatioship itself.
* [New] the user now can add relationships only creating foreign keys on tables (fk relationships).
* [New] added a french UI translation (provided by [toorpy](https://github.com/toorpy)).
* [Change] all relationships type are now grouped together on "Model objects" widget.
* [Change] chinese UI translation updated (provided by: [Bumanji](https://github.com/Bumanji)).
* [Change] user now can remove fk relationships directly without needing to remove the related foreign keys.
* [Change] field semantics adjustments on relationship editing form.
* [Change] graphical object can be now selected and have the context menu activated only with a single right-click.
* [Change] minor improvements on plugin base class: PgModelerPlugin.
* [Change] widget size adjustments to better showing on Mac OSX system.
* [Change] crashhandler now shows the compiled and running versions of Qt.
* [Change] french UI translation reviewed and updated (provided by [babs](https://github.com/babs)).
* [Change] 'Objects of Model' when used as object picker now expand all the nodes by default.
* [Change] 'Objects of Model' now memorizes the tree state when update an object and / or opening another model.
* [Change] PostGiS 'geometry' type can have a free assigned SRID value.
* [Change] editing forms when shown set the focus on the first field, generally, the object name.
* [Change] 'Objects of Model' widget displays the nodes in alphabetical order.
* [Change] the printing options for the model were moved to the general configuration form.
* [Change] relationship validation method now removes fk relationships when the foreign keys that gerenates is no longer exists.
* [Change] copy/cut/delete commands does not manipulates system objects like schema public and languages C, SQL and plpgsql.
* [Change] pgModeler startup scripts are now path location free meaning that software can be installed where the user desires.
* [Fix] corrected a bug related constraint name on domain XML code generation.
* [Fix] corrected a bug that was causing crash when click "Apply" on Type editing form with fields not filled.
* [Fix] corrected the "invalid constraint name" error on domain editing form.
* [Fix] corrected the empty DEFAULT clause for columns, types and domains.
* [Fix] corrected a bug related to incorrectly initialized OID attribute when creating tables.
* [Fix] corrected a bug when creating a view with WHERE statement.
* [Fix] corrected a bug related to one-to-many relationships semantics.
* [Fix] corrected some bugs that was causing crash when removing all operations from operation list.
* [Fix] minor bug fixes related to object selection over the model.
* [Fix] corrected a bug on load model dialog filter (chinese UI only).
* [Fix] pgModeler no longer crash when editing objects style.
* [Fix] corrected bug that was deleting two sequeces at once.
* [Fix] pgModeler no longer crash when removing (disconnecting) relationship that has special primary keys.
* [Fix] minor fixes on the startup scripts on all platforms.
* [Fix] corrected an incorrect reference to output stream on Windows system.
* [Fix] shortcuts and popup menu now works correctly when selection an object on 'Objects of Model' tree.
* [Fix] the pgsql base types (represented by tables, sequences, user defined types and domains) are now updated correctly when the related schema is renamed.
* [Fix] corrected some weird SRID value on non spatial types.
* [Fix] corrected bug on objects table when move rows to last / first.
* [Fix] typos corrections on some error messages and dialog titles.
* [Fix] 'referenced columns' combobox on constraint editing form are filled correctly when the dialog is shown in a second time.
* [Fix] pgModeler no longer crash when creating many-to-many relationships.
* [Fix] pgModeler no longer crash when the user activates the print dialog.
* [Fix] corrected bug that was removing fk relationships when pasting objects.
* [Fix] corrected SQL syntax error of 'timestamp with time zone'.
* [Fix] corrected constraint type showing on editing form.
* [Fix] corrected bug on cyrillic typed enums and check constraints expressions.
* [Fix] corrected bug on enumeration type editing form.
* [Fix] corrected bug on 'truncate' table privilege code generation.
* [Fix] corrected column default value code generation.
* [Fix] dummyplugin build process corrected on Windows.
* [Fix] corrected bug on column comment code generation.
* [Fix] corrected bug that was deleting two tables at once.
v0.3.4
------
Release date: October 17, 2012
* [New] added chinese UI translation (provided by [gjunming](https://github.com/gjunming)).
* [New] added basic support for PostGiS 2.0 only data types: box2d, box3d, geometry and geography (suggested by [george-silva](https://github.com/george-silva) on [issue#28](https://github.com/pgmodeler/pgmodeler/issues/28))(EXPERIMENTAL). Note: when using these data types make sure that PostGiS extension is installed on database cluster since pgModeler WILL NOT install it automatically or generate the command to do it!
* [New] added a model restoration feature to reopen models after unexpected quit (crash).
* [New] added a crash handler to pgModeler. Now signal SIGSEGV is trapped (in most cases) and the crash handler pops up permiting the user to generate an error report. (EXPERIMENTAL)
* [New] to facilitate the error reporting exceptions stack now can be showed in text format. Users can post the complete error stack when creating an issue.
* [New] icon added to pgModeler executable (Windows only)
* [Change] update on pt_BR translation file.
* [Change] removed "pgmodeler" prefix from translation files.
* [Change] added the field "Underline" on textbox editing form.
* [Fix] corrected the "AlwayOnTop" bug on model overview widget. ([issue#30](https://github.com/pgmodeler/pgmodeler/issues/30))
* [Fix] little fix on startup scripts. Corrected de PGMODELER_ROOT on both Linux and Windows systems. ([issue#29](https://github.com/pgmodeler/pgmodeler/issues/29))
* [Fix] corrected the referece to environment variables PGMODELER_*. Now pgModeler search for necessary paths on current directory if some of these variables are not set.
* [Fix] corrected the validation of UTF-8 names that have 3 bytes length.
* [Fix] corrected the sources path reference on project (.pro) files. Now lupdate command do not generates empty TS files.
* [Fix] corrected a bug that was causing crash where user try to edit protected objects.
* [Fix] corrected the exhibition of UTF-8 messages on ```throw``` statements.
v0.3.3
------
Release date: October 09, 2012
* [Change] pgModeler license were update to GPLv3.
* [Change] Error massages and entire UI were translated to en_US. Now people can contribute more easily with translation files. [(issue#8)](https://github.com/pgmodeler/pgmodeler/issues/8)
* [Change] The left side image were removed form all forms giving more space to show widgets.
* [Change] pgModeler now shows a messagebox at startup if any critical error is raised instead to show them on stdin.
* [Fix] Translation files now are correctly loaded depending on system language. [(issue#23)](https://github.com/pgmodeler/pgmodeler/issues/23)
* [Fix] Compilation process and execution is working correctly on Windows system. [(issue#11)](https://github.com/pgmodeler/pgmodeler/issues/11)
* [Fix] No more crashes when dealing with relationships that have special triggers/indexes/columns. [(issue#8)](https://github.com/pgmodeler/pgmodeler/issues/8) [(issue#24)](https://github.com/pgmodeler/pgmodeler/issues/24)
v0.3.2
------
Release date: September 27, 2012
* [Change] The default extension for the models now stands for ".dbm" [(issue#9)](https://github.com/pgmodeler/pgmodeler/issues/9)
* [Change] Tables and sequences now can be used as function return type as well parameter type. This is valid for other objects that make use of base types (except for table columns).
* [Change] The relationship conversion command now need to be confirmed by the user.
* [Fix] Compilation process now works correctly on Windows system.
* [Fix] Adjusted the size of some forms to show their fields properly.
* [Fix] The "make distclean" command now make the correct cleanup on build/ directory.
* [Fix] Startup scripts "start-pgmodeler.(sh|bat)" where adjusted. To prevent errors pgModeler need to be started through these scripts.
* [Fix] Corrected the reference to the plugins directory. [(issue#7)](https://github.com/pgmodeler/pgmodeler/issues/7)
* [Fix] The action "New Object -> Tablespace" now is displayed properly.
v0.3.1
------
Release date: September 18, 2012
* [New] Relationships generates column suffixes automaticaly. This behavior can be changed on the relationship editing form.
* [New] Added two samples to pgModeler.
* [Change] Tables are now created with "With OIDs" attribute by default.
* [Change] The graphical update method on overview widget has improved preventing unecessary processing.
* [Fix] Class CenaObjetos now doesn't delete objects twice.
* [Fix] Eliminated bug that caused crashing on pgModeler when closing a model.
v0.3.0
------
Release date: September 12, 2012
* [New] Added a model overview widget.
* [New] Added export feature that generates PNG image of the models.
* [Fix] Corrected the naming of columns generated by many-to-many relationships.
* [Fix] Corrected generation of XML/SQL code by the model.
v0.2.0
------
Release date: August 31, 2012
* [New] Added an interface to implement third party plugins. Check [PLUGINS.md] (https://github.com/pgmodeler/pgmodeler/blob/master/PLUGINS.md) for details.
* [New] Added a short cut to easily control the zoom on the model. Use Crtl + Mouse wheel up (zoom up) or Crtl + Mouse wheel down (zoom down).
* [Change] Due to the plugin interface the compilation method changed back to the form of shared libraries + executable.
* [Fix] No more crashes when removing an primary-key of a table which has relationship with other tables. [(issue#2)](https://github.com/pgmodeler/pgmodeler/issues/2)
* [Fix] Adjusted the semantics of one-to-one relationships.
v0.1.2
------
Release date: August 24, 2012
* [New] Added a functionality to save modified models before closing the software.
* [Change] Updated the en_US dictionary with the texts of the above functionality.
* [Fix] Dockwidgets no longer disappear unexpectedly when the main window is minimized.
* [Fix] Operations performed before creating a table object (column, constraint, trigger, index, rule) are no longer removed when any exception is thrown in the creation of these object.
* [Fix] Fixed bug that caused user-defined types had wrong SQL/XML code generated by the model.
* [Fix] Functions and Types received an own range of id in order to create these objects in a correct way.
* [Fix] Eliminated segmentation faults caused by the destruction of relationships which possessed attributes/constraints.
* [Fix] Adjusted the translation to SQL code of one-to-one relationships.
* [Fix] Eliminated segmentation fault when editing relationships and/or undoing an operation involving a relationship.
* [Fix] Identifiers relationships now correctly display the thick line beside the weak entity.
v0.1.1
------
Release date: August 14, 2012
* [Fix] Correction of the actions for inserting graphic objects (table, text box, vision and relationship) in Windows environment.
* [Fix] Correction on the display of the maximize button in the window decoration in Windows environment.
* [Fix] Adjust on the position and spacing of widgets in editing forms.
* [Fix] The XML parser can now correctly read DTD files in Windows environment.
* [Fix] The compilation method is no longer in the form of shared libraries + executable and passed to be as standalone executable only.
v0.1.0
------
Release date: August 9, 2012
* First pgModeler release.
pgmodeler-0.9.4/CODE_OF_CONDUCT.md 0000664 0000000 0000000 00000006430 14160100006 0016270 0 ustar 00root root 0000000 0000000 # Contributor Covenant Code of Conduct
## Our Pledge
In the interest of fostering an open and welcoming environment, we as
contributors and maintainers pledge to making participation in our project and
our community a harassment-free experience for everyone, regardless of age, body
size, disability, ethnicity, sex characteristics, gender identity and expression,
level of experience, education, socio-economic status, nationality, personal
appearance, race, religion, or sexual identity and orientation.
## Our Standards
Examples of behavior that contributes to creating a positive environment
include:
* Using welcoming and inclusive language
* Being respectful of differing viewpoints and experiences
* Gracefully accepting constructive criticism
* Focusing on what is best for the community
* Showing empathy towards other community members
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery and unwelcome sexual attention or
advances
* Trolling, insulting/derogatory comments, and personal or political attacks
* Public or private harassment
* Publishing others' private information, such as a physical or electronic
address, without explicit permission
* Other conduct which could reasonably be considered inappropriate in a
professional setting
## Our Responsibilities
Project maintainers are responsible for clarifying the standards of acceptable
behavior and are expected to take appropriate and fair corrective action in
response to any instances of unacceptable behavior.
Project maintainers have the right and responsibility to remove, edit, or
reject comments, commits, code, wiki edits, issues, and other contributions
that are not aligned to this Code of Conduct, or to ban temporarily or
permanently any contributor for other behaviors that they deem inappropriate,
threatening, offensive, or harmful.
## Scope
This Code of Conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community. Examples of
representing a project or community include using an official project e-mail
address, posting via an official social media account, or acting as an appointed
representative at an online or offline event. Representation of a project may be
further defined and clarified by project maintainers.
## Enforcement
Instances of abusive, harassing, or otherwise unacceptable behavior may be
reported by contacting the project team at raphael@pgmodeler.io. All
complaints will be reviewed and investigated and will result in a response that
is deemed necessary and appropriate to the circumstances. The project team is
obligated to maintain confidentiality with regard to the reporter of an incident.
Further details of specific enforcement policies may be posted separately.
Project maintainers who do not follow or enforce the Code of Conduct in good
faith may face temporary or permanent repercussions as determined by other
members of the project's leadership.
## Attribution
This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4,
available at https://www.contributor-covenant.org/version/1/4/code-of-conduct.html
[homepage]: https://www.contributor-covenant.org
For answers to common questions about this code of conduct, see
https://www.contributor-covenant.org/faq
pgmodeler-0.9.4/LICENSE 0000664 0000000 0000000 00000104467 14160100006 0014507 0 ustar 00root root 0000000 0000000 GNU GENERAL PUBLIC LICENSE
Version 3, 29 June 2007
Copyright (C) 2007 Free Software Foundation, Inc.
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
Preamble
The GNU General Public License is a free, copyleft license for
software and other kinds of works.
The licenses for most software and other practical works are designed
to take away your freedom to share and change the works. By contrast,
the GNU General Public License is intended to guarantee your freedom to
share and change all versions of a program--to make sure it remains free
software for all its users. We, the Free Software Foundation, use the
GNU General Public License for most of our software; it applies also to
any other work released this way by its authors. You can apply it to
your programs, too.
When we speak of free software, we are referring to freedom, not
price. Our General Public Licenses are designed to make sure that you
have the freedom to distribute copies of free software (and charge for
them if you wish), that you receive source code or can get it if you
want it, that you can change the software or use pieces of it in new
free programs, and that you know you can do these things.
To protect your rights, we need to prevent others from denying you
these rights or asking you to surrender the rights. Therefore, you have
certain responsibilities if you distribute copies of the software, or if
you modify it: responsibilities to respect the freedom of others.
For example, if you distribute copies of such a program, whether
gratis or for a fee, you must pass on to the recipients the same
freedoms that you received. You must make sure that they, too, receive
or can get the source code. And you must show them these terms so they
know their rights.
Developers that use the GNU GPL protect your rights with two steps:
(1) assert copyright on the software, and (2) offer you this License
giving you legal permission to copy, distribute and/or modify it.
For the developers' and authors' protection, the GPL clearly explains
that there is no warranty for this free software. For both users' and
authors' sake, the GPL requires that modified versions be marked as
changed, so that their problems will not be attributed erroneously to
authors of previous versions.
Some devices are designed to deny users access to install or run
modified versions of the software inside them, although the manufacturer
can do so. This is fundamentally incompatible with the aim of
protecting users' freedom to change the software. The systematic
pattern of such abuse occurs in the area of products for individuals to
use, which is precisely where it is most unacceptable. Therefore, we
have designed this version of the GPL to prohibit the practice for those
products. If such problems arise substantially in other domains, we
stand ready to extend this provision to those domains in future versions
of the GPL, as needed to protect the freedom of users.
Finally, every program is threatened constantly by software patents.
States should not allow patents to restrict development and use of
software on general-purpose computers, but in those that do, we wish to
avoid the special danger that patents applied to a free program could
make it effectively proprietary. To prevent this, the GPL assures that
patents cannot be used to render the program non-free.
The precise terms and conditions for copying, distribution and
modification follow.
TERMS AND CONDITIONS
0. Definitions.
"This License" refers to version 3 of the GNU General Public License.
"Copyright" also means copyright-like laws that apply to other kinds of
works, such as semiconductor masks.
"The Program" refers to any copyrightable work licensed under this
License. Each licensee is addressed as "you". "Licensees" and
"recipients" may be individuals or organizations.
To "modify" a work means to copy from or adapt all or part of the work
in a fashion requiring copyright permission, other than the making of an
exact copy. The resulting work is called a "modified version" of the
earlier work or a work "based on" the earlier work.
A "covered work" means either the unmodified Program or a work based
on the Program.
To "propagate" a work means to do anything with it that, without
permission, would make you directly or secondarily liable for
infringement under applicable copyright law, except executing it on a
computer or modifying a private copy. Propagation includes copying,
distribution (with or without modification), making available to the
public, and in some countries other activities as well.
To "convey" a work means any kind of propagation that enables other
parties to make or receive copies. Mere interaction with a user through
a computer network, with no transfer of a copy, is not conveying.
An interactive user interface displays "Appropriate Legal Notices"
to the extent that it includes a convenient and prominently visible
feature that (1) displays an appropriate copyright notice, and (2)
tells the user that there is no warranty for the work (except to the
extent that warranties are provided), that licensees may convey the
work under this License, and how to view a copy of this License. If
the interface presents a list of user commands or options, such as a
menu, a prominent item in the list meets this criterion.
1. Source Code.
The "source code" for a work means the preferred form of the work
for making modifications to it. "Object code" means any non-source
form of a work.
A "Standard Interface" means an interface that either is an official
standard defined by a recognized standards body, or, in the case of
interfaces specified for a particular programming language, one that
is widely used among developers working in that language.
The "System Libraries" of an executable work include anything, other
than the work as a whole, that (a) is included in the normal form of
packaging a Major Component, but which is not part of that Major
Component, and (b) serves only to enable use of the work with that
Major Component, or to implement a Standard Interface for which an
implementation is available to the public in source code form. A
"Major Component", in this context, means a major essential component
(kernel, window system, and so on) of the specific operating system
(if any) on which the executable work runs, or a compiler used to
produce the work, or an object code interpreter used to run it.
The "Corresponding Source" for a work in object code form means all
the source code needed to generate, install, and (for an executable
work) run the object code and to modify the work, including scripts to
control those activities. However, it does not include the work's
System Libraries, or general-purpose tools or generally available free
programs which are used unmodified in performing those activities but
which are not part of the work. For example, Corresponding Source
includes interface definition files associated with source files for
the work, and the source code for shared libraries and dynamically
linked subprograms that the work is specifically designed to require,
such as by intimate data communication or control flow between those
subprograms and other parts of the work.
The Corresponding Source need not include anything that users
can regenerate automatically from other parts of the Corresponding
Source.
The Corresponding Source for a work in source code form is that
same work.
2. Basic Permissions.
All rights granted under this License are granted for the term of
copyright on the Program, and are irrevocable provided the stated
conditions are met. This License explicitly affirms your unlimited
permission to run the unmodified Program. The output from running a
covered work is covered by this License only if the output, given its
content, constitutes a covered work. This License acknowledges your
rights of fair use or other equivalent, as provided by copyright law.
You may make, run and propagate covered works that you do not
convey, without conditions so long as your license otherwise remains
in force. You may convey covered works to others for the sole purpose
of having them make modifications exclusively for you, or provide you
with facilities for running those works, provided that you comply with
the terms of this License in conveying all material for which you do
not control copyright. Those thus making or running the covered works
for you must do so exclusively on your behalf, under your direction
and control, on terms that prohibit them from making any copies of
your copyrighted material outside their relationship with you.
Conveying under any other circumstances is permitted solely under
the conditions stated below. Sublicensing is not allowed; section 10
makes it unnecessary.
3. Protecting Users' Legal Rights From Anti-Circumvention Law.
No covered work shall be deemed part of an effective technological
measure under any applicable law fulfilling obligations under article
11 of the WIPO copyright treaty adopted on 20 December 1996, or
similar laws prohibiting or restricting circumvention of such
measures.
When you convey a covered work, you waive any legal power to forbid
circumvention of technological measures to the extent such circumvention
is effected by exercising rights under this License with respect to
the covered work, and you disclaim any intention to limit operation or
modification of the work as a means of enforcing, against the work's
users, your or third parties' legal rights to forbid circumvention of
technological measures.
4. Conveying Verbatim Copies.
You may convey verbatim copies of the Program's source code as you
receive it, in any medium, provided that you conspicuously and
appropriately publish on each copy an appropriate copyright notice;
keep intact all notices stating that this License and any
non-permissive terms added in accord with section 7 apply to the code;
keep intact all notices of the absence of any warranty; and give all
recipients a copy of this License along with the Program.
You may charge any price or no price for each copy that you convey,
and you may offer support or warranty protection for a fee.
5. Conveying Modified Source Versions.
You may convey a work based on the Program, or the modifications to
produce it from the Program, in the form of source code under the
terms of section 4, provided that you also meet all of these conditions:
a) The work must carry prominent notices stating that you modified
it, and giving a relevant date.
b) The work must carry prominent notices stating that it is
released under this License and any conditions added under section
7. This requirement modifies the requirement in section 4 to
"keep intact all notices".
c) You must license the entire work, as a whole, under this
License to anyone who comes into possession of a copy. This
License will therefore apply, along with any applicable section 7
additional terms, to the whole of the work, and all its parts,
regardless of how they are packaged. This License gives no
permission to license the work in any other way, but it does not
invalidate such permission if you have separately received it.
d) If the work has interactive user interfaces, each must display
Appropriate Legal Notices; however, if the Program has interactive
interfaces that do not display Appropriate Legal Notices, your
work need not make them do so.
A compilation of a covered work with other separate and independent
works, which are not by their nature extensions of the covered work,
and which are not combined with it such as to form a larger program,
in or on a volume of a storage or distribution medium, is called an
"aggregate" if the compilation and its resulting copyright are not
used to limit the access or legal rights of the compilation's users
beyond what the individual works permit. Inclusion of a covered work
in an aggregate does not cause this License to apply to the other
parts of the aggregate.
6. Conveying Non-Source Forms.
You may convey a covered work in object code form under the terms
of sections 4 and 5, provided that you also convey the
machine-readable Corresponding Source under the terms of this License,
in one of these ways:
a) Convey the object code in, or embodied in, a physical product
(including a physical distribution medium), accompanied by the
Corresponding Source fixed on a durable physical medium
customarily used for software interchange.
b) Convey the object code in, or embodied in, a physical product
(including a physical distribution medium), accompanied by a
written offer, valid for at least three years and valid for as
long as you offer spare parts or customer support for that product
model, to give anyone who possesses the object code either (1) a
copy of the Corresponding Source for all the software in the
product that is covered by this License, on a durable physical
medium customarily used for software interchange, for a price no
more than your reasonable cost of physically performing this
conveying of source, or (2) access to copy the
Corresponding Source from a network server at no charge.
c) Convey individual copies of the object code with a copy of the
written offer to provide the Corresponding Source. This
alternative is allowed only occasionally and noncommercially, and
only if you received the object code with such an offer, in accord
with subsection 6b.
d) Convey the object code by offering access from a designated
place (gratis or for a charge), and offer equivalent access to the
Corresponding Source in the same way through the same place at no
further charge. You need not require recipients to copy the
Corresponding Source along with the object code. If the place to
copy the object code is a network server, the Corresponding Source
may be on a different server (operated by you or a third party)
that supports equivalent copying facilities, provided you maintain
clear directions next to the object code saying where to find the
Corresponding Source. Regardless of what server hosts the
Corresponding Source, you remain obligated to ensure that it is
available for as long as needed to satisfy these requirements.
e) Convey the object code using peer-to-peer transmission, provided
you inform other peers where the object code and Corresponding
Source of the work are being offered to the general public at no
charge under subsection 6d.
A separable portion of the object code, whose source code is excluded
from the Corresponding Source as a System Library, need not be
included in conveying the object code work.
A "User Product" is either (1) a "consumer product", which means any
tangible personal property which is normally used for personal, family,
or household purposes, or (2) anything designed or sold for incorporation
into a dwelling. In determining whether a product is a consumer product,
doubtful cases shall be resolved in favor of coverage. For a particular
product received by a particular user, "normally used" refers to a
typical or common use of that class of product, regardless of the status
of the particular user or of the way in which the particular user
actually uses, or expects or is expected to use, the product. A product
is a consumer product regardless of whether the product has substantial
commercial, industrial or non-consumer uses, unless such uses represent
the only significant mode of use of the product.
"Installation Information" for a User Product means any methods,
procedures, authorization keys, or other information required to install
and execute modified versions of a covered work in that User Product from
a modified version of its Corresponding Source. The information must
suffice to ensure that the continued functioning of the modified object
code is in no case prevented or interfered with solely because
modification has been made.
If you convey an object code work under this section in, or with, or
specifically for use in, a User Product, and the conveying occurs as
part of a transaction in which the right of possession and use of the
User Product is transferred to the recipient in perpetuity or for a
fixed term (regardless of how the transaction is characterized), the
Corresponding Source conveyed under this section must be accompanied
by the Installation Information. But this requirement does not apply
if neither you nor any third party retains the ability to install
modified object code on the User Product (for example, the work has
been installed in ROM).
The requirement to provide Installation Information does not include a
requirement to continue to provide support service, warranty, or updates
for a work that has been modified or installed by the recipient, or for
the User Product in which it has been modified or installed. Access to a
network may be denied when the modification itself materially and
adversely affects the operation of the network or violates the rules and
protocols for communication across the network.
Corresponding Source conveyed, and Installation Information provided,
in accord with this section must be in a format that is publicly
documented (and with an implementation available to the public in
source code form), and must require no special password or key for
unpacking, reading or copying.
7. Additional Terms.
"Additional permissions" are terms that supplement the terms of this
License by making exceptions from one or more of its conditions.
Additional permissions that are applicable to the entire Program shall
be treated as though they were included in this License, to the extent
that they are valid under applicable law. If additional permissions
apply only to part of the Program, that part may be used separately
under those permissions, but the entire Program remains governed by
this License without regard to the additional permissions.
When you convey a copy of a covered work, you may at your option
remove any additional permissions from that copy, or from any part of
it. (Additional permissions may be written to require their own
removal in certain cases when you modify the work.) You may place
additional permissions on material, added by you to a covered work,
for which you have or can give appropriate copyright permission.
Notwithstanding any other provision of this License, for material you
add to a covered work, you may (if authorized by the copyright holders of
that material) supplement the terms of this License with terms:
a) Disclaiming warranty or limiting liability differently from the
terms of sections 15 and 16 of this License; or
b) Requiring preservation of specified reasonable legal notices or
author attributions in that material or in the Appropriate Legal
Notices displayed by works containing it; or
c) Prohibiting misrepresentation of the origin of that material, or
requiring that modified versions of such material be marked in
reasonable ways as different from the original version; or
d) Limiting the use for publicity purposes of names of licensors or
authors of the material; or
e) Declining to grant rights under trademark law for use of some
trade names, trademarks, or service marks; or
f) Requiring indemnification of licensors and authors of that
material by anyone who conveys the material (or modified versions of
it) with contractual assumptions of liability to the recipient, for
any liability that these contractual assumptions directly impose on
those licensors and authors.
All other non-permissive additional terms are considered "further
restrictions" within the meaning of section 10. If the Program as you
received it, or any part of it, contains a notice stating that it is
governed by this License along with a term that is a further
restriction, you may remove that term. If a license document contains
a further restriction but permits relicensing or conveying under this
License, you may add to a covered work material governed by the terms
of that license document, provided that the further restriction does
not survive such relicensing or conveying.
If you add terms to a covered work in accord with this section, you
must place, in the relevant source files, a statement of the
additional terms that apply to those files, or a notice indicating
where to find the applicable terms.
Additional terms, permissive or non-permissive, may be stated in the
form of a separately written license, or stated as exceptions;
the above requirements apply either way.
8. Termination.
You may not propagate or modify a covered work except as expressly
provided under this License. Any attempt otherwise to propagate or
modify it is void, and will automatically terminate your rights under
this License (including any patent licenses granted under the third
paragraph of section 11).
However, if you cease all violation of this License, then your
license from a particular copyright holder is reinstated (a)
provisionally, unless and until the copyright holder explicitly and
finally terminates your license, and (b) permanently, if the copyright
holder fails to notify you of the violation by some reasonable means
prior to 60 days after the cessation.
Moreover, your license from a particular copyright holder is
reinstated permanently if the copyright holder notifies you of the
violation by some reasonable means, this is the first time you have
received notice of violation of this License (for any work) from that
copyright holder, and you cure the violation prior to 30 days after
your receipt of the notice.
Termination of your rights under this section does not terminate the
licenses of parties who have received copies or rights from you under
this License. If your rights have been terminated and not permanently
reinstated, you do not qualify to receive new licenses for the same
material under section 10.
9. Acceptance Not Required for Having Copies.
You are not required to accept this License in order to receive or
run a copy of the Program. Ancillary propagation of a covered work
occurring solely as a consequence of using peer-to-peer transmission
to receive a copy likewise does not require acceptance. However,
nothing other than this License grants you permission to propagate or
modify any covered work. These actions infringe copyright if you do
not accept this License. Therefore, by modifying or propagating a
covered work, you indicate your acceptance of this License to do so.
10. Automatic Licensing of Downstream Recipients.
Each time you convey a covered work, the recipient automatically
receives a license from the original licensors, to run, modify and
propagate that work, subject to this License. You are not responsible
for enforcing compliance by third parties with this License.
An "entity transaction" is a transaction transferring control of an
organization, or substantially all assets of one, or subdividing an
organization, or merging organizations. If propagation of a covered
work results from an entity transaction, each party to that
transaction who receives a copy of the work also receives whatever
licenses to the work the party's predecessor in interest had or could
give under the previous paragraph, plus a right to possession of the
Corresponding Source of the work from the predecessor in interest, if
the predecessor has it or can get it with reasonable efforts.
You may not impose any further restrictions on the exercise of the
rights granted or affirmed under this License. For example, you may
not impose a license fee, royalty, or other charge for exercise of
rights granted under this License, and you may not initiate litigation
(including a cross-claim or counterclaim in a lawsuit) alleging that
any patent claim is infringed by making, using, selling, offering for
sale, or importing the Program or any portion of it.
11. Patents.
A "contributor" is a copyright holder who authorizes use under this
License of the Program or a work on which the Program is based. The
work thus licensed is called the contributor's "contributor version".
A contributor's "essential patent claims" are all patent claims
owned or controlled by the contributor, whether already acquired or
hereafter acquired, that would be infringed by some manner, permitted
by this License, of making, using, or selling its contributor version,
but do not include claims that would be infringed only as a
consequence of further modification of the contributor version. For
purposes of this definition, "control" includes the right to grant
patent sublicenses in a manner consistent with the requirements of
this License.
Each contributor grants you a non-exclusive, worldwide, royalty-free
patent license under the contributor's essential patent claims, to
make, use, sell, offer for sale, import and otherwise run, modify and
propagate the contents of its contributor version.
In the following three paragraphs, a "patent license" is any express
agreement or commitment, however denominated, not to enforce a patent
(such as an express permission to practice a patent or covenant not to
sue for patent infringement). To "grant" such a patent license to a
party means to make such an agreement or commitment not to enforce a
patent against the party.
If you convey a covered work, knowingly relying on a patent license,
and the Corresponding Source of the work is not available for anyone
to copy, free of charge and under the terms of this License, through a
publicly available network server or other readily accessible means,
then you must either (1) cause the Corresponding Source to be so
available, or (2) arrange to deprive yourself of the benefit of the
patent license for this particular work, or (3) arrange, in a manner
consistent with the requirements of this License, to extend the patent
license to downstream recipients. "Knowingly relying" means you have
actual knowledge that, but for the patent license, your conveying the
covered work in a country, or your recipient's use of the covered work
in a country, would infringe one or more identifiable patents in that
country that you have reason to believe are valid.
If, pursuant to or in connection with a single transaction or
arrangement, you convey, or propagate by procuring conveyance of, a
covered work, and grant a patent license to some of the parties
receiving the covered work authorizing them to use, propagate, modify
or convey a specific copy of the covered work, then the patent license
you grant is automatically extended to all recipients of the covered
work and works based on it.
A patent license is "discriminatory" if it does not include within
the scope of its coverage, prohibits the exercise of, or is
conditioned on the non-exercise of one or more of the rights that are
specifically granted under this License. You may not convey a covered
work if you are a party to an arrangement with a third party that is
in the business of distributing software, under which you make payment
to the third party based on the extent of your activity of conveying
the work, and under which the third party grants, to any of the
parties who would receive the covered work from you, a discriminatory
patent license (a) in connection with copies of the covered work
conveyed by you (or copies made from those copies), or (b) primarily
for and in connection with specific products or compilations that
contain the covered work, unless you entered into that arrangement,
or that patent license was granted, prior to 28 March 2007.
Nothing in this License shall be construed as excluding or limiting
any implied license or other defenses to infringement that may
otherwise be available to you under applicable patent law.
12. No Surrender of Others' Freedom.
If conditions are imposed on you (whether by court order, agreement or
otherwise) that contradict the conditions of this License, they do not
excuse you from the conditions of this License. If you cannot convey a
covered work so as to satisfy simultaneously your obligations under this
License and any other pertinent obligations, then as a consequence you may
not convey it at all. For example, if you agree to terms that obligate you
to collect a royalty for further conveying from those to whom you convey
the Program, the only way you could satisfy both those terms and this
License would be to refrain entirely from conveying the Program.
13. Use with the GNU Affero General Public License.
Notwithstanding any other provision of this License, you have
permission to link or combine any covered work with a work licensed
under version 3 of the GNU Affero General Public License into a single
combined work, and to convey the resulting work. The terms of this
License will continue to apply to the part which is the covered work,
but the special requirements of the GNU Affero General Public License,
section 13, concerning interaction through a network will apply to the
combination as such.
14. Revised Versions of this License.
The Free Software Foundation may publish revised and/or new versions of
the GNU General Public License from time to time. Such new versions will
be similar in spirit to the present version, but may differ in detail to
address new problems or concerns.
Each version is given a distinguishing version number. If the
Program specifies that a certain numbered version of the GNU General
Public License "or any later version" applies to it, you have the
option of following the terms and conditions either of that numbered
version or of any later version published by the Free Software
Foundation. If the Program does not specify a version number of the
GNU General Public License, you may choose any version ever published
by the Free Software Foundation.
If the Program specifies that a proxy can decide which future
versions of the GNU General Public License can be used, that proxy's
public statement of acceptance of a version permanently authorizes you
to choose that version for the Program.
Later license versions may give you additional or different
permissions. However, no additional obligations are imposed on any
author or copyright holder as a result of your choosing to follow a
later version.
15. Disclaimer of Warranty.
THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
16. Limitation of Liability.
IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
SUCH DAMAGES.
17. Interpretation of Sections 15 and 16.
If the disclaimer of warranty and limitation of liability provided
above cannot be given local legal effect according to their terms,
reviewing courts shall apply local law that most closely approximates
an absolute waiver of all civil liability in connection with the
Program, unless a warranty or assumption of liability accompanies a
copy of the Program in return for a fee.
END OF TERMS AND CONDITIONS
How to Apply These Terms to Your New Programs
If you develop a new program, and you want it to be of the greatest
possible use to the public, the best way to achieve this is to make it
free software which everyone can redistribute and change under these terms.
To do so, attach the following notices to the program. It is safest
to attach them to the start of each source file to most effectively
state the exclusion of warranty; and each file should have at least
the "copyright" line and a pointer to where the full notice is found.
Copyright (C)
This program is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation version 3., or
(at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program. If not, see .
Also add information on how to contact you by electronic and paper mail.
If the program does terminal interaction, make it output a short
notice like this when it starts in an interactive mode:
Copyright (C)
This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
This is free software, and you are welcome to redistribute it
under certain conditions; type `show c' for details.
The hypothetical commands `show w' and `show c' should show the appropriate
parts of the General Public License. Of course, your program's commands
might be different; for a GUI interface, you would use an "about box".
You should also get your employer (if you work as a programmer) or school,
if any, to sign a "copyright disclaimer" for the program, if necessary.
For more information on this, and how to apply and follow the GNU GPL, see
.
The GNU General Public License does not permit incorporating your program
into proprietary programs. If your program is a subroutine library, you
may consider it more useful to permit linking proprietary applications with
the library. If this is what you want to do, use the GNU Lesser General
Public License instead of this License. But first, please read
.
pgmodeler-0.9.4/README.md 0000664 0000000 0000000 00000013030 14160100006 0014742 0 ustar 00root root 0000000 0000000 Building status
---------------
[](https://github.com/pgmodeler/pgmodeler/actions?query=workflow%3A%22Linux+build%22)
[](https://github.com/pgmodeler/pgmodeler/actions?query=workflow%3A%22Windows+build%22)
[](https://github.com/pgmodeler/pgmodeler/actions?query=workflow%3A%22macOs+build%22)
Introduction
------------
pgModeler - PostgreSQL Database Modeler - is an open-source data-modeling tool designed for PostgreSQL. No more DDL commands written by hand, let pgModeler do the job for you! This software reunites the concepts of entity-relationship diagrams and the features that PostgreSQL implements as extensions of SQL standards.
Please, let me know how pgModeler is working on your system! Help improving this project, give your feedback about the software or report any bug at [Issues](https://github.com/pgmodeler/pgmodeler/issues) page. Additionally, follow pgModeler on [Facebook](https://www.facebook.com/pgmodeler) or [Twitter](https://twitter.com/pgmodeler) and be up-to-date with new features, fixes and releases.
Licensing
---------
This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation version 3.
This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.
See [LICENSE](https://github.com/pgmodeler/pgmodeler/blob/master/LICENSE) for details.
Donate to pgModeler
-------------------
Much effort, coffee, chocolate, time and knowledge is being devoted to this project so that a reliable and constantly improved product can be delivered to the community. If you liked pgModeler and think it deserves a contribution, please donate any amount (via PayPal) at [project's official site](https://pgmodeler.io).
Developers and Reviewers wanted!
--------------------------------
pgModeler has reached a state where its developer cannot handle all the modifications and new features requests alone anymore. So if you know C++ and Qt and want to contribute with coding let me know! I'll be grateful for any help to the project!
Compiling/Installation
----------------------
For details about the installation process from source code, visit the [Installation](https://www.pgmodeler.io/support/installation) section. If you don't want to compile pgModeler there are binaries available for purchase at [official site](http://www.pgmodeler.io/purchase).
You might want to check out the [official plugin repository](https://github.com/pgmodeler/plugins) as well.
Known Issues
-----------
* Due to the usage of Qt's raster engine to draw objects, the process of handling objects on the canvas tends to get slower as lots of objects are created causing constant CPU usage. A heavy performance degradation can be noticed when dealing with models with ~500+ tables and/or relationships. There're plans to improve the speed of drawing operations, for large models, in future releases. Changing the relationship connection mode and render smoothness options may help in the performance when handling big database models.
* pgModeler can't handle correctly the importing of complex CSV files (multilined cell values) in data manipulation form, or pasting CSV content of that complexity on that dialog.
* Due to the CSV importing limitations, any value copied or exported from pgModeler in CSV format will be automatically formatted in the proper way that the tool can handle (by escaping any special character like line breaks and tabulations). If you intend to use CSV files generated by the tool in other software you have to revert back that characters escaping so the file can be read properly by third party softwares.
* The diff process still presents false-positive results due its limitations. Sometimes, there is the need to run the process twice to get the full changes.
* pgModeler does not fully supports the [quoted identifier notation](http://www.postgresql.org/docs/current/static/sql-syntax-lexical.html#SQL-SYNTAX-IDENTIFIERS). When using quoted identifiers only the following characters are accepted in the middle of names: a-z A-Z 0-9 _ . @ $ - / \ space.
* pgModeler is unusable in sandboxed Mac OS X installations. To workaround this issue you'll need to deactivate sandbox usage to run pgModeler properly. There is no plan to support sandboxing in Mac OS X.
* pgModeler can't be compiled with Microsoft Visual Studio due to use of some gcc/clang extensions.
* Compiling the source using '-Wconversion' (disabled by Qt in its defaults) generates a lot of warnings. These warnings are 99% harmless, I don't plan to fix them in a near future.
* pgModeler can sometimes crash during the export, import or validation process due to some threaded operations that, depending on the size and the arrangement of the model, cause race conditions.
* Due to particularities on executing bundles on MacOSX, the file association does not work correctly on this system. So it's not possible to open a model file by clicking it on Finder.
Changelog
----------
The detailed changelog can be seen on [CHANGELOG.md](https://github.com/pgmodeler/pgmodeler/blob/master/CHANGELOG.md) file.
Older Releases/Code
-------------------
Older releases of pgModeler can be found at [Sourceforge.net](http://sourceforge.net/projects/pgmodeler)
pgmodeler-0.9.4/RELEASENOTES.md 0000664 0000000 0000000 00000011521 14160100006 0015701 0 ustar 00root root 0000000 0000000 v0.9.4
------
Release date: December 17, 2021
Changes since: v0.9.3
Attention: the database model file structure has changed since the last stable 0.9.3. Models created in older releases will certainly fail to load due to incompatibilities because some attributes in the XML code don't exist anymore or have changed during the development of 0.9.4. Before loading your database models in this new release, please, make sure to have a backup of them all and follow the steps presented by the model fix tool to patch the documents' structure. Not paying attention to this situation may cause irreversible data loss! If the fix procedures aren't enough to make your database models loadable again, please, ask for help at the official support channels!
Summary: it was quite a challenge to develop version 0.9.4 during the year 2021 but we finally made it, the last pgModeler of the series 0.9.x is ready! This one has a vast set of improvements over 0.9.3, being 51 new features, 104 enhancements, and 73 bug fixes that will make a big difference in the overall usage of the tool.
The first improvement in 0.9.4 is the ability to put objects in multiple layers which was not possible in previous versions. The user has now the ability to set up custom colors and labels for each layer enhancing the database model visualization and semantics. Still in the database model design, one can now define a custom color for canvas, grid lines, and page delimiter lines which can help a lot those who aren't comfortable with the excessive glare produced by the default color schema.
This release also improves the support for some PostgreSQL objects by bringing the configuration parameters and transform types to functions and procedures, adding the support for PARALLEL attribute on functions, and the support for included columns also known as non-key columns on indexes. It's worth mentioning that the import and diff processes were also improved to support all the mentioned improvements in those objects. Besides, the diff process is now capable of generating GRANT and REVOKE commands to set up new role memberships.
The data type configuration widget received a simple improvement which adds a significant reduction in the time spent to configure a data type. Now, the user can just type the name of the desired data type to be used instead of selecting it by using the mouse. After typing the data type name just hit the tab key to jump to the next field and the data type will be automatically configured. Seems a silly fix but it adds speed when you need to repeatedly create columns in a table, for example.
In the SQL tool, is now possible to drop databases quickly from the databases listing. Previously, there was the need to browse the database first and then drop it. In the database browser widget, the tree items collapse state is saved and restored after any updates requested by the user, improving the overall experience on that module. In data manipulation form, the sorting operation performed when clicking columns was adjusted. Now, the sorting will be triggered by holding the control key and clicking the desired column, and if the user only clicks a column without holding the control key will cause the entire column to be selected in the grid.
Attending to some requests, pgModeler is now capable of exporting the database model in split SQL files instead of generating a single SQL file representing the entire database. In this export mode, the files are named in such a way to represent the proper order of creation, which means that running the scripts one after another will create the whole database like it was created from a single file.
Due to the introduction of a new syntax highlighting configuration file (for code snippets configuration), pgModeler will, from now on, create missing configuration files at startup. This will avoid breaking the tool's execution when it detects the absence of any configuration file. Also, during the copy of these files, pgModeler will enforce the write permission over them to avoid access problems on some systems that store template settings on read-only paths.
The command-line interface was patched in such a way that now doesn't crash anymore when performing a diff operation in which a database model is used as input. Another improvement to the CLI is the introduction of the option --force in the mime type handling operation. Also, a patch was made in such a way to avoid the usage of option '-platform offscreen' explicitly when calling the application.
Finally, there is a bunch of other new features and bug fixes implemented in almost all parts of the tool which improves stability and reliability. I kindly invite you to read the CHANGELOG.md file of the 0.9.4 development timeline to know everything in detail.
pgmodeler-0.9.4/apps/ 0000775 0000000 0000000 00000000000 14160100006 0014431 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-ch/ 0000775 0000000 0000000 00000000000 14160100006 0016777 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-ch/pgmodeler-ch.pro 0000664 0000000 0000000 00000001415 14160100006 0022070 0 ustar 00root root 0000000 0000000 include(../../pgmodeler.pri)
TEMPLATE = app
TARGET = pgmodeler-ch
windows:RC_FILE=res/windows_ico.qrc
windows:RCC_DIR=src/
SOURCES += src/main.cpp \
src/crashhandlerform.cpp
HEADERS += src/crashhandlerform.h
unix|windows: LIBS += $$LIBGUI_LIB \
$$LIBCANVAS_LIB \
$$LIBCONNECTOR_LIB \
$$LIBCORE_LIB \
$$LIBPARSERS_LIB \
$$LIBUTILS_LIB
INCLUDEPATH += $$LIBGUI_INC \
$$LIBCANVAS_INC \
$$LIBCONNECTOR_INC \
$$LIBCORE_INC \
$$LIBPARSERS_INC \
$$LIBUTILS_INC
DEPENDPATH += $$LIBGUI_ROOT \
$$LIBCANVAS_ROOT \
$$LIBCONNECTOR_ROOT \
$$LIBCORE_ROOT \
$$LIBPARSERS_ROOT \
$$LIBUTILS_ROOT
# Deployment settings
target.path = $$PRIVATEBINDIR
INSTALLS = target
pgmodeler-0.9.4/apps/pgmodeler-ch/res/ 0000775 0000000 0000000 00000000000 14160100006 0017570 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-ch/res/windows_ico.ico 0000664 0000000 0000000 00001261536 14160100006 0022626 0 ustar 00root root 0000000 0000000 ( V ( ~ 00 % ( NN h ^ ( 8 k q | y v ` B 4 < e c . +
? Y f q r o i R
8 +
: c K I %
# &% R5{Tis~{rfsL B. && "
$ * - - / 6 = 5Pks ai %E : 4 , + , ( !
# ' - 3 6 5 : B )U b{ Sn L = 7 4 4 1 ) %
# ( + , - . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . - - , ( $
# * - - 0 : ?Y z
&#/&3'5(5(5'5&4%2!," o 6L 1 . ) * % # / 8 ? D F H I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I J J H G E A 9 / % ! OE
#%1/?5G;MBWG_IaI`G_G_G_H`HaE[>R7J3D+:!, q O7 # 3 B Q Z a f g h i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i h g h e a [ R E 5 '
`$ b $*88HCWH_G^E\CX>R9K6G4C2B2B2B3D5G9L>SAWCZD]E\;O2B".
L i ; . B W i w x k Z H 6 ' D #-5CEXJ_G]?S8H2?*6$. ) %! " &!+$/*62@5H?UBZC\;Q+; &
t & ! 6 O h } n Z G 8 / * ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ) ( ( & 45 r %/:JG\J_AT7F.;#,!
!$/.<5G@VCZ?U1A & E 1 N k k X L E B A A B C B B B B B B B B B B B B B B B D C @ EZ
#+8FG[H]?Q3@%.
'22A>RCZ=S/>!
j s/ 9B3t{*{m$oa dV [OVKSHRGQFQFPFQFQFQFQFQFQFQFQFQFQFQFQFPFQFQFPFPFPFPEPEOEODNDNDNCMDNDMDNDNDMDMCNCNDNDODOEPEPEPFPFQFQFQFQFNDVLRI
z j ` \ \ ] _ ` a b b b b b b b b b b b b b b b a ` N 0>DVJ]BS1> (
",1B?UD[;N&4 3AMõYķ]ķ\Ķ\Ķ\Ķ\ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\Ķ\ķ\ö[Ķ[õZµZ´Z´ZZZYXWWVVVVVVWWWXXYZ´ZµZö[Ķ[Ķ[ķ\ķ\ö\˺YC>6 y s s v z } ~ L "+=LJ]GY7D"*
$/6HCYBX2A + /F̽atspqqrrrssssssssssssssssqqpppommkjji̿h˾hʾh˾h˾h̾ghiiklnopppqqrpx{R>7 F ,6DUL_AQ*3
,9>SE]9K ) 0 -GelͺYƲSųVųVųVųVųVųVųVųVųVųVųVųVųVŲVŲVŲVųVųVųVųVIJUIJU±UTSRPPNLKIIHGGGHIIIKLNPQRTU°UñVIJVîMξ_xS:2 > 3?HZK]9G $
)9KE\%!
6/ MB RG RG TH WJ \O
aS
iZqa{jr{+MɾiJ2+ &(0ЁXW CSM^DR
'>RG^-;
S .G˾bg¯L3'$&%$$$##$#"!!!! fZ,'
6.
MB RG QF UI XM _Q
fWo_ wgq'GcF0(
&(/р}| /8P`HV)/
)3DXAU ) $ .G˾bg¯L3'$&%%%$$$$#"""" r 93
=4 WJ
RF
RF VI \N dU k]uf"A\B-&
&'-~DD !N^JX:C
5CI^8I g .G˾bg¯L3'$%%%$$$%$#"""! r 5.
'"
E; TH SF UH \N bTj] x*$$%,||vt ;DSbCO
'@SF['2 , .G˾bg¯L3(%&&%%%$$$###! sd3,
:2 RH RF TG ZNbU yn7P~:'"#$+yz}AA !'SbJW4<
1=H]68B̾ch®L5+)*)(('%RI
nTVTUTTSS~S~R~R~R~Q~Q}Q}Q|P|P|O|N|MzMzM{MzLzM|LjJ.+/
VR0bY( aad 9 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? = ;,(N>̾bh®L5,**))((p (%
YMDZVUUUUUUSSSR~R~R~Q~Q~Q}P|P|O|N{NzO{N{M|L|MkG;1(
YU1d[) cbe BEzdiEDLMJJKKKKKKJJKKGGYY00BBLLMMKKJJFDKJksrGT , * 9 E O V Y \ ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] \ X!
f9ͿchL5,**))((dX
.('vUVUVUUUUUTTTSSS~R~Q}Q}P|Q|P|P|O|O|N|M|N|OjA;.
\X3g_+ "ffh FJ}dhCBLLJJKKKKKKJJKKEEWW##55LLMMIIGGHHJJFFJJkszO\ 3 ' : L ^ k s x { | | | | | | | | | | | | | | | | | | | | | | | | | | { { w7ͿchL5,**))(#E>
jYKWXWWWUVUTUUUUTSS~S}Q~R~Q~Q~Q|P|P|P|O{O|NlJ92/
`[5mc- "ijl HK}bfAALLJJIIIIIIJJKKDDWWCCGGJJEEGGIIHHIIFFHHiq|T` 6 /F^t x5chL6-**)*(m_ =40}\[WWWWVVVUUUUUUTS~SS~R~Q~Q~Q|Q|Q|Q|O}O~QxaF
fa8tj0 $mmp GK}beA?JJHHHHHHHHHHJJEEWWGG??HHGGHHHHHHIIEDGGhp{Ta 6
1 L h u2οciL6-)**)'PF iXIVXYXXXWWWVVVTTUUTTT~S~R~R}R}P}P}Q~PRtQE92
rl?|q4 !'qqt EI|bfA@JJHHHHHHHHHHJJDDWWCCAAHHGGGGGGGGHHDDGGhp{T_ 2 + !]>$eCFN3N>*a3"w+
$ "
~q0ͿciL5,*+*)y#4.
4,(tT[XYYYYXXWWWWVVUUUUTTS~S~S~Q~QRVuSSE7
43 }Gy8# "#(uux ?BxcgCBJKHHGGHHHHHHJJDDWWCC@@GGFFFFFFFFGGDCGGhp{PZ + P6 L5*wPQ.W/Z.X,U+{R*wP(uN(sL(qK(qK(qL(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(qK(rL'pKR7 |o0ͿdiL6-**©+)dY YJ;Y[YZZYYYYXXXXWWVVUUUTTTTTT{RhMK@9
LF'P<&!#$*zy| 36qwcgCBIJHHGGGGGGGGIICCVVCC@@GGFFFFFFFFGGDCHJir{JT Y; K.+zRj1`:p9n:o:o:p:q:q:q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;q;qvx3c3^@rCvBsBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtAtBtAtBtBtBtCv8d.X=t;t"dC
zm/diL6-*ū,*WM 1*&lQ_]^]]]]]\\\\ZZZZYYYYYWmQ4.-
/)rc.OlK2+ &(0ЂQP PUtzZ\BAHHFFFFFFFFFFFFEEEEEEEEEEEEEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCBBCCCCDDCCCCCCCCCCDDA@DD\bvm{$) V U9 *+yPf4c>x2a7cOSnjPQQQRRQQRQRRQQRRRQRQRPQPQQQTnj@p,V=u;t"dC
zm/diL7.,ê-)LC H>4ac^_^^]]]]]\\\\[[ZZYYX~Y<4/
,'sc 0RoM3, &)0т|| >@}be@?IHGGGGGGGGFFFFEE@@==>>>>>>>>>>>>>>>>>>>>>>>>>>==============================<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<>>DDDDDDDDDDDDDE@?EFdly^g 9 U9 *+yPf4c>x2a8eSYɐUËVŌVŌVŌUČUČVČVČUŌVČUŌUČVČVŌUŌUČUČVČUČVČUČVČVČUČVČVČUċUʎ@q,V=u;t"dC
zm/diL7.©,,y&2/`RBab_``_^^^]]]]\\\\[[ZZWfUH
.)k\ 2TqN4, &(0҂ $&hnhkDDGGFFGGGGFFGGGGFFGGGGGGGGGGFFFFFFGGHHHHHHGGFFGGGGGGFFFFFFFFEEEEEEFFFFFFGGFFEEFFFFFFEEEEEEDDDDDDDDDDEEEEEEFFEEEEDDDDDDDDDDCCCDA@IKku{JQ # U9 *+yPf4c>x2a9fU[ɑWÌXčXčXčWčWčXčXčWčXčWčWčXčYčXčXčWÍXÍWčXčXčYčXčWčXČXÌVTȌ?p,V=u;t"dC
zm/diL7.Ī,,zk#$")$!vbIaa`a``___]^]]\\]\\[[[],%%
;4m]t 2TqN3- &(/ҁ X\otRSDDHHGGGGGGGGFFGGGGGGGGGGFFEEEEEEFFEEEEEEFFFFFFFFEEFFFFFFEEDDDDDDDDDDDDDDDDEEEEDDEEEEEEEECCCCCCDDDDCCCCCCCCDDDDDDDDDDDDDDEECBCDTXt}y6; v
U9 *+yPf4c>x2a;gZ_˓ZŎ[Ɛ[Ɛ[Ɛ[Ɛ[Ə[Ə[Ɛ[Ő[Ə[ŏ[Ə\Ə\Ə\Ə\Ə[Ő[Ő[Ə[Ə\Ə\Ə[Ə\Ɛ\ƏYōUUnj@p,V=u;t"dC
zm/diL7.Ǭ.,^S
92-sYd_`a`a```__^]\\]\][\[}d
?6bUxgoz 2UqM2, ')0ՃDB DGx~`cA@GHGGGGGGGGFFGGGGGGFFFFGGGGGGGGFFEEEEFFEEEEEEEEFFFFFFFFFFFFFFFFEEDDDDDDDDDDDDEEEEEEEEEEEEEEEEEECCCCCCCCDDCCCCCCDDDDDDDDDE@@EF`fymx#' Q U9 *+yPf4c>x2a;g]c̕^Ƒ_ǒ_ƒ_Ɠ_ǒ_ǒ_ǒ_ƒ_ǒ_Ǒ_Ǒ_Ƒ_Ǒ_Ƒ_Ƒ_Ǒ_Ǔ_Ǔ_Ƒ_ƒ_Ǒ_Ƒ_Ǒ^ǒ]ƐYōUÊUǍ@p,V=u;t"dC
zm/diL7.ɮ.,OF G>9hh`babaa`aa____^]\]]]\mY
" D;XKdUj[xhu 0SoL5- ()/{zzec )*qujoDEGGGGGGGGGGGGGGGGGGFFFFGGGGGGFFFFGGGGFFEEEEEEEEFFEEEEEEFFFFFFFFFFFFFFEEDDDDDDEEDDDDDDEEEEEEEEDDDDEEEEEEDDCCCCCCCCCCCCCCDDA@KMlt{U\ 0 U9 *+yPf4c>x2ax2a=hcœjϜeɕeʖeʖfɗfɗfɖfɖfɖfɗfɗeɗfɗfɗfɗfɗfʗeʗfɖfɗfʖeʗfʖcɕaǒ\ŐXčUUǍ@p,V=u;t"dC
zm/diK6.ɯ.-SK
OB2`hbcccbaa``a````__^]]]|f /+TIQFWL^ShZvenw)IĸeG90
k 47}imBBHHGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGGGGFFFFFFGGFFEEEEEEEEFFFFEEEEFFFFFFEEEEFFEEDDDDDDDDEEEEEEEEDDEEEEEEDDDDDDDDEEA@JJgm~ho " I U9 *+yPf4c>x1a?hgƖnОiʘi˙i˙jʙjʙiʙjʙjʙiʙiʙiʙjʚjʚjʚjʙj˙i˚iʙiʙjʙi˘gʗdɕ`Ȓ\ƐXčUUǍ@p,V=u;t"dC
zm/diL7/ɮ.,TK
TG9bhcdddcbbbaaa``a`___^]b'$"
KBSGTIXMaTl\sd|l&C]Jr.vk-|p.s/v/w0w1x1y1y1y1y1y1y1y1y1y1x3y-siT! ^btxRSDCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFFFGGGGGGGGFFFFFFFFFFEEEEEEEEFFFFEEFFFFFFFFEEEEEEEEDDDDDDDDEEEEEEDDEEEEEEEFDCDDUYv{HM
U9 *+yPf4c>x1`?ikȗrѠl˚n̜n̜m̜m˜m̛m̚m̜m̜n̜n̜n̛n̛n̛n̜m̜m̛n̜n̜l̛j˙gʘcɕ`ǒ\ŐXčUUǍ@p,V=u;t"dC
zm/diL7/ɯ/-UL
UH8bhdeedddccbbaaa`````_^\PD9
/*RGTGTHZMbThZpb"|;V[ZŹcgjlnooppppppppppqmWR 58|jnEDFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGGGGFFFFFFEEEEEEEEEEFFFFEEFFFFFFFFEEEEEEEEEEDDDDDDDDEEEEEEFFABJMgnkt') ] U9 *+yPf4c>x1`@jmșuӢo̜p͞p͞p͞p͞p͝p͝p͞p͞p͞p͞q͞qΞpΞp͞p͞p͝p͞q͞n͜kʚgɗcɕ`ǒ\ŐYčUTǍ@p,V=u;t"dC
zm/diL81ɯ/-TK
QE9hkdeeeeeddccbbaaa````__t\
;4RFSGSHZM_Rf[!vl2AKQUZ^Ƹa˼cϿdfffghhhhhhhiew! _cv|WYEEFFGGFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGGFFFFFFFFFFEEEEEEFFFFFFEEFFFFFFFFEEEEEEEEEEDDDDEEDCEFY^x|KP
& U9 *+yPf4c>x1`Bjqʜyԥs͟tϠtΡtϡtϠtϠtΠtΡtΡtϡtϠtϡtϠtϠtϠtϠtϠtΠqΟn͜k˚gʖcɕ`ǒ\ŐYčUÊUȍ@q,V=u;t"dC
zm/diL81ʰ0.RI JBx1`Bkt˟}֨wϢxУxУxУxУxУxУxУxУwУxУxУxУxУxУxУxУuϡqΟo͝k̚gʗcɕ`Ǔ\ŐYčUUǍ@q,V=u;t"dC
zm/diL81ƭ0/tf% 93.tZjhgggffeeedeeccccbaa``_}^4/,
;4RHTHRGVKZO`Th[qb{l t!}$'()++,,++,,,,,+-&}D(#
NR|dgEFFFHHHHGGGGGGGGGGFFFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGGFFFFFFEEEEEEEEEEFFFFFFEEFFFFGGCCJJch~x@C U9 *+yPf4c>x0`Dlx̡{Х|Ѧ{Ѧ{Ѧ|ѥ|Ѧ|Ҧ|ѥ{ѥ|Ѧ|ѥ|ѥ{Ҧ{ҥ|Ѧ{ѥxѣuСqΟo͝k̚gʗdɕ`ȓ\ƐYčUTǍ@p,V=u;t"dC
zm/diL81ī0/w(0, ! !n]Khjhhgggffedddddddcbbaa`b}gQ#!!
1,LASHRGUIZNaShZqb{js| fX` psy~Y[EEGGHHGGHHHHHHGGGGGGGGGGFFFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGGGGFFFFFFFFFFEEEEFFFFFFFFEDFF]awX] S U9 *+yPf4c>x0`Dn{Σٮ|ѧ~Ө~Ө~Ө~ӧ~Ө~Ө~Ө~ӧӨ~ӧ~Ө~Ө~ӧ~ӧ}ҦyѣuСqΟn͝k̚gʖcɕ`ǒ\ŐXčTTǍ@p,V=u;t"dC
zm/diL81ê0©0*<6
QGx0`En~ЦڰҨԪԩԩԪԪԩթժԪԪԫԪԪҩ|ҦyФuϡqΟn͝k̚gʗbɕ`Ǔ\ŐYčUUǍ@p,V=u;t"dC
zm/diL810ȭ1-KC
3-*qYkiiihhhgggggeeeededcccbb^aRF
92LBQFQGWK\ObUk\venx çy@ MNoqPQDDHHHHGGGGHHHHHHGGHHHHHHHHGGGGGGGGGGFFFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFFFGGGGFFFFFFFFEDTWluv};> 5 0 U9 *+yPf4c>x0`FnѨ۳ӫխխլլխխխ֭խխլլիӨ}ҦyФuϡrΟo͝k̚gʘcɕ`Ǔ\ŐYōUÊUǍ@p,V=u;t"dC
zm/diL82/ƭ10ob%XK>ilhiiihhhgggfffeeddddccacfXMF +'I?VJRGTH[MbTjZsc~mu~ scX [^mnPPDDHHHIGGGGGGGGGGHHHHHHGGHHHHHHHHGGFFFFFFGGFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFFGGGGGFEERUlr~{GK
` 6 U9 *+yPf4c>x/_HoҪܵխׯׯׯ֯֯֯֯ׯְ֮֯խիө}ѦyѣuСrΟo͝k̚gʘcɕ`Ǔ\ŐYōUÊUǍ@p,V=u;t"dC
zm/diL830ê1ë1*83
.*)q\njijjhiigghhgfefddddddcbd}`SHA
'#>6PDSGSGYM`RgXq`zis{ 'WKl fhjlQRDDHHJJGGGGGGHHGGGGGGHHHHHHHHHHHHHHHHHHGGFFGGFFFFFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGHHEFDCSVlq}~QT
% U9 *+yPf4c>x/_Ipҭ֯ױױײײرررױزرװ֭իө|ѦyѣuТqΠn͝k̚gʘbɕ`ǒ\ŐXčUUǍ@p,V=u;t"dC
zm/diL8311ƭ2.VM!OE>hkjkjjjiiiihhgfgfededeecbcaWLD
71RF
TITHXL^QeWm_wfoy .?6 $%ikloTUEEFGJJIIIIHHGGGGGGHHGGGGGGGGHHHHHHGGGGHHGGFFFFFFFFFFFFFFFFGGGGGGGGGGGGGGGGGGGGGGGGEDDDWYnsUZ (D U9 *+yPf4c>x._Ipկײٴٴٴٴٴٴٴٴشزװ֭իө|ѦxѣuТqΠn͝k̚gʘbɕ`ǒ\ŏXĎUUnj@p,V=u;t"dC
zm/diL8311Ŭ2ª0t')' qbPqlkljjiiiihhhhgfgeedeeccbdd\QI
70MCRGRGVJ\PcVk\uemv 2/( ''hjqtYZGGEEIIJJHHHHIIHHGGGGGGGGGGGGGGGGGGHHHHGGHHHHHHGGFFFFFFFFGGGGGGGGGGGGGGGGGGGGFFCBGH\^ty~UY /g 4 $ U9 *+yPf4c>x._Kqղشڶڶڶڶ۶۶ڷ۶ٴرװ֭ԫө|ѦxѣuСqϟo͝k̚gʘcɕ`ǒ\ŏYĎUUǍ@q,V=u;t"dC
zm/diL83222Ŭ1.TK!4/-{dollkjjjihhhhhgggffedddddcdfaTL
+'G?UIUHUHZNaThZra|kt} 8*$""bdx{abKLFFFFIIJJIIHHHHHHIIIIGGGGGGGGHHHHGGHHHHHHHHGGGGGGGGHHFFFFFFGGGGGGGGGGGGDDDCNObfz{PT ) S < # U9 *+yPf4c>x._Krֳڷ۹۹۹۹ܹܹ۸۶ڴرװ֭ԫө|ҦyУuϡqΟn͝k̚gʘcɕ`Ȓ\ƐXčTTǍ@p,V=u;t"dC
zm/diL83ª221Ŭ2Ī0r((% D>9hnllkkkjjiiihhhgggfeeddeecdcfXI *%C;QESGTHYL_ReXo`{ir| 7*# XYlnTUHHEEGGHHJJIIIIIIIIHHHHHHHHGGGGGGHHHHHHGGGGHHHHHHHHGGGGGGFFFFGGGGDDCDGHUWmru{GL
s X : # U9 *+yPf4c>x._Lrص۸ܻܻܻܻܻܹܺ۶ڴرְխԫԩ|ҦyУuϡqΟo͝k̚gʗcɕ`ǒ\ŐXčUUǍ@p,V=u;t"dC
zm/diL83ª222ª2ū1.TK! `SHlomlllkkjjjiihhhggffeeeddddcyfQ*'' :2PESGSHWK^QdWm^xgq{ 21* EFy{z~dfNNHHFFGGIIIIHHHHIIIIIIHHHHHHHHGGGGGGGGHHHHHHHHGGHHHHHHGGFFEEEEGFPQfj{lo77 t w W : # U9 *+yPf4c>x._Nsٸܻܺ۶ٴزׯ֭ԫԩ}ҦyУuϡrΟo͝k̚gʗcɕ`ǒ\ŐXčUUǍ@p,V=u;t"dC
zm/diL94ª2223ī2ū2q('% {jYonmmlllkkkjiihhhhgggeeeededisZ6/)/*H>RFSHWJ\OcUk\wfpz ,G;y *+fhx{ccONGGGGHHHHHHIIIIHHIIIIIIHHHHHHHHHHGGGGGGHHHHGGGGGGFFGGHGOPehy{Y\ 1 w X : # U9 *+yPf4c>x._Otۻݾ߾ݼܺ۶ٴرװ֭ԫԩ|ҦxѣuТqΠo͝k˚gɗdɕ`Ȓ\ƏXĎTTnj@p,V=u;t"dC
zm/diL83«2332ª2Ŭ2/QJ"'##zaonmmmmlllkkjiihhhhhfffeedded{]ND;
'#H?QFSFVI[NbTk]ueoz 'i[] BDx{z}jlUUHHFEGGHHHHIIIIHHHHIIIIIIIIHHHHHHGGGGHHGGFFEEHHXZorz}lo46 $a=! w X : # U9 *+yPf4c>x-_Otܽ߾ܹ۷ٴرְխԫԩ|ҦxѣuСqΟn͝k˚g˗cɕ`ǒ\ŏXčUUnj@p,V=u;t"dC
zm/diL94ê3332©3«2Ŭ2+<7 822ssnnmlllllkkjjiihhhgggfffedeea_OB
&"H@RF
QFTHZMaSjZtdoz "wC-& NO}~}wyhjZ[MNDDEEFFFFFFGGHGHGGGGGFFFFFFDCEEQQ[\jnx|z}rv>? #@{? w X : # =) *+xPg4c>x-^Qv߾ܺ۶ٴرװ֭ԪԨ|ҦyѤuСqΟo͝k̚gʘdɕaǒ\ŐXčUÊUȍ@p,V=u;t"dC
|n/diL94ª33ª3©3ª22ª1ƭ1~n(+( H>6jqnnnmmmlllkkjiiihhhgggfeeddfds_L($#
5/SHODSHXM`SiZtcmx +cTb EGux}z}z}uxkndf_a]^Z[WXWXWYZ\^__adgoqv{y}z}}hl89 3sV> w X : #
$ (*vOh4c>x-^Rv߿ݼܹ۷ٴرװ֭ԫө|ѦyѤuСrΞn͜k̚gʗeɕ_ǒ\ŐXčUUǍ@p,V=u;t"eC }o/diL:5ë3ª3ª4ª3ª22©3ǯ2/SI# ZMDkqponmmmllllkjjiiihhhgggfeeddjn[3./
4.SHODRHXL`Ri[scmw !FJA 12WZ|~z}y|y|y{x{x{x{y|y|y|z~rwKM&) -]JN\= w X : # )tNk4c>x-^Rv߿ݼܹڶٴرװ֭ԫԩ|ҦyѣuСrϟn͝k̚gʗcɕ`Ȓ\ƐXčUUǍ@p,V=u;t"eE ~p1diL:5ê4©4ª3ª43ª233Ǯ3+;5 m`Uopppnnnmmllllkjjjiihihggfeedgiw[H>64-SHODSHXM`RhYrc~lv $GsXS
/0IK`dtwnq[^CE')
/]IU[OX= w X : #
'pJo4d>x-^Rvݽܼڹٶ׳ױծԭӪѨ|ѦzФwϡsΟp̝l˛iʘeȕbǓ_ő[ÎWTTŋ?o,V=u;s"fE r2ciL:5ê4©5ª3ª3©4ª32¨3é3Ǯ2zl($" |kaxqpponnnlmlllkkkjjihhhhgfeecdfc_RJ
4.RGODRHYL_RhYqb~lw )>Yĸotkh n
")+46?AHJNPQSRSQRMOFH==13')
18jK\b\UOY= w X : #
! $hEw4e>x,]Y}۰ۭ~ڪzبw֦sբnӞjҜeЛbΗ^͔ZˑZєBt,V=u;s#gF t3ciL:5ë45©4©3©3©4ª223Ʈ31qd')& %$)mZppqqonnnnllmmmkjkhhihihfffeechll[I# 6.QGQF
RGWL_RgYrcmx )Bν`h=3'
1z@mD_(
34ZCyVgi`ZZWOY= w X : # ' - 1 3 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 57 01!_?4e>x0`@fqwoomkihfdb`]\[YWV~U}R|P{OzMxKvHuFtEsCqApAq5a.X=t;r#hF u3ciL:5ë44©5©5ª3©4ª43«33γ41VN$
*%#u\uoqqpoonmlmlmmkkkjiiihhhgffeddgkV1..71ODRFSGXK_RhYrcny (AϾ`kF- WtV5j@a2I , /0M=eHz[otld`^\ZWOY= w X : #
" 0 < E L O Q S S S S S S S S S S S S S S S S S S S S S S S S S S SS L M T85e=w5f+W ~M }M N N!N!N"O"O"O#O#P$Q$Q%Q%R%R'R'R'S(S(S(T)T)T*U*U+U+V,V,V-X3`;q;s#hF u3ciL96ë555«5ª5©34ª4ª3ª32ī2,B[:U9U;W?]DgLvTYcx}ulgeeb^\ZWOY= w X : #
0 B S ` i m p r r r r r r r r r r r r r r r r r r r r r r r r r r r s l jL35g?{;r=tAxAx@w@x@x@w@w@w@w@w@w@w?w?w?w?v?v?v?v?v>v>v>v>v>v>v>v>v=u=u=u;s>v;swoqqpqoononllmlkkjiihiigggffdbhcVI@
'$LBSGRGXM`Sj[ueq| )Aо_jD. MtwhZ~wqomljgda_\[WOY= w X : # (= S g y H05f=uvrrrqqqpooonnmlmllkjjjhhihhgfeebizgR/+)81RGRGTH[NdVm_zhv )Bо_jD. Mtwi^}{wuroljgda_\[WOY= w X : #
I J 6-
#@Zu
}r0Ϳci®L:7ì6«6ê5ª6«5ª5554©4ª4ª4ª42̲5¨3cY%## !l]Qwssrqqqpppnnnmmmllkkjihhihhggffaoq\4..81RFRFUJ[PdVp_~lx (Aо_jD. Mtwi_}{wuroljgda_\ZWOY= v W : # +* V/.83243320/-+y*)s('n&&k&%h&%h&%h&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%g&%f&%h&%iO4/w0݁t2Ղu2Ӂu2Ӏt2~q1{o1ym/xl.wl.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.vk.uj.{o.砑?diL:7ë6ª7«6ê5ª6«6«5ª4ª55©4ª3ª3ª43ʰ4é2aW&#! '%$sdttsrrqqqqooonnmmllkkkjhhiihggff`pvb71/80THQFWJ^QgYtco| )Aо_jD. Mtwha~zwuroljgec_\ZWOY= u V 9 " )( A10^CBYVa__]`]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]_]a_WU0/$TLʸSgͿdͿdͿddddddddddddddddddddddddddddddddddddepfK;7Ĭ7ª7ª6«6ë6«6ª5ê5«55©4ª4ª4442Ȱ3¬9[S)! /+*puttsrqqqqppoonmmmlkkkjiiiihgfffbnyZ;2( ?8RGRGXK_Rk[xgs )AϿ^jD. Mtwha}yxtroljgda_\[WOY= u V 8 ! %$ #31_RPomnldbecfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdqpnl98!SJ^~jhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiijhϽ[I<8ī7ª7«7«6ë6ª65«6ª65455©4ª432ɯ39=7! H@! r S 8 ! $$ 43\TRhfUTA?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A>CA\[kh:9!SI_wȴQILLLLLLLLLLLLLLLLLLLKLKLLLLKKKKKKKKKKLKID=«8ì7ª7ê6ê7ë7«66ª6«55ª5©4ª5ª53332Ǯ4/40 navuttsssqqqqpponnmmlllkkjiiiihggdfiwY623($NDRFTI[OfWqb~nz )Aξ^iE. Mtwgb~zxuroljgda_\[WOY>" o R 7 $$ 43]SRdbMK6497=;<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:8686VTig99 SI_vI=?@??????????????>>?>>>====<<<<<<<<<<;<==;ª7ë7ë7ë7ë8ª7ê6«7«6ª6«6ª5ª544443302wk))' 0,+xxtttttrqrqqppoonmmmmllkjjihihggedm{e4/.5/TGPFWK_RhZufr} (@ν^iD. Mtwgd~zyvspmjgda_]ZVOY?$ h N 3 $$ 33]SRecPN;9ECLJKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKILJCA<:WUjh99!RI_w®K?AůBĮAĮAĮAĭAĭ@ĭAĭAí@ĭ@ĭ?í?í?ì>ì>ì>ì>ì>¬>ì=ì=«=¬<¬<ë<«<«;«;«;«;«:«:«:«:ª:ª9ª99«9ë8ì8¬7¬7ì8ë8ë7«6ê7ª6«6«5ª5ª5©4443311.->9 zk_vvuutttsrrqqqpponnnmmllkjjhighhgdfov`0++ @8RGSHZMaTm^zjv (?μ^iD- Mtwge}zyvroljgda_]ZVOY@& | c I 1 $$ 33]SRecPN=;JHRORPRPRPRPRPRPRORPQORPRPRPRPRPRPRPRPRPRPRORORORORPQORPROQOEC<:WUjh99!RI_w®K?ůBȲCƱBDZBǰBǰBǰBƯAǰAƯAư@Ư@ů?ư@Ư?Ư>Ư?Ʈ?Ů?Ư>Ư=ů=Ů>Ů=Ů=Ů=Į=ŭ<ĭ;ĭ;ŭ;Ů;Ů:Ů:ŭ:Ŭ9Ĭ9Ĭ9ĭ9ì8ì8ì8ì7¬7«8ë7ë8«8ê7ª6«6«5ª54553331.,+bW#%# 833tyuvttutssqqqppoonnnmmmljkjiiiiggddnoZ'### J@RGVJ\OfWrco{ '?̼]hC- MuwiZ~~~}{ywusrpnmkihgec`^]\ZYWTTQLY@( w ` H 0 $$ 33]SRecPN=;LJURUQSQSQSQSQTQTRSQTRSQSQSQSQTQSQTQSQTQUQSRSRSRSRSQTRSQROPNCB;9WUjh99!RI_w®K?ĮBǰCįBưBƯAƯAƯBůBůAŮAŮ@Į@Į?Ů@ů@ů?ŭ?ŭ?ĭ?ĭ>ŭ=ĭ=ĭ>ĭ>ĭ=î=í=Ĭ=ì<ì;Ĭ<Ĭ:ĭ:Ĭ;Ĭ;Ĭ:ì:ì:ì9ë8ë9ì8ì8«9«8ë7ë8ë8«7ë6ª6«6ª5455431/,)%]S"'% x|uvtuuttssqqppqpnnnmmmlkkihggggfeedmp_O,'SGSGXK^Rj\xgt '?ʺ]hC- Krwv]dfeededdccccbbbbaa`a``___^^^^][f@( |v _ H 1 $$ 33]SRecPN>ŭ?ŭ=Į=Į>Ů<ŭ=ŭ<Į=î<í;ĭ<Ĭ;ĭ:Ĭ:ĭ:ĭ:í:í:ì9ë:ë:ì8ì8ë9ì8¬8ë7ë7«7ë7ª6©6ª5ª55331/-*&f[!-+ w}vwuuuttttrrqpqqonnmlnnmonnmlllkihgcjUI@<4SGTHYNcWp`~ly &=ɸ\hB- MswA( { c L 4 $$ 33]SRecOM?=RP\Z\Z[Y[Y[Y[Y[X[X[Y[Y[Y[Y[Y[YZY[Y[Y[YZYZY[Y[Y[Y[Y[YYWVTTQPNCA;9WUjh99!RI_w®K@ĮCDZCƯCƯBŰBŰBƯBƯAůBůAƯAƯAŮAů@Ů@Ů?Ư?Ư?Ů?Į?Į?ŭ>ĭ=Į>Į=ŭ>Ů=Į<ĭ<Ĭ<í;í;ì;í;ĭ;ì;Ĭ:Ĭ:ë:ì:ì9ë9ë8ì8ì9¬8ë8«7ë7«7ª6566531/,*u&WN!&% u}wwvvvttutssrqpqppqqqponmlkrsrmhiihjgg>63 KATGWK^QhZvfs%<ŵ[gB- Ouj@& l S 9 # $$ 33]SRecOM?>US_^^^_]_\^]^]^\_\_\_]_\_\_]_\^]_]_]_]^]^\_\_\_]_]][ZXVUTQPMCA;:WUjh99!RI_w®K?İCDzDƯCưCưCƯBŰBŰBƯBƯBŰAƯ@Ů@ůAƯ@Ư@Ů@Ʈ@Ư@Ů?Ů>Į?ŭ>ŭ=ĭ>Ů=ĭ=ĭ<ŭ=ĭ=í<ĭ<ì<ĭ<í<Ĭ;Ĭ:ì:Ĭ:Ĭ9ì:ë:ë9ë9ì9ë8¬8«8«7«76554320,)u&KD" A:5w}xxwvvvuutttsrqqssqrp|as[|kWk[IbRAaQAaSI\PK\PH_QCbR>iXFvcPsXkght_-)'5/RGUIXMcVo`}mz$;³ZfB( 6V=NMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNH+h t Z ? (
$$ 33]SRecOM@?WUd`c`a_a`bab`a`a`b`b`b`a`b`a`b`b_b`b`b`b`b`a`b_a^^\ZXVUTQPNCA;9WUjh99!RI_w®K?ŰCɲDǯCǯCǰCưBưBůCưBưBƯAůAƮ@ƮAŮ@ů@ů@ů@Ư@Ů?Ů?į>Į?Ů>ŭ=Ů>ĭ>Į=Į<î=Ĭ=Ŭ=ĭ<Ĭ;í;ĭ;ĭ:ĭ;ĭ:ì:ī9ī:Ĭ:ì9ë9ë9ì8ë8«77654320-*s%JC! /+,{fzzxxxwwwvuuutttttsmv_ucQ]QFD;560-'&)
! ";3,WLDjZF}\ptaP D;SGWK]PhZvfs"9X˾dA+# !5 $7!5"6"6"7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7#7"7
%: + | ` C * $$ 33]SRecOMA?YWgdfdecececececedececececececececececececececdba`^[ZWVTTRPNCA;9WUjh99!RI_w®K?ŰCȲCƯDƯDƯCƯCưCŰCưBưAƯBƯAƯAƯAů@ŮAůAƯ?Ʈ?į@Į@Ů?ů>Į?ŭ>Į=Ů=Ů=Į>Į>ĭ<ĭ<Ĭ=í<Ĭ<í;í;ĭ;ĭ:Ĭ:Ĭ:ì:ì:Ĭ9ë9ë9ë9ë8ª876542/-*q&HA" ,*+teY}{zyxxxxxwvvuuuwuhzgTWKC711
NC7}]mOC9'#PEWKXMcVpa~mx 6UǺbDm`$RGSFWHWHWHWHXHXHXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIXIYJRE($
c E + $$ 33]SRecOMB@\Zjijhigigigigigigigigigigigigigigigigigigighfdba`^\ZXWTSRPNCA;9WUjh99!RI_w®K?İDDzEưDưDưCưCůCŰCŰBůBưBƯBƯAůAƯAƮAĮAį?ů?ů?Ů?Ʈ@ů?ĭ>ŭ?Ů>Ů>Ů>ĭ>ĭ>Į>Į=ĭ<ĭ=Ĭ<ĭ<ĭ;í;Ĭ;ĭ:Ĭ;Ĭ;ì:ì:Ĭ:ì9«9ª876542/-)vh&G?" GB>}l\}|{{zyyyyxxwwvvvmzhUK@9! !YKAc}a1,)
C:UHVJ]QiZwfr 4Rƻhȼdʻ]Ͽ_`````````````````````````````````````]I[Q f G - $$ 33]SRecOMCA_]nmnlmkljljmklklkmklkmkmklkmkmklklkmkmkmkkkhgdba_][ZXVUTQPNCA;9WUjh99!RI_w®K?ŰDɲEǰDǰDǰDưCƯCƯCưBưCŰBůBƯBƯAůAƮAƮAůAů@Ʈ@Ư?Ư@Į?Į?Ů>ŭ?Ů?Ů>Į=ĭ=ĭ>Ů>Ů<ŭ<ĭ<Ĭ<ĭ;ĭ;í;Ĭ;ĭ:ĭ;ĭ;Ĭ:ì:ì9ë8876420-(i\$73! +))bVLu~||{{zzzxxxxxwx{gOF@ t\wgXJ(%NDWKXLcUp`~m 2K÷amprsssssssssssssssssssssssssssssssssssswwWVN h I -
$$ 33]SRecOMDBb`qppoomompnpnomonpoonpnpmomoopoomomonpnonlkhfdca`^\ZXVUTQPMCA;:WUjh99!RI_w®K?ŰDȲEǰDưDưDǰDưCưCƯCƯCƯCưBŰBŰAƯBůBů@Ư@ƮAƮAŮ@Ư@Ů?į@į?Ů?ŭ>ĭ>Į>Ů>Ů=Į=ĭ<Į=î<ĭ<Ĭ;Ĭ;ì;ĭ;ĭ;í:í:Ĭ;ë:«9ª887520.*bW%,+! ! ! ! D=:sb}}|||{{{yyyx|wn[?86
n`SlhE<7 B:TIVJ_Rj\vg w0>EJLNNO¯OOOO¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯O¯OïP¯P¯NïMͺYlVVM h I -
$$ 33]SRecOMDCdbusustrtrtqtqtrtrsqtrsrsrtrtqsqtrsrtrsppnmkhfdca`^\ZXVUTQPMCA;:WUjh99!RI_w®K?ŰDɲEǰDDZDDZDǰDưDưCưDưDƯCưCưBƯBŰBŰBưBƮAƮ@Ư@ƮAŮ?Ư@ů@Ů@į@Į?Ů?ŭ?ŭ?Į>Į=Į=Į=ĭ=ŭ<ĭ<í<í<Ĭ;í;í;í;ë:ë:«997530.~*aV%.+! ! ! " %##[QJq~~~}|||{{{zyzuxgV/+(
###/0/;:;LLLUUVTSTNNOPPQNMNIHI666[NBcm{hU!!$)&NDYLZMeXrcp$~+-02334444444333333333333333222212221123<ƴSjVUL h I -
$$ 33]SRecOLEDgeywxvwuwvwvwvwvxvwuwvwvwvwvwuwuwvwvutsqpnmkhfdca`^\ZXVTTRPNCA;:WUjh99!RI_w®K?ŰDɲEǰEDZDƱDưEǰDǰDưDưCƯCưCưBưBŰBŰBưBƮAƯ@ư@ƯAů@ƮAƯ?ů?ů@į@į?Į>ĭ?ŭ?ŭ>Ů=Ů=ŭ>ĭ=ĭ<ĭ=Į<í;Ĭ<Ĭ<Ĭ:ê:ª:98642/s*QI%+)! ! "!" 1,,seY|~~}}||||z{}ua,(&
$$$???VVV|{|kkkgWKjhjWK?
@8VJWKaTn_|lz !"#########"""!!!! !8ǵVkVUL h I -
$$ 33]SRecNLFEjh|z{yzxzyzyzyzy{zzzzzzyzzzzzzzzzyyxvurqpnmkifdca`^\ZXVTTRPNCA;:WUjh99!RI_w®K@ŰEȲGŰEDZEDZEǰDǰDǰDưDŰCƯCƯCƯCưCưCůBůBŰBƯAƯ@Ư@ƯAŮAƯ?į@į?Ʈ?ů>į>Į?ĭ?ŭ>ŭ=ŭ=Ů>Į=ĭ=ŭ<ĭ<ĭ<Ĭ<Ĭ<ì:ª::97630w+HB$ !! ! ! ! ! ! ! $"" D>;xg~~}}}||}oG@? '''PPPJJK
n\peluY1,(
/)ODYM\OiZxgv !! 7ǵVkVUL h I -
$$ 33]SRecNLGFmk~}~}~|~|~|~|~}~}~}~|~}~}~}~}}|yyvusqpnmkifdba_^\ZXWUSQPNCA;9WUjh99!RI_w®K@ŰEȱFưFƱFưDDZDDZEƱEDZDŰDƯDƯCƯDǯCǰBŰCůCŰAŰAƯBƮ@ƮBŮAĮAį?Į?Ư?ů?į>Ů>Į>į>ŭ>Ů=Ů=Į>Į=ŭ<ĭ<ĭ<ì;¬;¬;;:9741x,JC& " !!!""!" " "! ! !!!"!"%#&XNGr~}||~vtcQ @@@jjk-))cmfgkfWF ! E=XLYLdVrbp !#""######"""!"! !! "8ǵVkVUL h I -
$$ 33]SRecNLGGon~}|yyvusqonkkhfdba_^\ZXWTSRPNCA;9WUjh99!RI_w®K@ŰEȲFǰFưFưFDZEDZEƱEDZEǰDƯDưCưDǯCưBŰCƯCůAŰAƯBƮBŮBƮ@ĮAƯ?ƮAů@į?Į@Ů?į>Į>ŭ>Ů?ĭ=ĭ>Į=ŭ=ĭ<í<ì;ì;;:8751y-JE& " "#"!"""!!"!!" "! !"!" !(&&naX{Ī~}}}~pND> WUW q`Riihglw]0,,
;3SHXL`Sm^}l{ ""#"""##""!!! !! !8ǵVkVUL h I -
$$ 33]SRecNLIHrq}|yyvusqonkjhfdba_^\ZXVTTRPNCA;9WUjh99!RI_w®K@ŰEȲFǰFưFưFǰEDZDDZDƱEǰDƱDưCưDƯCŰCŰCưBŰBŰBƯAƮBůBƯ@ů@Ʈ@ƯAŮ@Į?Į@ů@ů>Į>Ů>ŭ?ĭ>ŭ=Ů=Ů=ĭ<ì<ì;«;;9742{.LE' " "#""#"#! #!!!!!!! ""!! /,,}n]ī~~~zh1/2 POQ#""?89hniihgmgXN
,'LBYM\Pj[xhv "##""###""!!! !! !8ǵVkVUL h I -
$$ 33]SRecNLJIut}|zyvusqpnljhfdba_^\ZWWTTQPNCA;9WUjh99!RI_w®K@ưFɳGƱFƱFDZEDZEǰEDZEǰDƱEDZDưDưDưDƯCƯCưCưCŰCůBƯBưBůAƮAƮ@Ư@Ů?Ů@ů@ů?Ů?Į?Ů?Ů>Ů>Ů=ŭ=Į=ĭ=ì<«;;:853}/NG) # "#"##"#!!#"!"!!""!"$"# ! 733wg~|kY 000&''"! t`oljiihms]%$) B9YMXMfXtcr !"""##""#"""!!!! !8ǵVkVUL h I -
$$ 33]SRecNLKIxv}{zxvusqpnkkgfeca_^[ZXWUSQPNCA;9WUjh99!RI_w®K@ưFɲGƱFƱFƱFDZEǰEDZEDZEDZDǰDƱEưDƯCƯDưDŰCůCƯBưCŰBưAƯBƯBƮAŮ@Ư@ƮAƮ@Ư?į@į@Ů?Ů>Ů>Į>ŭ=ĭ=í=ì<«;;9741QJ)""#! ###"#!""""!!"!!"!""#"" >:9qseR EEE**+ s`LknlkjiijeVJ@ 92UJWLaTo_n} !"#########"""! !! "8ǵVkVUL h I -
$$ 33]SRecNLKJyx}|zyvusqonkjgfeba_^\ZWWTSQPNCA;9WUjh99!RI_w®K@ŰGɲHDZFDzFƱFƱFDZFǰFDZEDZEDZEƱEưDưCưCƯDƯDƯCǯCưCŰBŰBƯAưAƯBƯAƮ@Ư@Ư@Į@Į@į?į?Į?ĭ?Į>Į>ĭ=ì<«<<:763h]+*($ #####"#""#"!#"!#""#""# "?71wsdS HHH///gZSjmlmlkjiiklR.)LBYM^Rl\{kx !"###$$##""#"!!!! !! "8ǵVkVUL h I -
$$ 33]SRebNLLK|{}{yxvusqpmligfeba_^\ZXVUTQPNCA;9WUjh99!RI_w®K@ưGʴHDZGDZGDzFDzFƱGǰFǰEǰFƱEǰEDZEǰDƯDƯCƯCǰDǰDƯCưCưCůBƯAưAưBƯAƯ@Ů@Ů@ů@į?ů?Į@Ů@ŭ?ĭ>í=«<<;863oc-0.&""$#"$#"##"##"$""#""#%#$ !PIBvxhW ?>?334\QJnpnmlmmkjjl~_632 A9ZNZNhYwgu "#$$####""#"""""!!! "8ǵVkVUL h I -
$$ 33]SRebNKML~}|zywusqpnljhfdba_^\ZXVUTQPNCA;9WUjh99!RI_w®KAưGʳIDzGDZGDZGDzGDZFƱFƱFƱEǰEDZFDZEưEǰDǰDưDưDƯCƯCưCůBŰCưBƯBưBŰBƯAƮAƮAƯAů@Ư@ů@ů?Ů?ĭ>«==<:84re,1.%#!$%#$$"$##$$#$#"###$$#% " UKE}ŭtc##( 444878 VKDkqpnmmlmmljjjq`P
?7[NWKdVrbq "#$##$$$##"##""!"! ! "8ǵVkVUL h I -
$$ 33]SRdbMKNM}{yxvusqonkkifecb_][ZXVUTQPMCA;:WUjh99!RI_w®KAưHɳHǰGȲGȲGȱGDZFDZGDZFDZEưEưFDZEDZDDZDǰDưDưCưCŰDƯCƯCưCưCưBƯBƯBƯAů@ůAŮ@Ů@Ů?Ů?Į?ĭ>Ĭ>ª=<;85qe.30'! %%#%%#%$#$$#%##$#"$$#$""$ TJD|Ůªl855 tss?@? OG>krqpponmlmmkkmx] "1,PEYLaSn^~m{ "#$##%%$$##""#!!"!!! #9ǵUkVUL h I -
$$ 33]SRdbMKON}|yxvusqonlkhfdba_^\ZXVUTQPNCA;9WUjh99 RJ^w®KAƱHʴIȲGȲGDZGDZGȱGDZGDZFDZFDZFDZFưEDZEǰEưEƱEDZDDZDưDưCưCƯBůBůBŮBŮAŮAĭAĭAĭ@í?í?í?í?ì>«><:871FA)$&$%%#%%$$$$$##%##%$#%%#% OF@{ȰìqIB> JIKHIH KA:jsqqpqooomlmmllaA91%#F=ZM^Pk\{ky !#$$$$%$#$###""##"""! ! #9ǵUkVUL h I -
$$ 33]SRdbMKPO}|yyvusroolkhfdca_][ZXVTTRPNCA;9WUjh:9 RJ^w®KAưHɴIDZHȱHȱHȲHȲHDZGDZFDZFDZGDZFưEǰEDZEDZEǰEưEưDƯDůCůCŮBĮBĭBĬAíA@¬@«@«????>>=;973TL+$#%""%&%&%#%$#%$#%$#$%$%&%& PHBzɱĮ««nbS "^__ H?7iurrrqqponmmmllklqcW ?7[OZNhZwfu !#$%%%%$$$#$##"#"!!!"! ! $9ǵUkVUL h I -
%$ #43]SRdbMKQP}|yyvusqonljhfdba_^\ZXVUTQPMCA;:WUjh:9 SJ^v®KAƱIʴIDZHDzHȲGȱGDzHȱGȱGDZGƲGƲGDZFƱEưDǰDǰEŰEůDŮCĮCíB¬BAB@A@?@??>>==<:86i_.(&& %('&&$%%$&$#&$#%%$%%$% IC?yɲŮ¬ì«««~h-*, 788{zz! ! A;4fwsssrrpqponnnmllnyb70VJYMdVsdr !#$%%%$$%$##$###"!!!!" ! $9ǵUkVUL h I -
%$ 43\SRdbMKRP}{zxwusronkjhfdba_^\ZXWTSRPNCA;:WUjh:: UJ^v®KADZIʴIDzHdzHȱGȱGDZHȲGȲHDzGƱFDzFƱEƱDŰEůEůDîDC¬CBBA@???>=<<<;;::985vh/74(""%&%'&%&&$%%$%%%%$%%&$& !GBC}ȱƯ¬ììì¬ë««ª|]SL GHI,+, ;77iyuuutrrppqponnllmma610/)NCYMaToao} "%%$$%%%$$$#$$###"!!" !! $9ǵUkVUL h I -
%$ 43\SRdbMKRP}{zxwusrookkgfeba_]\ZXXTSRPNDA;9WUjh;:"VLϿ^v®KAǰIɳKdzIȲHDZHDzIȲHDzGȲHDzFƱFưFưEůEĮEECBCA@@?=<<;:9888877564r/94( &'&&&%&%%&%%&&$%&%&&&& !?;;|ʲƱ¬îíìĬ쬫««zh&%' ECDAAB 510|j~vvvuutrrppponnmllng[OD'#G=ZN_Sm^|kz "%%$$&&%%$$#$$######!!! ! $9ǵUkVUL h I -
%$ (43]SRdbMKQQ}{{wwusrpolkjfeda`^\[YWWTRPONCB<9WUjh;:#XNϿ^v®KAưIɳKDzIȱHDZHDzIȲHDzHDZGƱFŰGĮFĮEíDCBAA@>=<;98765553332211u.F@)#$(%$('&&%%&%%&%&&&%(&$' 20/~oǰȲîĮůįíìì¬í«ë«ªk^V !$$% %#%r`|xvwvuuutsqppoopnmlmm|jX ?7[N]Pk\yix "$%%$$%&%$$%$#$$""##!!! $9ǵUkVUL h I -
%$ ,43]TRdbLJWU}{ywvsronkihfdc_^[ZXWTSQEC<:WUjg<;%ZQϿ^v®KAƱI˵KDzIDZHȱHȲIDZHƱHƯGůGíF¬FDBA@@>;98764321~0|/z/y-x-w-w,v,v,r+YO)&%'##((''%%''&''%'&&&&'' "('+yla¬ȱƯůįůůĮĮíìíìì««§uD=; l]Swywxwvvuuusrqpppponmlpg:3[O[NhYwfu "$%%%&%%%%%%$#$$""""#!!! ! %9ǵUkVUL h I -
%$ +43[SRdbMKOM~|{yxwutrrpnmkjhgfdcaa^][[YXWUSQOOMMKKI@>;9XUig<<%]S;^v®KAƱI˵KȲJDzJDzHDZHƱHŰGîG¬FDCA@?=:88542}/y.t-r,p+|n)yl)wj)wi(vi(uh'ug'tg&th&f[&40(&$((''&''&%('%('%''&(""#%$%g]YɴDZƯƯŰİįįůĮîíĬí¬«««~k2-, UJEq{yyyxwvvuussrqpppoonmmd7124-THZNdWscr !#%&&&%%%&%$%$#$$"""#""!!"! %9ǵUkVUL h I -
%$ -43ZSRdbML21,*+*+*+*+*,+,+,+,+,,,+-+-,-,.,.-.-.-.-.-.-/./.0.0//.0/0/0/101075VThf=<&]S;]v®KADZIʴKDzHDzHDZIŰHįGFEDA?>=:863}1y0t.~q,zm*wj)ug'rd'oa&m`$k^$i^$g\#g\#h\"fZ"g[!`U"<8&&&)&%)''('&'''(&'''&($"%"!$QKF̶DzƱŰưůůưİįŮįîíĬì쫪ª|k:43 831g~{zyyyxwvuuttsqqppponmnhWLC)%I?[OcUqbq !#%&&%&'&&%$%$#####$""!!""! %9ǵUkVUL h I -
'& $64YTRhf[YLJPNPNPNPNPNPNPNPNPNPNPNPMOMOMOMOMOMOMOMOMOMOMOMOMOMOMOMOLNLNLMLMLa_ki==%\Q;^v®KAưJʴJDZIűIïHíGFDCA?;974}2x0s-|o+xj(se'pc&l`%i]$dX"bW#aV"_T _S ]R \R \Q \Q [P YO F@$%%)&%)(&('&(('(('''((&&'!!#>:;zһƱƱDZƲűŰůůůưůįŮĮíĬí¬ëë«rC?< 2-.}k}{zzzyyxwwuttsrqpppponoihWG*%I@ZNaTo`n } !$&&%%&'&%%&%$%%$$$#""""!!"" !! %:ǵUkVUL h I -
'& -31ZQOusqo87$YOϿ^v®KAƯJȲJįIîHFFDA?=:64z1u/|p,wk*rf(l`&g\%dY$aV"^T!_S!A: @;$C=%A<$A;$A;$@;#@:#@:$B;!C; 0/((')('((((('('&)'&)('(""$745~rϹdzDzȲDZƱƲDZDZűůƯưůĮůĮîíĬĭ«ë«oa[.*+ RIEs~|}|{zzxxyxwvuttsrqqqpponoud ! A9[N`Sm_}l{ !$&''&&''&%%&%%$$$$###""""!!! !! %9ǵUkVUL h I -
43 5443[4354656565757676767676767676767676767676767676767676767676767676767676767687('
(TL^wJAïJƱJHGDB@=;84x0q.yk+sf)ma'm_%]R%HB'E@'75)+*++*,++,*),)),))+))+))+))+))+)(+)(*)'))(*((*)(*(')('((()'()))+!!$+)*wlaȳʵɴȳDzȳDzƱDzDzŲűưůưưůĮůĮîĭĭ¬¬¬©oqbTi[Lo`|~~}|}}{{zyxyxwvvutsrrqppoope 92[O^Qk\{jy !$&'''&''''&%&&&$$%$#$#""!""""! %9ǵUkVUL h I -
PL32++ b F" 04 !K e
QH ^vJ@HîHFCA?<85x1p.wj*tg(f['XN'?:)/.,/-,-+-,+-+*-)*,*),*),**,*),**,))+(**(*+)(+)(+))*())))))()((*)())'))'**(*'&'%%'TMJӽDzȳɴȴdzȲȳȳƱƱDzƱŰƯŰưůŮůįíĭĭ쫪~}}|||{zzyyxwvutttrqqpqppf/)(82ZN\Ph\yhw #%'''&''&'&%&%%%%$%$$#""#"!!""! %9ǵUkVUL h I -
! Ѹ
$4/q'uv"uh h\^SXNUKSJSIRISHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSHSIPGPG{m)ʺYtI?FFCA=85z2r/|m+ka)YP)>:+10-/.-,*-))-)+-*+-+*,+*-,+,-+-,+,,,,-,----.,-.---,,,+,,+-,+,,*,+)**)*))*((*)'*)()*))$$'<87nйɶʵʵɴȳɴȴdzȳȳȱƱƲDzƱűŰưƯůůůïîĬ쬬«ª~~}}}{{{zyyxxwvuuutsrqpppiJBC 1-SH]PhZwgv #%'''&'''''&&&&&&%$%$$#"####!!"!%9ǵUkVUL h I -
shE >>Mĵ[´\ZYYYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXUVisH>ED?<8}5w1}o,bX+B=-53-20-+*.)(.**.++.-,.-,.-,..,--,----/-/---*)*&&(##&!!% #!#&#& "!!%$$&)()-,-*)+*))*(*)(***+$#&>::wԾƳʶɶʵɴȳɴɳȳȳȳDzDzDzƲƱƱưưŰůŮįįĮĭìí¬ë«ª~}}}||{zyyxwvvuttsrqpqqk]PG *'JA\PgYuet #%''((((('&''&%%&%$$$%#$#""##"!!&9ǵUkVUL h I -
{. }
<ɼ_umlmnoooooooooooooooooooooooooooonnmlmeG,32.**0**1..///..-..,/.-/.-/.-.0-.-,-&&)##'735aYT|rλŭ˱ͳ̰ͲƮűyme>:9##%)()+*+)'**)+$%& #RJIԿȴɶɶʵʴȴȴɴɴɳȳȳDZDzDzDZŰůƯưƯĮĮůĮîĬ¬¬ë«ª~~~~}}{z{yxyxvvvtttsrpqno^M )&H@[OdWscr #&((('(('(&&''''%%&&$$%##$$""##!%:ǵUkVUL h I -
y- s <̿dkGAFFFFEEEEEEEEEEDDDDDDDDDDDDDDCBCBB@?>;88{4ka0NH0860*,0*+10/01///-/.-..../-0/-/.-/,+.$$&/-/ZSPxoů϶ȯĬѿ̻ʹʸʸɶ˸ƭѽUNM##&&%',+,)(*,*+%%'((*g^XλɶɶɶʶʵʴɴɴɳȳȳdzDzDzDZDzŲůƯưůĮůįîĬĬ¬ë«ªª~~~}}|{{yxyxwvuttttsrppp_#"" $"D<[OcWqcr #&(((()('(((''''%%&&$$%$#$$$""#"&:ǵUkVUL h I -
y- t <̿dmHFƲRȴTƳRƳQƳQƳQƳQƳQƲQƲQƲQƲPƲPDzPƲOƲOŲOŲOƲOŲNƲNŲNŲNƱMŲMűMűMİLįKįK®KKIGD?:7~q4^W1960&&1**11001000.0/-//-00.0/./...,+,'&)=::d]W}sʳ϶Ʈν˺̺ͻϻϼннϽϼλ˺ʸμëc[U(&($#&,+,*(*+)+#$%1/0uk˸˶ʶɶʶʵʴʴɴɴȳȳȳDzƲDzDzƱŰưưưůůŮíĭì¬ë¬«ªª~~}}|{{zyxywuuuttsrpsp'%% <5]PcUqbq #%'((())(((('&&&''%%&%$$%$$##$#"&:ǵUkVUL h I -
y- t <̿dmHIWϺYXXWWVVVVVU̸U̸U̸T̷T̷T̸T̷T̷S̷S˷S̷S̷R˷R˷R̶Q̵P˵PɴPƱNïMJGC>8pf5HD20/0,,11112010.10.10.00.1//0.-/,,-('+B>=g_Z|ɷϹưμ̺μоϿϿϿннммϽϼμϼμ̺˹°i_X''($%&+*+**+'&(##%LFEҽ̷ʷʶʵɶɶʴʴɴɴȳȳȳDzDZDzƱDZƱŰưưůůĮîíìì쬪ª~~~}}|{zyyyxvvuttsrqtq)&& 82]PcUpap #&())(()(((('('&'&%%&&%$%$##$$""':ǵUkVUL h I -
y- t <̿dmHH˷WW˷V˷W˸W˸V˶V˶V˷UʸTʷT˶U̶T˷SʶTʶTʶSʶR˷RʶS˵R˶RʵQʵQɶQɵPɳOɳODzOŰNLIFB>8e[3:72))2..12110/10/10/1//0//10.1,,/((*988ZSR}ѹìͼϾѿѿѿѿпппϾϾнннϽϽϼμμμ˹нh`Y'%(%%(,+,+*+%$''')si_ɵι˷˷ʶʵʶɶɵʵɴɴɴȳȳȲDzDzDZDZűůůưůůįíĭí¬ì쪪ª~}}|{zzxxxwvvuttsrse)&#
93\PbUo`o #&(()))))(((((''''&&%&&%$$$$$##"&:ǵUkVUL h I -
y- t <̿dmGI˷WX̸W̷W̷W˸V˷V̷U̷V˷U˷U̶U˶T˷T˶S˶TʷSʷR˶R˷S˶S˵SʵQʶQɶQʵPʳPȳOƲOîMKHC?y9ZS3002-,22111110/11011000/00/1.-/,+-424NIGwoȶ̷íνѿѾппϾϾϾонϽϽϼμλ̺_XS!"%))*+*,('*%$&D@>Ҿκʶ˷ʶʶʶʶɵʵɴɴȳȳdzȳȲƲDzDzűŰƯưůĮĮĭíììë묪~}}||zyxyxwwvuttsth*'$ 83\PaTn_n } #&())()*))))(''(('''&%&&%%%$$$$#':ǵUkVUL h I -
y- t <̿dmGI˷WͺY̸W̷W̷W̷W˸V̸V˷U̷V̷V̷U˷U̶U̷T̷TʷTʷSʶSʶRʶR˵RʶRʵRʵQɴPȳPDzPİNLIE@t9HC4&'20022121021020020/11/1001-,.,+.@==rjc˵ůҿпѿпппϾϾϽнϽϼϼμͼнNHH!!#+*++*,&%'$#'riaɷм˸˷˷˷˷ʶʶɶʵʴɴɴȳDzȳȳƲƲDzƱŰưưůŮĮĮĭĬ¬¬ì«ªª~}}}|{zyxyxvvuuttti0+( 82[O`Sl^~m } #&(()))**)()(''((''&'&%&&%$$$$##':ǵUkVUL h I -
y- t <̿dmGI̸XκX̸W̸X̸W̷W˸W˷V̸U̸U̸V˸U̷U˶T̶U̷U˷T˶T˷TʶS˶SʶR˷S˵RɴPɴPDzOįOLIEAt:KF4**3212103113202102102102101.-//.0MHFðȳîîîî¬ѿѿппооϾонϽϼλҿнu<87%%(++,)(*%$'FA@ѽϻ˷˸˶˶˷ʶʶɶɵʴɳɴȳdzȳȳƳƲDzƱűƯưůįįĮííí¬ë««~~}||{zyxxxwvvttuk830 93[O_Sk]}l { #&(**)***)))(('''(('&'%&&%$%%$$#':ǵUkVUL h I -
y- t <̿dmGI̸WκY̸W̸W̸X̷V̸V̸W˸V˸U˸U̸V̷U˷U˶U̶U̷UʷSʶS˷T˷TʶR˶RʵQɴQdzPŰOMJF?}q9KG5**2323213213113112212213002/.0968ia\ǴDzİïïﯮ®îíѿппϾϾннϽͻʶul1.1'&(++,'')%%(xnd˷ҽ˸̷̷̹˷˷ʶʶʶɵʴɴɴȴǴȲȳƲƱDzƱŰƯưůĮĮĮîìì¬ì«ª~}}}|zzyxywvvutul?96 72XM_Sl]|l | $&(**)***)*))))''''('&&%%%%%$$%$(;ǵUkVUL h I -
y- t <̿dmGI̸XκZ̸X̸X̸X̷W̸W̸W˸W̸V̸V˸V˷U̸V̷V̷T˷TʶU̶T̷S˷SʷSʵRɴRȴQƱONKHBvk8;70/.4214224224213213113324103,+.C>@}w̽˶ƲıűŰİİðïïïîîîî¬ҿѿпооϾϾнϼμ«¯nd^'&)**,))*""$WQMмκ̸̸̸̹˷˷˶ʶɶɵʵɴɴȳȳȳȲDzDZDzƱŰƯƯůĮĮĮĭíì¬ë««~}}|{{zxxxwvvuvnF>< 0+QGaTm^|l |!$')********)))))(''((&'&&&&%%%%$(;ǵUkVUL h I -
y- t <̿dmGI˸XͺZ̹YY̸W̸WͷX̷W˷W̷W̸V˸V̷V̷V̷U̶U˶T˷T̷U˶T̷TʷTɵRɴRƲPįOLIDz>JD6((3314433313324313213324112,,.LGG̷ƳıűűűűűİŰŰİİïïïîíѿѿппоϾнϼҿìSMJ""&,+,''(755uλҽ̸̸̷̹˷˷˷ʶɶɵʵɴɴɴɴȳȳȲDzDzƱŰưůůĮĮĮĭìì¬ì«ª~~|}}{zzyyxwvuvoIA? )'KBbUn`}m |!$')**)*+******)))(('''&''&&%%&%$(;ǵUkVUL h I -
y- t <̿dmGI˸XͺZ̹YY̸X̸XX̸X̸X˸W˷V̷W̸V̷U̷V˷V˷V̷T˷T˶U̷TʶSɵRɳRƱPNLF|>LF7-,5445444324224224324324214/-1WROɴ˷ųŲƲŲƲŲűűűűűűıİİįïïîîí¬¬ѿѿппϾϾͼ«оt301&'(+*, "kb[ðӿ˸̸̸̹˸˷˷ʶɶɶʵʴȴȴɴȳdzȳƲƱƱŰƯůůŮŮĮííì¬ë«~}}|{zzyxxxwuvnF@= )'JBbVoa~n }!%(*+**++++****)))))('(&&&&&%%&%$(;ǵUkVUL h I -
y- t <̿dmGJ̸Yκ[̹Y̹YYYX̸X̸X̸W̷W˷V̸W̷V̸U̸U̷U̷U˷T̶T˶SʵRȴRƲQ¯OMHAMH8+,4224634425325334224435213203a[Y̸̹ƲdzǴƳųƳƳƱƲƲŲŲűűűűŰİįį¯®îí¬¬ѿѿпϿпϾϾìf^W#%&**,""%IDCϼϼ˹ͺ̸̹̹˷ʷ˷ʶɵɶʵɴȵɴɴdzDzƳƱDZűŰƯƯįįĮĮĭí¬¬¬«ª~~|}}{{zyxxwvwnC=9 *( LCcWpbp "&(*++++++*++***(()))(''&&'&&&%%%);ǵUkVUL h I -
y- t <̿dmGJ̸Yκ[̸Y̸XXXY̸X̸W̷X̷W˸V˷W̸W̸V̸U˸U˸V̸V̶TʵSʵRȴRİPMKDOK9++42157554144243343245452140.2bZXϼʷƳȴȴǵǵǴƴdzƳƳƳųűƱƱűűıűŰİ°¯ïî¬ҿѿѿппμëGBB%%'*),*(,~sj̺ʸ̷̺̺̹ʸʷ˷ʵɶʶʵɵȴȳɴDzȲȳƱDZƱůŰŰįįŮĮí¬¬¬ë«~}|}|zzyxxwwwnB;8 *(MCeXpcq #&(**+++,+**+*)*))*))('((('&&%%&%);ǵUkVUL h I -
y- t <̿dmGJ̸Yκ[ͷYXXXY̸X̸W̷X̹X˸X˷W̸W̸W̷W˷V˸U̸V̷TʵSȵTƲRPMHg`=/.51/4866426535434334435212/-0[TSϻ˷ƳȵȵǴǵȵȵȴȴƴƴƴǴDzƲƲűűıűűııįðïîï®ѿѿпоѾϾëμxp.-/)(* e]W˹̸̺̺̹ʷ˷˷˷ʶʶʶɴȳɴɴȲȳƳDZDZƱűůįįŮĮíĬì¬ë«~|}|zzyxxwxwn?85 )'LBeWrcq #&(**+++,++*++*)**)((()((('&&''&%);ǵUkVUL h I -
y- t <̿dmGJ̸Yκ[YYYYX̹X̸X̹X̹XX̷W˸V̸W̸W̸V̶V˶VʷUʶTȴTİQNKwA?=7115866535546535436536213/.0TPMϼ̺ƵɶɶȶȵɵȵȵȴȵȴǴȴȵƴƳƳƲƲŲűűűűİİïïﯮ¬ппѿϾŮYRQ(&) !#NJFѾϼ̹κͺ̸̹̹˸˷˷˷˶ɵɶʵɴȳɴȴDzdzƳDZDZƱůƯƯůĮĮĭì¬ì«ëȰ˳˲ȯª~~}}|{{zxxxxo<74 ,)NEeXtc r #&)++++,,,+,+++***)(())(('''&&'&&);ǵUkVUL h I -
y- t <̿dmGJ̸Yκ[̹YYYY̹XYX̹X̸WͷX̷W˷W˷W˷W˸W̷V̵UʵTʶTƲS®QMEIF90/5556556535535436446325/.1MJIλͻȷɸɶɷɸȶɶɶɶȶȵȵǴȴȵǵǴǴƳƳųƲƱűűűİİİįïï®®¬ѿѿѿѿϾz:88$$&101{qκ̹λͺͺ̹̹˹̸˷ʶʶʵɵɶʵɴɳɴɳDzdzƲDZDZűůƯůůĮĮíí¬ȰǯëƮ~~}|}|{zyyxyo931 5/XMfYse s #')*,,+,,,+,+*+++))*))()()(''&&'&*;ǵUkVUL h I -
y- t <̿dmGK̹Zλ[̹Z̹ZZYYYX̸X̸X̸W̸X˷W̷X˷X˸W̸W˶U˵TɵSűRPKWP;/.65367675475355355564350/2DA@ͼμɷʸʸʸʸɸɷɷɷɷɷɶȵȵȵȵǴǴȵǴǴdzƳƲƲƲűűİİŰİİï¯î®ѿѿĬd]X)(* kaXİ©̺λλͺͺͺ̹̹˸̸˷˷˷ʵʵʶʵʴȳɳȳDzDzƱƲƲűŰƯůĮĮĮíĭȰzui\XPHVNFk`UqŬ~}|}}{zyyxzm0,)! ! <6`TeYte t $'*,,,,,-,,,++*++****)((()(''''&&*;ǵUkVUL h I -
y- t <̿dmGJ̹[λ\Z̸Y̹YZYY̹YYY̹X˹X̸W̸X̷W̷V˸WʷUʶTƳS¯QN}C327106966547557545545546002:9:~vpŵμ˹˹˸˸ʹʹʸʸʸʸʸɸɷɶɶɶȵȵȵȵȵǵȴǴǴƳƲŲűűııŰıİïﯮ¬¬ѿпѿĭ{><: RKFμͻλλκͺ̺̹˸̸̷˷˷ʶɵʵɵɴȴȳȲDzDzDZƱƱưŰůůĮĮíɲym_FA<*)* ##$?<7h]P|Ŭ}|||{zyxzo+('#"" ;6_SgYuf u $(*,,,,--,-,+,,**++))))(((((''''&*;ǵUkVUL h I -
y- t <̿dmGJ̹[λ\Z̹Z̹ZZZYYY̸XY̸YX̸X̸W̸W̸V˷UȴTŲSPHJF:447657657647547557767224325e_]ƹ̻̺˺˹˹˹˹˹˹ʹʸ˹ʹʸʸɸɷɷȷȶɶȵȵȵȴȵǴǴƳƳŲŲŲűŰİİðïﮬѿ«ųmc^#"&>:<ϼѾλμμͻͻͺ̷̹̹̹ʷʷʶɶʵʵɴɳȳdzȲȲƲƱƱŰưůůĮȲpeX+)) $"$'&&'&&#"$ !!"\SH~Ĭ~~}||{zzy{u,*)"!! <6aTh[wg w!%(*,--,--,-,,,,++++*)**()())''(''*;ǵUkVUL h I -
y- t <̿dmGK̹Zκ\[ͺ[[̹ZZZZYX̸YXXW̸X̸W̷VʶVdzTıRNlc@3274477776586576577685450/1RONͼ̻̻̻̺˺˺̺̺˺˹˹˹ʸʸ˹ʹʸʸʸɷɷɶȶɵɵȴǴǵǴǴƴƲƲŲŲűİİİİïî®®¬¬ȱC?>*(,~sk̹ͻϼμλλκͺ̸̸̸̺˶ʶʷɶʵʵɴȳȳȲDzDzDzƱƱŰưůŮȱq41/ &&'%#&%#$%$$%#$$#% ""!#l`Tê~~}||{zyzt+))" " <6aUj]yi x!&)+--------,-,+,,**+*)))*)(((''('+;ǵUkVUL h I -
y- t <̿dmGJ̹[λ]ͺ[ZZ̺Z̹Z̹Z̹ZYYYX̸Y̹XX̷WʶVȵVŲTRJ?;9448757657758667667667324EBBϽͽͼͼͼͼ̻̻̻̻̻˻̺˺˹˹˹˹ʸ˹˹ʸʸɷɷȶȶɵȵȴǴǴǴǴƳƳƲŲűűİİİïï¯˹ule d^W̻í̺Ͻϼμμλͺ̹̺̹̹˹̸˷ʶʷɶɶɵɴȳȳDzDzDzDzƱƱŰƯʴMGA ""##&%&$$%$$%$#%%#%$$%#"$ 2/.në©~~~}|{{zyzj)'("!" =7cVl^{k {"&*,----...-,-,,,,,+++*)))*)((((''+;ǵUkVUL h I -
y- t <̿dmGK̹\λ][[ͺ[̺ZZͺ[Z̹ZZXYY̹Y̸Y̸X˶VǴTǴSNf^@338758867768667657768446537tliʺννͽͼͼͽͼͼͼͼͼ̼̻̻̻˺˺˹˹˹˹ʹʸʸʸʸɷȶȶɶȵȵǴǴǴǴdzƳŲŲűŰİİİðîî®пʴ101TOKìμнϼϽϼλλͺ̹̺˸˸̷˶ʷʷʵɶʵɴȳȳȳDzDzDzƱűŰηt'&' )((%$&%$&%$&%$%$$%%$%"""" "`WM~ª~}||{{xo_&%&#!" ! =7dWm_}m }#'*,--...-.-----,+,,******))())(('+<ǵUkVUL h I -
y- t <̿dmGK\Ϻ^\ͺ\ͺ[̹[[ZZZ̹Z̸YYX̹Y˹Y˸WʶVųUıSK978668778878879778778767325QNM̼ξνννννμμͼͼμͼͼͼͼ̻̻̺˺˺˹˹˹˸˸˹ʸɸɷȷȶȵȵȵǴǴǴƴƳƲŲűűİİİİïﮬî̸d[XEA@пμннϼϼμλͺ̹̹˸˹̷˶ʶʶɵʵʴɴȴȲȲDzDzƱƱƱͷu('( )&)%$&%$%%$%%%%%%&! #""$dZNë~}}|||vrbR%## "!! ! B:eYoa o $(*,---....-.-,--++,+++*+*)))(()((,;ǵUkVVL h I -
y- t <̿dmGK\ϻ^\ι[̺[̹\[[[ZYY̹Y̹YYY˸XǵVɵUQpgB228788868769879869879657637~wrξϿϾξξξϾνννννννͼμͼͼͻ̻̺̺˺˺̹˹˸ʸ˹ʸɷɷɶȶȶȵȵǴǴǴdzƳŲŲűıİİİİï®Ͽ}MFF{rϾϽонϽϽϼμͻͺ̺̺ͺ̹˸̷˷ʶʶɵʵʴȴȴȳȳDzDzƱƱθu''( )')%$&%$%%%%'&' """$cXOǯ«~}|||wi[N#"# " " ! !)' JBfYrd r!%(+-....//...-,,--,,,,,+***)))))((+<ǵUkVVL g H - y- t <̿dmGK\ϻ^κ\ι\\ͺ\ͺ\ͺ[ͺ[ιZYͺY̹ZZZ˷XʷWǴVȳUM@=:989779779778868978879104UNO̼ϿϿξξξξξξνννͽͼμͼͻͻ̼̻˻˺̸˹ʸʸʸʸʷʷȷȶȶȵȵǴȴǴƳųŲűűűİİİï®®Ȳókb_ukfƵŭϽпϾнϽϽμμλλ̺̹ͺ˸˸˷ʷʶɵʶɶɴɴɴȳdzDzDzDZθx/.. "(()$$'%$'''( "#"$bYOȯ«}}|}w[SM $ "!" ! ! ! !/+ QGgXte s"%),.//..../.-.-,,-,+,+,,***)**)))(+<ǵUkVVM f G , y- t <̿dmGKͺ\м^ͺ\\ι]\ͺ\κ\ι[κ[ͺ[̺[ZZ̸Z̸XɵWȴWR|rE1/8:8:98:77:77876888:769;;=~пοοοξξξͽͼνμν̽ͼͼ˻˻˺˹ʸ˸ʸʸ˸˷ɷȷȷȶȶǴǴǴǴųƲűűűűİİݯî®к{rog_ĴȰνпϿϾнϽμϻμμͺ̹̹˹˷˷ʶʶɵʵʵɵɳȳȳDzDzƱʵQJD #"$*)*''( "$#%aYOȱ«ª}}|~uF?? !"# !!" ! ! !.+ PGj\wh v"&*-.../.../.-...-,,+,+++*+***))*((-;ǵUkVWN b E + y- t <̿dmGKͺ\м^ͻ[ͻ]κ][[κ\ι[κ[̺[̺[ZZ̸Y̸YƳXϻXPLJ=879:8:98:97:97:88888:647aYVξϿϿξξνννμͽͽμμͻͻ̼˺˺˹̸ʸ˸˹ʹʸɷȶȷǵǴǴǴdzƲŲűűűİİİİî®íοѺ{qĮϾппϾннмϻϼμλι̹̹ͺ˹˷ʶʶɵʵʵɵɳȳȳDzDzƱȳîr<86 ##%!"#$$%aXOɲ«««ª}|~p1-, """ !" !"" ! ! !1. TJl]yj x$'+-/..00//../...---,--,,++******))-;ǵUkVYP z ] A (
y- t <̿dmGKͺ\ϼ^κ[λ]κ]ͺ\ι[ͺ[ͺ\ͺ[̺[̺ZͺZZYʷYǴXʷVK./9<;:88987:97:97:98:98:637yϿϿϿϾϾνννμμͼͽͼ̼˺˺̹˺ʹʸʹ˸˹ɷɷȶȵɵǴǴƳƳųűűűűİİïîîưǷнппоϾннϽϻμͻκ̺̹ͺ˹˸˷ʶʶɶɵɶɵɳȳȳDzDzDzDZįp?;9 $$&bYOʳìì«~}t'&& ###! ! ! !! " !:5 ^Sl^{l |$&+.////0/......-,-,,,,,+++*****)((,;ǵUkW\R! o U ; %
y- t <̿dmGKͺ]Ͻ_κ\ͺ]ͻ]κ\κ\\ͺ\ͺ\ͺ[[ͺ[ZYɶXXQc\A44:;:;98:97988997998:88:KFHпοννννͽͽͼͼ̻̻˺˺˹˸ʸʸ˹ʸɷɷȶɶȵǴǴǴƴƲƲŲűıİİïï®®îͼɷппппϾнϽμλλͻͺͺ̸̸̹̹˷˷ʶʶɵɵʶɵɴȳȳDzDzƲǴv\TLg^T̶¬íí¬¬«ª}s&%& #"$! "! !"!! #! !A: fXm_ }n!~&(,/000010/00///.....---,,,,,++++*)-;ǵUkX`V# ud J 3 y- t <̿dmGKͺ]μ_ͻ]λ]λ]κ\ͺ]κ\ι[ι[κ\ͺ\ͺ[̹Z˹YǴXӾZPDB=99:;:;:8;:8:98:87:99;446|upǻϿϿϿϾξνμνͼͼͼ̻̺˺˺˺˹ʸʸʸʸɷȶȶȵǵȴȴƴƳƳŲűŰİİï®®ѿѿпоϾнϽϽϻλλκ̸̺˷˶ʶʶɵɵʵɴɳȳȲDzƲƱűİįŮĮĭì쬫«~{{l]$#$ ##$! "" !#!! " !?9 eX l`!}n&|*/2577788887877777777666555545544555=ǴTjWe[$
} gW @ + y- t <̿dmGLκ^м`ͻ]ͻ]λ]κ]κ]ι\κ\κ\ι[ͺ\ͺ[Z˸YųXӽYL-.9<<;98:98;:9;:8;:9<:9;546пϿϿϾξϽνͽͽͼͼ̻̻̻˹˹˹ʸʸʸɷɷȶȵǴǴǴǴǴƳŲűűİİðïîîѿѿпоϾмϽνϼϼλλ̸̹̺˸˷ʷ˷˵ɵɵʵɴȳȳDzDzDZűűDZƯįįůĮĭí¬ì«xeYL""" #"$"!"!!"""" ""!"D>"k_&sg+w29>CFHIIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ˹XkXg\%
u \L 5 " y- t <̿dmGLκ^м`λ]ͺ]ͺ]ͻ^ͺ]κ\κ]λ\κ\\ͺ\̹[ɶYκZSc]C44:<<<99;:9:98::8::9;98:b\[ǽϿϿξξνμͼνͽͻͻ˻˺̺˹˹ʸʸʷɷȶȵȵȴǴǵƴƳƲŲűıİįï¯ѿѿпоϽϼμμϻͻͼͺ̺̹˸˸˷ʶʶʶɶʵɴɴȳȳȲDzƱƱƱƯůůůĮĮí¬¬««ªªxMGG ! #"#"""""# # "42&\U0wn9{@JT\ƹaοdfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmsYh[&
r WE . y- t <̿dmFMͺ^μ`ͺ^λ^κ^κ^λ]ͻ]λ]κ\ι]\κ\[ȴZӾ[OIF>:9;<;<::<;9;:8;99;;:<98:ϿϿξξνͼͼμμͼ̻˺˺̹˹ʸ˸ʷɷȶɵɵǵǴǵǴƳŲƲűİŰůﯮíппоннνμμλͻͺ̸̹̹˹̷̹ʶʶʶɵʵɴȳȳDzȳDzDZDZűŰưůůĮííìë¬r-)+ ####"##!##!#! "!!"53'^W0wp9}@JRYö^ɼa̿ccdeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefcMh\$
s VB *
y- t <̿dmFMͺ^Ͻ`κ]κ_λ_ͻ]λ]λ^ͺ]ι]ͺ\λ\\[ųY\L/.9=<<:9;;:<:9<;9<:8;<:<<;=ϿϿξξξͼͼνͼͻ̻˺̺˹ʸ˸ʸɷȶȶȶȵȴǵƴƳųƲűŰŰððïî¬ѿппоонμνϻμͻͺ̸̹˸̷̷ʷʶʶɵʵɴȳȳDzDzƱDzDZůůưůĮĮíĬ쬫ªªt"!# %$$""$""$""#""#!!"%%61HARJ `V&nd,{o0ڂv3ֆy6ׇz6څx4܅x4߄w4v4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4u4v4v4w2ym,C<x ZA ) y- t <̿dmFMͻ^н`ͺ_κ_λ^ͻ^λ^λ]ͻ^κ]κ\κ]ͺ[ʷ[ϻ\Tb\D33<><=;:<:9;;9;::;;:;;:==<:=;9<;:<:9<;:=<:={sm˾ϿϿονννͼμͼ̻˺˺˹ʹʸʸʸʷɷȶȵǵȴǴƳųƲƱııİïïîѿѿѿϿϽмϼμλͻͺ̺˸˸˷ʶʶɵʵɴȳɴȳDzDzDzDZƯůưůįĮĭí¬ì쪪ycVJ! $! "$#%####"$"#$#"#! "*!
5"
VA3xZE}`JbLeNdMbMcMcLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLaLbLdNvZF3& a C ) y- t <̿dmFMλ_нaμ_μ^Ϻ^Ϻ_λ^λ^λ^κ]κ^κ]ͺ\ǵ[\N=;=<:<<;<<:=;:=;;<<9<<:==<=пϿϿϿξνͽͼͼ̻̻˺˺˹ʸʸʸɷɷȶȵǵȴǴƳŲƱƱııİįïîҿпϾϽнϼμͻͻͺ̹˸˸̶˶ʷʶɵʵɴȳȳDzDzƲƱDZưŰƯŮůĮĭí¬ì쫪uG@> !$!!#$#$$"$$"#$!##!#!/)!O8W9 %$ׁbKl̝wҡz֣|إ~٦ڦڧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧܨפ|eK:+ c D * y- t <̿dmFMλ`нbλ`ϼ`μ_λ^Ϻ^κ_λ^λ]ͻ^κ]κ]Ƴ[^tJ+,:??>;;=;:<;;<;;=<;<=;=97:ϿϿξξμͼͽ̼̻˺̸̹ʸʸʸʸɷȶȵȴȵdzƳŲƲƲűŰİįîîпонϼμϻμͻ̺ͺ˷˷˷ʶʶɵʵɴȳɴɳDzDzDZDZƱŰưŮŮįĭí¬¬ìëªx&%( "$$$##$##$##$$"$# #!2*"X< Z< " ՀbKqҠ{բ|٥ۧۧۧۧۧۧۧۧۧۧۧۧۧۧۧڧڧڧڧڦڦڦڦڦڦڦڦڦڦڦ٦ڧ٦eE5' c D * y- t <̿dmFMλ`нbκ_ϼ_μ_ϻ_λ^κ^Ϻ^κ]ͻ_ͺ]]ɶ[λ\xoJ12:?>>=<>;:<<;<;:<;;<=;=KEG˿Ͽοξνͼͼͽ̻˺̹̹ʹʹ˹ʹɷȷɵɵȵȵǴƳƳƲİİűįî®îѿооϽϼϻλͻ̸̹̹˹˷˶ʶʵɵʵȳȳȴǴdzdzƲƱưƯŰĮůĮíììªxh " $%$%#$$$$%#$%$"$### 9,!]> \=
&"ԄeMpŗtmiijjjjjjjjkkkkkkkkkklklllllllllnɚvԢ}eF5( c E + y- t <̿dmFMλ`нcϻ`μ_μ_ϻ`μ`ϼ^Ϻ^ͺ_λ_ͺ]̸]κ\Vb]F55=?=>=;>=:=<:=;:<;:<=<=tlkϿξοξͼνν̼̺˺̺˸ʸʹɹʷȶɶȵǵȵȴƳŲűűűıï®îѿоонϼνϻͻͺ̹̹̹˸˷ʶʷɵʵʵȳȴǴdzdzƲDZưůưįůĮí¬¬¬ª|g\S!!##!%%#'$$$%#$$$%$"$#$$ B0 hD _?
($ԇgNŖrǘtjhjlllkkjjjiiihhhhggffffeeddcdcbgȚv֤~eF5( d F + y- t <̿dmFMλ`ѽbϼaμaμ_μ_ϻ`ϻ`λ_λ_λ_ͺ]ʷ\ӿ^RQMB88>==?<<>=;=<;=;;>;:=?=?ϿϿϾνͼνμͻ̺̺̺˹ʸʹʹɷɶȵȴȵǵdzŲŲƲűűıïî¬ѿооϼνϼλͼλ̸̹˸˷ʶʷɶɵʵɴȳȳȳȳDzDzƱűưůůĮĮĭ¬«ë¬©yFA@""##$$$%&$#%%$%%%%$#%"(& E1#iF"cB
)$҉iPȘuǗtl̙sۣ{ۤ{ڣyڢyסy֡x֠v՞uԝuӜtқsћrϚqΘqΘq͗p̖n˕mʔmɓkǒkƑjŐiĎhÎgfeeddhșv֤~eF5( d F + y- t <̿dmFNλ`ҽbϻ`μaμ_ϼ_ϻ_κ`ϻ`ϻ_λ_κ]ɶ\`zN><>><>>=>=<><;>=<><<>;;=?>AпϾξνͼνͽͻͻ̻˺˹˸ʹʸɷȶɵȴǵǵǴųŲƱŰűð¯î¬ҿҿѾϿнϼμλͼμκ̸̹̺˸˷ʶʶɵʵɵȴɳɲȲdzƲDZƱŰƯŮůĮĭĭ¬ì«ª§s"#%$#%%%%%%%%$&$#&%#&%#% -&K4%nI#hE * %ьkR˚vșulǖqՠxաxԟwԟwҞwўvќuМtϙsΚs͙r̘q˘pʗpɕpɕoɔnȔmǓmƒkĐjihggfeeedhșv֤~eF5( d F + y- t <̿dmGMλaнcκ`μaμaλ`ϼ`ϼ`ϼ`μ`ϻ_κ^ȵ\_tlJ00=?>=?=>=<>=<>>=>=<==;><;=A@AϿξϾϽͼͼͼͻ̻̺˹ʸ˸ʸɷɶȵȵȵǴǴƳƲűűİï¯î¬ѿпϾмϼμλͻͻͺ̸̺˸˷ʷʶɶɵʵʴȴȴȳdzƲDzưůưůůĮĭĬ¬¬ì«ªzYNG! #%%'%$'&%'%$&$%%%$%$%&:, Z:*uN%rK
. 'ΑnSΝx˚wmʘs٣{٣{֡y֡yՠx՟wӟwҞvҝuМtЛtϚsΙr͘q͗q̗p˖oʕoɕnȔmǓmƒkĐjÐiihggfeișv֤~eF5( d F + y- t <̿dmFNλaѾcμaλbϻbϻaμaϼ`μ_ϼ`λ_̹_λ_Yc]F66>?>?>>=>==@><@>>=?XQRϿϾϾϾνͼͼ̻˺̺˹˹ʸɸȷɶɵȵȵǴƳƲŲıŰİïîҿпоϾмϽϽϻͻͻͺͺ̹˸˷ʶ˷ʶɵʴʳɳȴdzȲDzDZưůưůŮĮĮĭí쬪yj )')&%'&&&&%&&&'%#&&'(%=2 L5 ^>-W)zQ
2!)̔qVПz˛wn˙uۤ|ܥ|٣{٣zآzסyաx՟wӟwӞvҜuќuЛtϚsϚsΘq͘q̘q˖pʖoɔnȔmƓmƑlőkÑjhhhfișv֤~eF5( d F + y- t <̿dmFMϼbѾdмaмbмbϼbϼbμaλaμ`ϻ`̹_ҿ_UVRD:9>???>>??=??=@==?<<>?>@c\\ϿϾϽνννͼ̻˺̹˹˹ʸɷȶȶɶȵȵǴƳƲűűŰį¯îì¬ѿоϾнмμμμλͺ̸̸̹̹˷ʶʶʶʶʴɴɴȳȳDzDzƱŰưůůįĭĭíì쫪©}_UL !(')'&''%''&&&&&%"%&+*'R= \= ^>/\*~T4"*˕rVѠz̜wn̛tۦ}ܦ}ڤ{ڤ{٣zآzסyաx՟xԟwӝvҝuќtћtϛtΚsΙr͘q̘p˖pʕnɕnǔmǓlƒkőjÏiÏiÏhfișv֤~eF5( d F + y- t <̿dmFNμcѾeмcнcϼbϼaϼaμbϻaϻaϼ`̹`ӿ`TTQD:9>A>@?=@?>?>>@>>@=;>@>@pfgϿϾϾϾνͽͼ̻̺˺˹˹ʸɷɷɶȵȵǴdzƲƲűűİïïíѿѾонϼϼϼͼͻͺ̸̹˷˶˷ʷɵɴʴɴɳȳȲDZƲƱưŰůůůĮĭí¬ëªĬu<7;%%%'''&&(&&'&%''&'&$&(70*\B"_?"bA1^+V6$*ʗsWҠz̜wn̜vܧ~ݧ~ۥ|ۥ|٤{أzآzסy֠x՟wԟwӞvҝuќuќuЛtΚs͙r͘q̘q˗oʕoɕnȔmǓlǒkőkđjĐigiǙv֤~eF5( d F + y- t <̿dmFMϼcѾeλcнcнbнbϼbμbϼaϼ`ϼa˷_aumL99?@?@?>@>=@>=@?=??=@=;>B?A||Ͽξννμͼ̻˺̹˹˹˸ɶɶɶȵȵǵƴƳűİűűïïí¬ѿѿоϾннνλλͻ̸̷̺˷ʷʶɵɵʵɴɴȳȳDzDzƱŰưůůůĮĭí¬ì«ªīxi +**'&(''('&'&&(&%(&&')D7,dH#`A#hE4b-Y7$+ʗrWҡ{̝xo͝uݨ~ߨܦ}ܥ}ڥ|٤|٣{آzסy֡y՟xԞwӝvҝuҝtМtϛtΚsΙr͙q̗p˖pʖoɕnȔmǓlƒkƒkĐjhjǙv֤~eF5( d F + y- t <̿dmFNϼcѿeмbнcнcмcϽbϼaϼbϼ`ϼa˸_cibI33>BAB??A>=@>=@>=@?=?=<>CADοϾννͼ̼̻̺˹˹ʹʸʷɶɵȴȵǴƳƲıűűﯮíҿпоϾооϽϻλλͺͺ̸̺˷˷ʶʶʶʵɵɴȴȳȳDzƱưưŰŰůĮĭíí¬ëªé`VM *)+(&)('(''(''(&#'&)*,XB.sP%bB%mH4e.[8%+ɘsXӡ{͝xoΝvߨߩݧ~ܦ~ۦ}ۥ|ڤ|٣zآzסy֠y՟xԞvӞvӝvќuМtЛsϚsΙr͘q̘p˗pʖoɕnȔmǓlǓlőlijǙv֤~eF5( d F + y- t <̿dmFNϼcѾfмcмcнcϼcмbнbϽbϼbϼa˸_coiK66?A@A@@A@>A?=@>=@>=?=<>CADϿϿϿϽνμ̼̼˺̺̹ʹʹʷɶɵȴȵǵǴƲƲűŰŰî®îѿппϾнмμμμͻͺ̸̹˸˷ʶʶʶʶʵɴɴȳȳDzDzƱŰưƯůůĮĭí¬ì«ɮm0.1((((()''((')'')(')(&'(4//fJ1{U'fF'sK6i/^9%+ɘsXӡ{͝xoΝwੀާݧܧ}ܦ|ۥ|ڤz٣zءyסy֡xաvԟvԝvӜvҝtќsЛtϙsΚr͘p̗p˖pʖoɕnȔmȔmǒljjǙv֤~eF5( d F + y- t <̿dmFNϼdѾfмdмdнcϽcмbϽbнcϼbϼa˸_cniK56>B@B@?B??A?>A@=@>?A=<>CBDпϿϿϽνν̼˺̺˺˸˸ʹɸȷɶȵǵǴƲƳŲűııð¯îпоϾннϽϼλͻͺ̸̸̹˷˷˷˷ʶʵɴȴȳȲdzDzƱŰưƯůůĮĭíì쩨wi^ ,++(()''((')(&((%((()*B61nO4~X)lI'vN8k1`9&+ɘsXӢ|͝xoϝxઁ⪀ߧިި~ܧ~ܦ|ۤ|٤z٣{ءzסy֡yԠwԞvӞvҝuҝuМtЛsϚsΘr͗p̖p˖oʖnɕnɔmȔljjǙv֤~eF5( d F + y- t <̿dmFOϼdѾfмcмdмdнcнbϽbнcмbϼa˸_cohK66>A@B@>A@>@??A@?@>?A=<>CBDϿϿϿννμͼ̻˹˸˸ʹȸȷɶȵȴȴƴƳŲűűűð¯îпѾѾϽϽϽϻλͼͺ̸̷̺̹˷˷˷ɶɵɴȴȳȲdzDzƱưưůůůĮííìì©©ƭ}PHG !,*,(())()('((&('%(',+-XB5{W6[+rM)zP9n1a;'+ȘsXӢ|͝xoѝx⪂᪂ߩߩި~ݧ~ܦ}ۦ|ۤ{٣{آzסyסxסwՠwԟxӟvҝuҜtМsϚsΙr͘q̗p˘oʗpɖoɕmȓmjjǙv֤~eF5( d F + y- t <̿dmFOϽdѿfмcнdнdмcнcнcϽbмcϼa˸`dohK76?CAAA@A@>A@>@??A@>@>A>>@A?Al^[Ͽξννͼ̼̻̺̹˹˹ʸɷɶȵǵȴƳƲƱııŰð¯îпооомϼμλλͺ̺̹˸˷ʶʶʷʶʵɴɴȳȳDzDzƱŰưưůůĮĭí¬ìªcZO .,,())(())'))'*('))++.TA4tT:`=@A@BjbeϿϾννͼ̻̺̹̹˹˸ɸɷɶȵȵǴƳƲűűűİð®îѿѿѿϿϾϽϼμμͻͺ̸̺̹˷˷˷˷ʶɶʵɴȳȳȲDzƱƱƱƯůůůĭíì쪫˳m745&%'+*+))*)()((*(()(()*4.2cK8[?e>j0X-Wv2e<',ștYԢ|͝xpҠy宄毄㬃㬃⫂᪁ੀߨާ~ܧ~ܦ}ۥ|ڤ{٣{٣{ءzסy֡x՟xӟvӞvҝuќtЛsϚrΙr͘r͘p̘pĒmkǙv֤~eF5( d F + y- t <̿dmFOϽeѿgмdоeоeϽdϽdнdнdнdϽc̸aepiL78@DBCA@C@@B@@A@@AA?BA@AA>APJKϿοξνͼ̼̼̻̺˹˹ʸɷɶȵȵǴƳƳƱűűįï®íѿппоϾнϼμλκͺ̷̹̹̹˷ʷʶʵɴɴȳȳDzDzDZŰŰưůůĮĭíììȯzD??!!$-,-***))+*(+*)*)')*,+2^G;~\>dDpDs3].Z>w3e<',ștYԢ|͝xpҠz毅氅㭃䭃㬃⫂᪁ੀߨިܧ}ܦ}ۥ|ڤ{ڤ{٣{آzסy֠x՟wԞwӞvҝuќtЛsϚrΙrΘr͘qēmkǙv֤~eF5( d F + y- t <̿dmEOϽeѿhоfѽfнeоeоeϽdϽcнdϽc˸aeqiL88@DBBBACAACA@BA@BA@A@?A@>AEBCϿϾννν̻̻̻˺˹ʸɸȶɶȵǵƵųųƱŰŰð®ѿѿпооϽϼμλͻͺ̹˸˸˶˶ʶɵʵɴɴȳdzDzƱưưưŰůŮĭĭìì˲oc[&%+,+,,+,+*****))*)(**)+-<48wW>cBiHuGw4`.\>x3e<',ștYԢ|͝xpӡ{谆豆宄宄䭄㬃⫂᪁ੀߩާݧ~ܦ}ۥ|ۥ|ڤ|٣{آzעy֠x՟wԞwӞvҝuќtЛsϚsϚsΙrœnkǙv֤~eF5( d F + y- t <̿dmEPнfhнfнfѾeоeнdоdоdоdнc˹bfqiM88@CBBBABB@BB?CAACB?B@@B@?ADCEϿξνννͼ̻̺˹˸ʸɷɶȵȵȴƴƲűıııïѿѾооϾϽϼμμͻͺ̸˸˸˷ʷʶʶʵɴɴȳȳDzDzDzŰŰưůůĮĭìĬJDA #.-.***+)*+)+*)+)'*+-.4_I=^BgFoK{H{5a/]?x3f<',ștYԢ|͝xpԢ{鰆鱇毅寅䮄䭄㬃⫂᪁ߩިݧ~ܦ}ܦ|ۥ|ڤ{٣zآzסy֡x՟xԟwӝvҝuќtЛsЛsϚsƔokǙv֤~eF5( d F + y- t <̿dmEPоfhѽeѽeѾeоeоeоeнeоdнd̹bfqjN98ACBBBABBABB@BA@BA?CA?C@?AEBEǽϿϾϾ;ͽͼ̻̺̺˹ʸʸɶɶȵǵǵƳŲŲİŰï®ѿѿпоϾнϼμλλͺ̸̸̹̹˸˷ʶʶʵɵɴȳȲDzDzƲưưưůůĮĭ̳sh\,+-))*,*-*)+**++*,*)+**+/<5;zZAdElHuM~J}6c/]?x3f=(,ștYԢ|͝xpբ|鱇겈簆簆毅宄䭃㬃⫂᫁ߩިݧ~ݧ~ܦ}ۥ|ڤ{٣{آzסy֠x՟wԞvӞvҝuќtќtЛtǕplǙv֤~eF5( d F + y- t <̿dmEPоfhнfнeѾeоfоfоeнeϽdϽd̹bfqjM99ADCCCBCB@CA@BA@CA@BB@BA@BCBDϿξνννͼ̻̺˹˹ʸɷɶȵȵȵƴƳƲűİįï®ѿѿѿпоϽϼϼλͻͺͺ̷̹̹˷ʷʶɶʵɴɳȳȳDzDzDzűŰƯůĮĮ¬ůF@>!!$.,.+*-+*,**+*++*(*+0.7`K?`DjIsLyOK6c/^?y3f<(,ștYԢ|͝xpգ}겈겈籆豆簆毅宄䭃㬃⫂᪁ߩިިݧ~ܦ}ۥ|ڤ{٣zآzעy֠xՠwԠwӞvҝuҝuќtȖplǙv֤~eF5( d F + y- t <̿dmEPоfiѾfѾfнfнfоfнeϾeнeϾd̹bgslN9:BDCDDADC@DBACB@CBABAACA@BDBDϿϾνννͽͼ̺̺˹˸ʷɶɶȵȵȴdzƳƲİŰï®ѿѿпоϾнϼμλλͺ̺ͺ˸˷˷ʶʶʵɴɴȳȳDzDzDzűŰưůůĮ«ȯndY,,-('*-,.++,++,+*,+*,++,0>6>}\DfHoLwN}QM7d/]?y4f<(,ștYԢ|͝xp֣}볊볉豇鱇豇簆寅宄䭃㬃⫂᫁ߩߩިݧ~ܦ}ۥ|ڤ{٣{آzסy֡xՠxԝwӝvӞvҝuɖplǙv֤~eF5( d F + y- t <̿dmEOнgҿiѾfѽfнfоfѽeоfϽeоeѾe˹chleL56AEDDB@CBADBBDC@CB@BAABB@BDBDϿϾϽννͼ̻˺˹˹ʸɶɶȵǵǵŴųűİıï¯í¬ѿѿпоϾнϼμλͻͺ̸̺̹˷˷ʶɵʴɴȳȳDzDZDZƱƱưůůíDZz>;9$&(-.-+,-+*-+*,,+-*(*,/.8`MCcHlMuP|PRM7e/^?y4f<(,ștYԢ|͝xp֤}겈걈鲇豆氅毅它䭃⬃⫂᪂ੀߩި~ݧ}ܦ}ۥ|ڤ|٢{آzעy֠y՟xԟwӟwӞuɗpmǙv֤~eF6( c E + z- u <̿dmEOнgӿiоgѾgѾfоfѽeоfнfоeѾech{sO?>BCBDBBCBBCBADC@CB@DA@BB@CCBDb\\ϿϾϾνμͼ̻˺̺˹ʸɸɷȵǵǵŴųűƲıïïíпоϾϽϼμλͻͺ̸̹˷˷ʶɵʴɴȳȳDzDZDZƱƱưůů¬ʳg]X,*.*),,--,,,,*-+*-,+-+*,0=7BaGhMrP{SRRM7d/^?y4f=(,ȚuYբ|͝xpץ}겈곈鲇鱆谅毅寅䮃㬃⫂᪁ੀੀߩިݧ~ܦ}ۥ|ڤ|٤{آ{עy֡yՠxԟxӞwӞvɘrmǙv֤~eF6) c D * y- u <̿dmEOоgiоgоgѾfϾfϾfнfоfоeоeκdeXVRG@>DDCECBCDACBBCCBDB@DB@CCACD@Aпоξνμμ̻̺̺˹ʸʸɷɵȵȵǴŴųƲİŰﯮѿѿпоϾϼϽμλκ˸˸˷ʶʶɶʵɴɳȳȲDzDzDzƱưůů˴}:::)(+.-.-+.-+-,,,+,,*(*-1/:bNFhLoQyTUTUN6d/^@y4f=(,ƚvYԢ|̝xqץ볉볉겈鱇貇簇毅宄孃䬄⫃᪂ᩁੀߩިݧ~ܧ}ۥ|ڤ{٣{آzסy֠xաxՠxԟwʘqmǘv֤~eF6) b C * y- u <̿dmEQѿijҿgҿgҿghѿhѾhѿgҿgѿgϽgf]]XK>=CEDEDBDCAEBBDCBCCADBACCACA@CϿϿϾννͼ̻˺˹˹ʸȷɶȵǵȴƳųűİŰﯮѿѿпоϾнϽμλλͺ̸̹̹̹˷˷ʶʶʵɴɴȳȳDzDzDzƱưůưȱZRO-,-,+,-,.-+.-+.,--,,,+'*1A:EeJlQvTWVUUËN8e0^@y4f=(-ÚvYӢ|̝xqץ촊볉겈鲉豇篆毅宄䭄㬃⫂⪂᪁ીߪިݧ~ܦ}ۥ|ڤ{٣{آzסy֡x֡xՠxʘrmǘv֤~eG6) } _ A )
z- w <̿dmEPϾfjпhпhпgѿfѾfѽfѾfоeоeͼff\ZXJ>?CECDDADCBEBADBBCCBCCADCADDCEϾνͽͼ̻̻̹˹ʸɷɷɵȴȵdzŲŲŰİİï®ѿѿпϾнϼμλͻͺ̸̸̺̺˷˶ʶɵʴɴȳȳDzDzDzƱůȱ˳s524+*-/-/,+-,,--,.-,.+)+/53=eQJlOsU|XXWUUċN8e0^@y4g>).wZӢ|̜xqئ촊볉겉鲇谇簆毅宄䭄㬃㫂⫂᫁ߩާݧ~ܦ}ۥ|ڤ|٣{آzסyסx֡x˙smǘv֤~fJ9+ w [ ? & 8 u =̿dlFHðWųXıWıWIJVIJUıUıUıUıUıU°UıWOf`F;;EEDEDCEDCDCBDCADBBDBADCBDCBDϿξννͻ̻̺˹ʹʸɷȶɴȴȵƳųƱİİï®ѿпоϽϽϼμλκ̸̹̹̹˷ʷʶɶʵɴɴȳDzDzDzƱƱ̴E@>----,..,/-,-,-.,,.,*-../:SGLjPrV|Z[[[ÍWVƌO7f0^?y3g@*0x[Ӣ|̜xqڨ︍ﶌ볉벉鲈豇簆毅宄它䭃㬃⫂᪁ੀߨިݧ~ܦ}ۥ}ڤ|٣{٣{أz͛tlǘv֤~gO<. l Q 8 " 8 w =̿dmįLFKKKKJJJJJJJJJ̵HsjF99EFEECCECCEDCEDBECAEBADDBECBDa\]Ͼννͼ̻̺˹˸ʸɸɶȵǵȵdzƲűİİï®ѿпоϾнϼμλλ̻̹̹˸˷˷ʶɵʵɵɴȳȲȲDzŰʴǰwka0/0-,---/--/.,..,/,-/,'+4>:Fw_QrVz[^]\ZĎVÌVǍO8e0^?y3gB+2 y\Ԣ|̜xrۨﶍ촊쳉벉鲇豇簆毅毄宄䭄㬃⫂᪁ੀߩާݦ~ܦ}ۥ|ڤ|ڤ{٣zΛumǘt֤}hVA1z l\ E 0 8 x =̿evdabbbbbbbbbbbb;bdYGGIDADECFDCFCCDDCDDBDCBECAECBDEBDϿϾννͼ̺˹˸ʹʹʷȷȶǵƴdzűŰİİï®ѿпоϾнϽϼμͻͺ̸̹̹̹˷ʶɶʵɵɴȳȳȳƱdzʴ;88/.0/-.....-.--/.-/.-/*)+0J=?~]BbGlJqLvLyKyJyGxHyDt5`2`?x4fD-5 z^Ң|̝xnʛwڦۧإإإפ~פ~֣}բ}բ}ԡ{ӡ{ҠzҠzҠzўyϞyϟyϞxΝwΝw͝v̛v̛v˛uʚtʙsʙsəsokǘtգ}j_I7_ SI 6 &
; &
>ôWjgfffffggggghhihi`]ZL@>DGDGEBFDBECCDDCEDCDCBDDCEB@CϿϾννͼ̻̺˹˹˸ɷȷɵǴǵƳŲűİİﮬѿпоϾϽϼλλκ̸̸̺̺˷ʷʶɵʵɴȳȳȳİϹQKJ../.-//.//../-.../..//&-'81"]?*lK-vP1W3[5^6a6b5b5b5b4b1]5e=v4gE.8 {^ҡ{ϟzonppoopoooooooooonnnnnnnnnnnnnnlmɚvԢ}lmS@A 94 ' ? 8@gGONNNNNMMNMòLƭI̧GԢEܞCᙋA坎@v;RN@BAFEDEDCEECFCBECBECCDCCDDDECBE}|Ͽξνͼͻ̺˺ʹʸɸɷɵȵȴƳŲűİİï®íì¬ѿпоϾϽϼϼλͺ̺̺̹˸˷˶ʶɶʵɴɴɴŰιįwkb1/10/0.-/.-/.-/..//.//*-,:3'_B&vM*~T/[2a4e7h8j7k8k9l9l9l9l:q>x4hC-6 z^Ӣ}٦Пz͝yΞyΞyΞyΞyΞzΞyΞyΞyΞyΞyΞzΞzΞzΞzΞzΞyΞyΞyΞzϞzϞzϞzΞzΞzΞzϞzϞzΞzΞzϞzПzפ~פ}n|`Hu ( ""
IA'yO-V1^3d5i8l9o:q:q:q;r;r;r;r;s=u3eH07 {^Пy֣}Ӡ{П{ПzПzПzПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПyПz̜wlmSo oZ eT t]Qv]mVeP|^KtWDnS@iP>dM=nP;NB>;=DGDGCCFDDEEDEDCEEBEEBEEDFECF?>@ονμͼ̻̺˹˹˸ɶɶɵǴǴƳŲűİİï®î¬ѿоϾнϽμμμκ̸̺̺̹˷ʶʶɶɴʴïҼPKH.-/001//10.0//00.0.,.635(6/ I1!\=$`B'jG)qL+tO,xQ,yR-zS-{S-{S.{S.{S.{S.zS.zS/~U*tN;((`JԤ~_㪂cܮeԲgеi˸kȹkȹlǺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƺlƹlǷkȰftXN<.#
` qVdmʙu̜w̝w͝xΝxΝx̜w٥{jVOOBBFFDGECEDDFECFDCFECEEBFFCGCACsmlϿϾννͼ̻˺˸ʷɷʶȵǴǴƳŲűİİï®®¬ѿпоϽϼμλλλ̸̺̺̹˷˷ʶʶʵ®Ӽg_Z-,/1020/10.0//00/00.0113
+!?1$G7*U@1qgO;]z]FOhOEqV@uZ>w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=w[=y\>x\5iP0% x]B fLdɚuܧۨݩުߪߪܨ谆qcWPACFHFGFCGDCFECFDDFECEEBEECFDCEOIKϿϾννͼ̻˺˸ʹɹʸȷǵǴƴƳŲűİï®®¬ѿпоϾϼϼλͼͻ̸̹˷˷ʶ˷űкdz{of5350011021/1/.0/010/1102,+-**++)+0+.3/3626:59;6:<7;=8<=8<>8<>8<>8<>8=>8=>8=>8==7;A;?C>B&#% b D ) ~`J dMeȚuԢ|ƗtollmlndgXN=@DIFGFCGFCFECFDDFDCGEBEECEECFA@BϿϾννͼ̻̺˹˹˹ʸɷɵǴƴƳŲűİï®®¬ѿпоϾϽϼμͼͻ̸̹˷˷ʶǴʶӽs=990/12230021/2/02101213(()EEGhgjvvy~IJK iJ/
:,!fNuZץʚ̛͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜͜Ҡ~`z]G ~aJ eNeəuԣ}phjjiigƔmp\>@EHFHFEFFEFEDFDCFDCGECFECEFDFCBD[WY½Ͼννͼ̻̺˹˹˹ʸɷɵǴǴƳŲűİİįíѿпоϾнϼμμκκͺ̸̹˷˷ɵɵӾMHH/-02231120021/2002201/,.546mmpBBE iJ/ & :,"oTdLfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNfNgN ~aJ eNeəuԢ|poՠx٣yנxנxӞvޤyhVOMDDGGFFFEGFDGECGFDGDCFECEEDGDCFA@CϿξνμͼ˼˺˹ʸȷȶȵǴǴƳŲűİİį¯¬поϾнϼμλλλͺ̹̹˷˶ʵҼUOO-,/2131131/21/11011120/00/1SSUiijrrt{{}CCD i J /
~aJ eNeəuԢ|pnӟw֡yՠxԠwҝvסwno^U@AFGFGEEFFDFFDFFDFECFDCFDCGEDGCBD]Z[ϿϾννͼ̻̺̹˹ʸɷȶǴǴƳųƱŰİð®®ѿѿооϽϼμμμκͺ̺̹˷˶ҽXPJ.-02032231132032021120/0/./PPSbbdjklrsuyy|}}CCD j K 0
~aJ eNeəuԢ|poԠwآy֡xՠwԟxԟwќto]:>DIGHFDGEEGFEFEEGEDFFDFEDFEDFCCEAACzroϾννͼ̻̺˹˹ʹɷȶȵǴdzŲűİİİ®®ѿопϾнмλͻͻͺ̺̹̹мZSM.-/2144353221121022031010/1FEFyxzCCD j K 0
~aJ eNeəuԢ|po֠yڣzעz֡yՠyѝv{e7;BJIIGEGFDHEDGFDFFDFEDGFDGFCGFDGA@CMILϿνͽμͼ̻˹˹ʹɷȶȵǴdzƳŲİİðîîѿпоϾнмλλλͺ̺κм^VQ1022024242242242132230120/1DCD{z|CCD j K 0
~aJ eNeəuԢ|poעyڤ{٣zآzסyԟxzjTNLGEHGFGGEGFEGEEGFDGEEFFDGEDGFEGECEBACidfϿϾνͼͼͻ˹˹˹ɷȶȵǴǴƳŲŰııİ®¬¬ѿпоϾнмμμλλ̹ͺнSML--0203424213224224213325/./334kjlCCD j K 0
~aJ eNeəuԢ|ppעzۤ|ڤ|٣zآzסzԟx{g5;CJGJFFHGEGFFHEEHFDGFEFFEGFEGGFHBBDBADϿϾννͼ̻̻̹˹˸ɶȵǴǵƴųŲİİð¯îѿпоϾнмμμμͺλҽTNN002213435335324313213446.-/546ljlCCD j K 0
~aJ eNeəuԢ|pp٤{ܧ}ۥ|ڤ{٣z٣z֡yۣzНvq_A@FHFHFEIFFHGEGGEHGEHGDHEEHFEGFEF@?BJGJпϾννͼ̻̻̹˹˹ɸȶǵȴdzŲƲƱİݯ®поϾннνμʸѿҾzKFD102324425324424435434656-,.768mlnCCD j K 0
~aJ eNeəuԢ|pq٥{ݨ~ܦ}ۥ|ۤ{٣zأz֠yޥ{oOKLJHIGFIFEHGFGGFHGEGGDGGDHEEHFEHFEH?>ALGEпϾννͼ̻̻̹˹˹ɷȶȵǴƳŲƱƱıį¯®ѿпоϽϽ̺̻©yoi>;=102435546335435435435657--.;:>?VRPпϾϽνμλ̻˺˹˹ɷȶȵǴƴƳŲıŰŰï®ѿϿϾμ˹êYSO436013436546545446346235646424324^\^CCD j K 0
~aJ eNeəuԢ|pĕqܦ}ݨݦ~ܦ}ۦ|ۤ|ڤ{סyܤ{آxk\>?FGFGHGHGEIFEHFEGFFGFEGGDHFDHEEGEEGB@CZVXпϾννͼ̻̻̺˹˹ɷȶȵǴǴƳűűűį¯®ѿоνϾĮ¬uleFBC.-1103778556455546535535768203.,.YWZCCD j K 0
~aJ eNeəuԢ|pĖrܧ~ިާݧܧ}ܥ|ۥ{ڣzءz֡xΛuj\EEHEEHHGIFEHFEGFEHFFIFEHGDHGDHGEGEDF??B][[Ͽξνͽ̼̻̺˹˹ɷȶȵǴǴƳűűıį¯ŮŮ̹{piQKK0/3,-0778869647647657546535879,,-B@BljlCCD j K 0
~aJ eNeəuԢ|pĖrݧ~᪀ߨިި~ݧ~ۦ}ۥ|ڣ{٣z٣{٣y͚uVONABGHGIHGHHFHGEIGEHGFHGFIGFHGEGGEHFEHA?BWSTϿϾννͼͻ˺ʹ˹ɷȶȵǴǴųıűŰİðįưȳDzŵyphbLGF-,0*+/76898:657657647647657656657++,>=?{y|CCD j K 0
~aJ eNeəuԢ|pŖrߧ⪁ੀߩި~ݧ~ݧ~ܦ}ۥ|ڤ{٣{آzԟx~eVONBBFGFHIGIGEHGEHGEIGFIGFHFEHGEHGEHIGJ?<@OKNϿϾννͼͼ˺ʹ˹ʸȶȴȴǴdzƳdzȳʵ˵ν~tqiePLJ227$%+..1989:9;779567567657557567657323646ONOCCD j K 0
~aJ eNeəuԢ|pŖrߩ㬂᪁ᩀߨިިܧ~ܦ}ۥ|ڤ{٣zעy|~eUONBCHGFHHGIHGIHFIGFHGEHGEHFEGFEGGEHJHK?=@B>A}ww¿ϿϾννμ̼˺˹˹ʹɷʶʶʷʷ̷wo^WV@=@$$('(,014879<;<:8;758758767567568658658545102;:<^]_CCD j K 0
~aJ eNeəuԢ|pƗs䭃᫂᪁ੀߩߩާܦ~ۦ}ۥ|ڤ{٣{Ԡy|~fVPNBDGFFHHGHHGHGFIGFIGFHFFHGFHFEGFDGIHKFEI98=@B?B|vxппϾϾϾνϽϼųĶoicXSS1/3'(,005758<;<=<>:9;98:88:97:869869869778778869869769547435<;=\[^||CCD j K 0
~aJ eNeəuԢ|pƘs᫂毅䭃㬃㫂᪁ੀߨާ~ܧ~ۦ|ۥ|٤{٣z֡xަ{gl]RIIKCCHHGIHGIGFHGFIGEHFFHFEHGEGGEGFEGGFIHGI98<=8;{ttпŵȻnfbYSS('+,-0436658;:<=:=;9;:9::9:99;98:97:88:88:97:97:8798797697684377680/.&%&YX[{{~CCD j K 0
~aJ eNeəuԢ|pƘs㬃氆䮄䭃㬃⫃⫂᪁ੀߨިܦ}ܦ}ۥ|ڤ{٣{ءzܤ{˚uk\HFIKHJGFIHGHHFHGFIGFIGFHGEHGEHGEHFEHFEGGEGEEG==?C>?vppоɹôǻvnjVOO203227658769;:=:9;::;;:<;9<:9;:9::8;98;99::8;98;98:98:97:98987987:439547B@a]^˽ĸ˾ùysh``C>?64697:97:87:87:98;9:<;:;<;<;:<;:<:9;::<;:;;9;:9;:9;:8;98::9:98;:9::8965954:?=;C@7OJ7OXmd&^_d뤤CCD j K 0
~aJ eNeəuӢ|pǘt䭄鱇篆毅宄䭄䭄㬃⫂᪁ੀߨިݦ~ܦ}ۥ|ڤ{٣zآzۤ{٣yibWQMJKCDGHGIIGIGFIHFHGEIGEIGFHFFHFFHGEGGEHGFIDCE?>@A@BCCFC@Db^_~þʾĸȾùvpf\UMHH@?@=<>;;=:9;76:64987:98<;:=><>>;=<;=;:<<;=<;=;;<::;;9;::<::<;:<;9<;9;;:;:9:76:55:98:DBph@?=@FCEIHJKIKb\]ƼŸŻ~~ypjhSOOFDEECEA@B>=?;8:75964877:98<;:<>=>>=?><>=<>=;>=;><<>=;=<;=;:<;;<;;<;;;;:<;:;<:;=<<:9<75;55;98:DA;HE=[V?EKJC¯Leƹand&abgꧦCCD j K 0
~aJ eNeəuӢ|pșu密볉豇豆簆毆毅宄䭃㬃᫂ߪߨߩި~ݧ~ܦ}ۥ|ۥ{٣zסzڣzߦ{ӝvheYSNJKEEHGEJJHIIHIHFHHFHGEIGEHGFHGFHGEGFDGFEHGFIHGJEEGBAC=AA>BA?A?=@?>?>=?<<>===>=>=<><<=<;==<>=<>=<==;==<<><<<;<98;77;44::9;DA=HE=_Y@~FILðNθPɵNEKeɻbpe'bbgꨧCCD j K 0
~aJ eNeəuӢ|pəu簇촊豈鱇鱇豇氆寅宄䭃⫃᪂ઁੀߨިݧ~ܦ}ۥ|ۥ|ڣ{סzסyݥzۣyovcfZSHFI?AGFEHKHIIGIGFIHEIGEHGFHFEHGEGGEGGDGFDHFEHGFHIGIIGKEDHA?C?>@<A86:31510422545778:99<::=>=>AAACCDCACB@AA@A@>A?>?>>??=?><@>><=>==?>?>>>99=:8=76<34;98f]BFJLOʵQϺQɴPƱPİOFMfʼcqe(bbgꨧCCD j K 0
~aJ eNeəuӢ|pɚv籇곉걈鲇鲆氅尅毄它䭃⬂⫂ᩁߨިݧ~ܦ}ܦ}ۥ|ڤ|ءzՠxءyޥ{ӝwk{gYSNMGFICCGDDGJHIIFIGEHGEHFFHFFHGFGGEGFDHGDGGDGEDGECGGCGHEHGFHGFIHGJIHIIHJEEGA@C>=@<>@=:9=98<99;::<;;=<:;<;;==>AABDDCEEDFDCEDBDCBDBACBABB?A@>@?>@@>@@>@?>@?=@?>?>=??=??=@?=?@>?@?@A??@>?<;?:9>99=33<55>>=>CC>IF?\WBskE{EJOįOͷRлSɴRDzRűQƴRʵRȳPFMg˽dpe(bbgꨧCCD j K 0
~aJ eNeəuӢ|pɚv豇볊겉鲇鲇豅氅毅宄䮃⬂⫃᪁ੁߨިݧ~ܦ}ܦ}ۥ|ڤ|٣{٣{סyԟxڢy٢yǖrfucWRMMGFJBCHCDIIGJIGIHGHGFHFFHFEHFDGGDHGFGEFGEEHFEFFEFEDGEDGECFDCFDCEEDFFEGGDHGEHEEFEDFFEFFDGFDGFDFEDFEDEDDEECFEBEDCEDCDDCDCCDBACB@CA?B@?BA?B@?B@@A@?A@>B@>A@>AA?AA@A@?AA@AA@AA?@?>@<;?;;?:9?66>46=67=<;>>=>??>FD?MHAulFtkF}IMNPïQкRҼTɵRƲRűRȴRɵRʶQʶRʶRǴPF¯Mg˽dpe(bbgꨧCCD j K 0
~aJ eNeəuӢ|pɚv貈촊볉겈鱇鱆豆篆殅䮄䭃㬃⫂᪁ੀߨާݧݧ~ܦ}ۥ|ڤ{٣{آzסyԟxӞwޥ{١wjzb|g[WOOIGIIGICBICBIFDHGFHHGHHFGHFHGFHFFGFEGEEGFEFEEGFEGFCFFCGDCEEDFDDEECEEBFDBFDBDCBDDBDDBECBDBADBADBADBADBACB@CB@CB@CB@BA@BB@BA@BBABBABA@BB@AAABBABBABA?B=<@<;@==?>=@@?@EC@DA@MIAf`EnfGzpGMMQQƲSտUӾTκU˷UƳSƲSɵSɵSʶRʶR˶SʶR˶R˷RɵPG®Ng˽cpe(bbgꨧCCD j K 0
aJ eNeəuӢ|pʛw賉촊쳉겈鲈鲈谇篆殅宄䭃㬃⫁᪁ੀߨިިݧ~ܦ}ۥ|ڤ{٣{آzءy֠xӟwΚuƕoȗrėuhiWM=:9DCDHFIDCHCAIBAHDBGCCFFFGIHHIFHGEHFEHGEGFEFEEFFEGFDGDCGEDFEDEECFEBFDCFDBECBDDCDDBEDCEDCEDADCBDCBDCBCCBCCBDCADCACBBBDBCCBC?>C>=B?=B<<@9;@99A<:@?=@?=A>=@A@ACAABAANLBibFleGxpIMNORSSXԿWVιUʷTƲTDzTɴUʶU˷T˷T˶T˶TʶTʶT˷T˶SʶS˷SɵQHNg˽cpe(bbgꨧCCD j K 0
aJ gNeəuӢ|pʛv괊촊볉벉鲈貇谇篆毅宄䭃㬂⫂᪁ੀߩߨާݧ~ܦ}ۥ|ڤ|٣{آzסyءyҞvloڦ~Ԣyz\I$ oe6xQd`MNKHGEIDDHDDHCBGBAGBAGCBGDCGDBGCBGCCFCCFDBGGDGGEFEDFEDEEEEEDFFCFDDFBBEA@DBAEB@EA?DA?DA@D@@D@?C@?C?>C<;B<;B<=B?>B>=B@>BC@C<;AMJCiaHkcHkdG~vKONPTSUϺXYԿYϻXWWƳVǴVɵVɵU˷U̷V˶U˷U˷U˷U˷U˷TʷU˷U˷UʷT˶S˶S˷TɵRHNg˽cpe(bbgꨧCCD i J .
|_ fOeɚuӢ|o˛w춊촉볈겇鲈谇簅毅它䭂㬂⬁᪀ᩀߧ~ި~ݧ}ܥ|ۤ|ڣ{٢zڢzԞvnpԣ}ɚunRD1ǽg]D}MvoRtmR[WLCBHCDHCBGCAFCBGCBGCBFBBFBBFBAFC@FCAFAAFAADB@DB@EA@EA@DA@D@@D@@D@?D@?D@?D@?D@?D??B??B@>C==C=E=>D??E::A=<=[VGibLfaKgaLg`LgaKg`Kh`Ke^KicKyOSRRSVWWXн[\Ѽ\κ\κ[λZ̸ZʷZʷZʷY˸Y̸Y̸Y̸Y̸Y̸Y̸Y̸XX̸X̸W̷W̷XͷW˸W˸V̸V̷V˷V˷U̷U̷U˶U˶T̶U˶T˷T˷TɵRHNg˽crf(bch訧EEG b E , ~_ iOeɚuԢ|pÖsު㮃ଃૃૂޫުݩܨܨۧۧ~ڦ~ؤ}ؤ|أ{ע{բ{բ{աyԠyԟyӟxҞxўwНvϜvΛuϜuʘrlpӢ}ʛu~_L 4qeBŲVhhgffμd__^^^^OSWVUVROWZZZZZYYYYƴ\^ϻ^н^ѽ^м]ϼ]ϼ]κ\̸\̹\̹\̸\̸[̹[̹[[Z̹[̹ZZZZ̹Z̹ZZYYYXX˸W̸X̷W̷V˸W˸W̸V̸V̸U̷V˷U˷T˷T˷U̶T̷TɵRHNh˽csh(bci秧HHJ t Y ? ' ~` hOgɚvӢ}rnrÕrÕrÕrrqqrqqqqqppooooooonnnnnnnmkrԢ|ɛufS"
s6qeBıWѿhhѿfeҿeҿefeӿeӿeҿdҿddҿdҿcӿcӿcѾcоbѾbнbнaнaнaнaнaн`н`н`м^ϻ^λ^μ^λ^ϻ^λ^λ]λ]]ͺ]ͺ\ͺ\ͺ\\\ͺ\κ[κ[ͺ[̺[̹[ͺ[̺ZYY̹Z̹YX̸X̹YY̹X̹W˸WW̷W˷V̸V̸V̸U˷V̷U˷T˷T˷T̶U̷UɵSIOg˽cwk)dej䧦LLN } w f N 7 " a kSgǙtգ~̜xǘuŗtŗtƗtƗtŗtŗtƗtƗtƗtƗtƗtƗtŗtƗtƗtƗtƗtƗtƘtƘtƘtƘtƘtƘtƘtƘtƘtƘtƘtŘtŘt̜xգ}ɚtnY-!Z8peBñVоgоgнfоfнeϽeоeѾdѽdнdнcнccҿcҿcҾcҾcѾaҾaҽbϽaλ`λ`ϻ`ϻ`λ_λ_ϻ_ϻ_λ_ͺ_̹^̺^̹]ͺ^ͺ]]]\]\̹\̹\\\[Z̹[̹Z̸[̹Z˹Y˸Y̸Y̸Y̷Y̷X˷X˸X˷W̸X̷W˸V˷W˷WʶVʶU˷U˶UʶUʷU˶U˶TʶTʶT˶T˶UȵSI¯Og˽czo,fglާRRT a ` Q ? - ` kPf̛w㭆㮆⭅ᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄᬄ᭄᭄᭄ᬄᬄᬄᬄᬄ᭄᭄᭄⭄᭄宆㮅͞xvb:*B;peAǴZmmllkkkjjjjjiihhhhhҿhgҿgӿgҿffҿfҿeҿeeeeddcӿcӿcӿcҾcѾbҾbҾbҿbҿbѾaѾaѾ`ѽ`ѽ`ѽ`ѽ`ѽ^н^ѽ_м_н]ѽ]м^м]м]м\м\м\м[м[л[ϻ[лZлZϻZϻZлZϻZϺYϻXϻXϻWлXUJ°Of˽cv.
jkpץYZ\ C F < / ! c x[fnəvʛwʛv˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w̛wɚvn~eS=%4oѿ]A>??????????????????????????????????????>??>>???????>?>>??>??>???>>>??>>>>>>>>??<¬Haɻa50*_stz˞mnp
ˠ{crVjNhNeKdJ}_H}_Hz^Gy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fy]Fx\EbIlK {>uwifggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggfmwiɻ`nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmnkŶZ@[P"2efrRxxzxxx{ozz}m{{~l||l}~k~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~j~~i~o~}muuw5 eb`a}_z]GwZEx[Fw[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ew[Ev[Ey]FtB ?@CöEöEµEôDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDĴDôDųBª>ug( "
#
! $ %'(.//205637746746746746746746746746746746746746746746746746746746746746746746746746746746746646644897:>=540 E= 5'$}#w"v"w"t!q p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p o u%y+ob'
73UP<kll J l !002334--/UUWrrtiijkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklkklllmnnp @;76;aU RIVM VL UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK UK VL SJ B; ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ( ; S , +
46 G X d ^ L>Z"
.
) * .0N u Q_ 5 ' (
! ! 0 8 ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; : 9 1 "
JN #'43C8K8K8J5G+8 ) nl$ "Fetxyyyyyyyyyyyyyyyyyyyyyyyx t e H ' V %7GBV@T7H/>*6'3'4,:2B:M?T8L$1
* # Z m H 7 4 5 5 5 5 5 5 5 5
6 .aT $>PCV0=! %09L?U'4 b > wh DMHʖBݑ@搄?鐄?鐄?鐄?鐄?鐄?鐄?鏄?鏄?鏃>鎃>鍂>鋀=~=~<~<~<~=鋀=鍂>鎃>鎄>鐄?鎃?蕉@YP! oinqrrrrrrs l[
6EGY,6
%:M=Q
= iS ĵYjcggggggggggfed̽bƸ_³\[[[\ŷ^̽adegdu|9 O EV VJ
[M
^P
hYxgv#;cuk.OPXߡ##GV6@
"E[" 6 = W= ŷ[ʺ[,$%$#$"! dW#
<3
SG XL ^Q
o_
o [md*PPYgf 9DES
'1BV
) = W= ŷ[ʺ[,$&$$$"! B:
D;
UI [M
hZObZ%OOW❜Q`
:K/> W = W= ŷ[ʺ[,%&%$$#! 6/
70
UI
WKCTN LLS䙙cb FS9B
FY #, = W= ŷ[ʺ[-&'&&$" 3- TC/WF48.%
91SHwo;IBHHN敕 N]
9H/< ? = W= ŷ[ʺ[-&'&%$"H@# lKN}M}NrKhR7/'"
D;nf5?9BCI鏎¼ :C\e@?IIHHAA66##
#*DU = W= ŷ[ʺ[-&''%$l^
qQOxKxLwJyJ~MzNlV=
%!jb294>>Dꊊǿ^] lvhkNNRRPPQQPPOOEE..
EV! JC T9 ŷ[ʺ[-()&&!
gHRyN{N{MzLxLwLwJMlF$ ZU,94;;A쇆.- UWJJNNNNNNSSRRTTWWPP77
W|P}Q|Q|P{NzMzMzMvK~NiF FB&;6:;@셅 :>NNMLMMJJSSVV
7A9H J
$Y˻[.)((y! <3+XS~S~R~Q}Q|Q|P{O{NzMxKPM?1 ;7"=7;;A놆OTyHHKKLLIISS`` 77CC\bLZ ^
5ELMMMMMMMMMMMMN K PUͼ\/))(KB pRWTUTS~R~Q~Q}P|O{OzMOdO5
>;$@;=>Dꉉ[aw~FFKKLLHHRRff""MMNNFE`dcp t
1 ] { QϾ]/)¨*%
UH;\VWVUUTS~S~R~Q|PzNSUF5
C>'HBBCI菎 _dv{DCJJJJGGPP??KKHHDB\`hv | O5 @*1
W
Mп]/)Ī+k] uTZYXXWVUUUT}R}PVkL
WS0TL GHO啔Y`v|DCHHIIFFPP99IIGGBA\`gs t .V )uN83a5f3a1_1^1^1^1^1^1^1^1^1^1^1^1^1^2^1_5!ԦH^/*)5/
J>2_ZZZYXXWVVTV~VgT=
|BaY$LMU㚙KOx~DDGGHHEEOO88HHFFA@_dam \ /Y )sM?8m9m7h7k8k8k8k8k8k8k8k8k8k8k8k8k8k8k=x<&٥G_/ƫ+&hO`[\[ZZYXXWYjM-'#
>7Xja*OPY47HHEEFFDDLLyy99GGDDA@fmWa H /Z *uN=7k5dGzH}H|H{H{H|H{H{H|H|H{H{G{H{I|6b9q;&٥G_/Ȯ,}n$
%" ]^]]]\[ZYY[iM
5/~%̽bsj-QQZ44PQDCGGFFFFFFFFFFFFEEEEEEEEEEEEEEEEEEDDDDDDDDDDDDDDDDDDCCDDCCCCCCBApyCK * /Z *uO>7k8hVÌYȏXǎWǎXǎXǎWǎXǎXǎWƎXǎXǎWǎXƎWǍ9g9q<&٥G_0Ī,WN F<1c`_^^]]\[Z\/)%
91u(fwm.PQYᦥQQ w}`cBBHHGGGGEEEEDDDDDDDDEEEEDDDDDDCCCCCCCCDDCCCCBBBBBBBBBBDDDDDDBBIJw&+ *, /Z *uO>7k9i\^Ǒ]ő]Ɛ]ő]Ɛ]Ɛ]Ő]Ɛ]ő]Ő]Ő]ƑZŎUċ9g9q;&٥G_1,4/ hWGg`a``_^]\]xY=5m^r'euk.KLV㥤zy W[w|CCGGGGGGHHGGGGGGGGFFFFFFFFFFFFFFFFFFEEEEEEEEEEEEEEDDDDDDDDEE??Z^oz /Z +vO>6j:icƓeʖeɕeɕdɕdɕdɕdɖeɖdɕdɕdɖbȓZŎUċ9g9q;&٥G^0-0,
vaJjbbaaa`_^^xZ
&"XL\Oscu"\sh-754432543543543543544320 %'QQDDHHGGGGGGGGGGGGGGGGFFFFFFEEEEFFEEFFEEEEEEDDDDEEEEEEEEDDDDBAryNU ; /Z +vO>6j;jjȘl͛k˚k˚k˚k˚k˚l˛k̚k˚l˚i˙bȔZŎUċ9g9q;&٥G_2.2.
ydKjddccba``_`($! F>WK`Rqb MOFIKLMMMNHmf kqquBAGGGGGGGGGGGGGGGGGGGGGGGGGGFFFFEEEEFFFFFFFFEEEEDDDDDDFFAATW{ u /Z +vO>6j6j=kx̡{ҥyФzѤzФyФzѤyѤzѤwТp͞i˙bɔZŎUċ9g9q;&٥G_3Ĭ0QH VJ>mgfeeedcba`b92, I?VJYMeXxgy !"!""#§ueW ]`GHGGHHGGGGGGFFFFGGGGGGGGGGGGGGGGGGGGGGFFFFFFEEFFFFFFAAcgy /Z ,vP>5j>lϧԪөөԩԩөө~ҧwУo͞i˘bȔZŎTċ9g9q;&٥G_2ʰ1pc%
*&$fihgffeddcac~[%"
;4TIYMdVxgz 80 {~ruDDHGHHHHHHHHGGGGFFGGGGGGGGGGGGGGGGGGGGGGGGFFFFFFBAWZ58 6 /Z ,vP>5j?mҫׯ֭ծ֮֮ծլ~ҧwϣp͞i˙bȔZŎUŋ9g9q;&٥G_2ɯ1,m\Johihggfeddbew\
+'NDWK_Rrbt - moDDGGHHGGHHHHHHHHGGGGFFFFGGGGGGGGGGGGGGGGGGGGBATWKO y]] y /Z ,vP>5i@mհٴسٳٳسر֬~ҧvТp͞i˙bȔZŎUċ9g9q;&٥G_31©1G@ %##fmjjihhgfeecev\" !
J@VJ\Ol]n !Ĩ|@+,qtHHFEJIIIHHGGGGHHHHHHGGGGFFFFGGGGGGGGHHFFBBZ]QV ( /Z ,vP>5iAnܸ۷۷۸۵رլ}ҧwϢp͞i˙bȔZŎUċ9g9q;&٥G_41ɰ3*H?8plkkiihhgfecg{_(%#
@8VIZMgY{j} ũsH$$STDDGGIJJJIIHHGGGGHHHHHHHHGGGHGHFFBBHHjnHK zf -
/Z -vP>4iBoں߽ݼݼݻڵذլ~ӧwϢp͞i˙bȓZŎUČ9g9q;&٥G_4ª23é2E> hYJskllkihhhgedfc?7/
3-RGWKcVwfz !ŪzB
fhnpOOEDEEGGIIIIIIHHHHHHHHGGEECBHG^`y-, | g . /Z -vQ>4iDpݿ߿ݻڵرլ~ӧvТp͞i˙bȓZŎUċ9g9q;&٥G_4«33ɰ3, q\tlmlkjhhhffdffWJ=
)$PEVJaSudy !ĩ10( 45y{tw\]MMEEDDDDEDEDDDDDIITUilPS
a.^w i - !]> -vQ?4iDpܹٴװԫ|ҦvϢo̝hʘaǓYčTĊ9f9q<'զG_4ë3ª32˲3k_& " crmmlljiihggeeir_L
JAVJ_Rtdx ! l^]
57imvyqsmooqtv{u{HJ
@Q+Xx h -
+oLC3hGrݶڱ{էtҢmНe͘]ɒWɎ9h9q?(ͩI^5ê4ª32ë31=7 -*)ornmlllkihhhfdjqW%"!
J@VJ^Qrbw èWb[ /-MNbdmppsorgiVX;: >L[Z+Xw h - ' ) ) ) ) ) ) ) ) ) ) ) ) )+ S8X4i@kǬɬƧģ~ytoid_ZTN~J{5a9oB*J^5«4©5©33ȯ4/(& 92/nqoonlmkjiihgdia:2-
J@VI^Qscx #ϽUűI(;E[-L 8At]ibVW+Xw h -
% 3O^ccccccccccccce Z;'I=I=I=I=I=I=I=I=I=I=I=I=I=I>LCֱRϿ]6ì6ª6«5ª5ª5©43ɰ4l`' scRyqrppnmmlkihihekkW LBXKfWm "ʹVN%Į@ĭ@í?í?ì>¬=ì=ë=ì<¬;«;«;:9«9«8ª8ª7ª8ì8ì7ë8ë7ê7«6ª5431/r' r]zttsqqponmlkihgcl|hS?7XLcU}k!ǵTM%;AԂk}xtplhc^ZWOS/b y
V % $$ ONXVFDXUVTVTWTVTVTVTVTWTWTVTVTVTVTGEOMJJ1, eKíADZCưBƯBƯAƯAů@ů@Ů?Ů?Ů>Ů>Ů>Į=ĭ<ĭ;ĭ;ĭ;ĭ:ì9ì9ì8¬8ë7ë7ª6ª542/)`V" _SH¤tuttrqpnmnopoomhmbSE LAZMl^w òSK&=Cx{zzzzzyyyyyyxw}2g w
W ( $$ ONWUIG^]][\[]Z][]Z]Z\[][\Z]Z][[YWTFCPMJJ1, eKîAǰCưBůBƯBƯAŮ@Ů@ů@Ů?Į>Į=ŭ=ĭ=ĭ<í<í;ĭ;Ĭ:ì:ì9ë9ì8«8«7653/*OG! n_P¤vvuttrqttmbpVlV~kZkRrWeoD<5
-(VJ^Rzi PL.7Ulhhhiiiiiiiiiiiijc Mp e 0 $$ ONWUMJeccacbdadbdacbdadbdadbb`\ZWTFDPMJJ1, eKĮAǰDƯCŰCưBƯAƯ@ůAů@ů?Ů?Ů?ŭ>Į=Į>ĭ=Ĭ<ĭ;í;ĭ:ī:ì9ë9ë8ª763/)KC! <74wzxxwutxsr\TI?1,(" !'$#_P?d%" C:ZNk\sJTC=29(5=(5<)5=)5=)5=)5=)5=)5=(5=(5=(5=(5=(5=(5=(5=(5=(4<(8?+(( q 7 $$ PNWUPNmljhkikijikikikijikiihca[YWUFDPMJJ1, eKĮBDZDưCŰCŰBƯBƯBůAů@ů?Ʈ@ů?ŭ>Ů>Į>Į=ĭ=ĭ<ĭ;ĭ;ĭ;Ĭ:ì9«8740})C<" ! ZPGx~zyyxw{yb>72 saLkU
&#UI`SyhBɼgecdcddddddddddddddce}7 w9 $$ POVTSRtsrprorprprprpqprpqojhca\ZWTFCPMJJ1, eKĮBȱDǰDưCƯDưCŰBƯAƯAƮAƮ@ů?ů@Į?Ů>Į=Į=ĭ<Ĭ;Ĭ;ĭ;ì;ë9851z)62! ! ! !+((wd||{zx|xgU +*+334..//./!!!92-o=60
B9\Om^|/=CFFFFFFFFEFEEEEEEEFh@ x: $$ POVTWU|zywywyxywyxywywwvqpjhca\ZWTFCPMJJ1, eKĮBȱEưDǰDưCưCưBŰBƯBƯ@ůAƮ@ů@į?Į?ŭ>Ů=ĭ=ĭ<Į<Ĭ;ë:973~o*-+! !! ! !! E>;wĩ}|{~uaDDC;::@71ptY($VJdWp (b> x: $$ POVTZY}~~~~~~}xwqpjhca\ZVTFDPMJJ1, eLĮCDZFǰEƱDưDưDưCưBưBƯBƮBůAů?Ů?Į?Ů>ŭ>Į>ĭ=ĭ<ì;;84r,'&# !""""!" dYN§~}z<62%$&~~ wdPmkNC9
I@_Rxf !#"#"!!! +d> x: $$ POUS^]~xwqojhca\ZWTFDPMJJ1, eLůDDzFDZEDZEDZDǰDưDƯCưCůBưBƯAƮ@Ů?ů?Į?Ů>Ů=Ů=ĭ=«;96t-('# "####"# !{l]ūl !
@93ohkx^5/\Pn_{!"###"!!! +d> x: $$ POUSa`}xvqoihca\ZVTFDPMJJ1, eLŮEȲGƱFǰFDZEDZEưDƯCƯCưCŰBƯAƯAƯ@Ů?į?Į?ĭ?ĭ=ì<;81-*% #$##$"$ " !zjȯ§|d101*''eokil?70%"TIfXs "###"#"!!! ,d> x: $$ POURed}xwqojhca\ZWTFDPMJJ1, eLůEȲGDzGǰFDZEǰEDZEưDǯDƯCŰCŰBưBƯAŮ@ů?Į@ŭ@ĭ>=:2<7& $%$#%$% !)'(pɱ§l )()$""grlmknwePKAbT{k "$$#""""!! ,d> x: $$ POTRhg}xwqpjhc`\ZWTFDPMJJ1, eLůFȲHȱGDZGDZEǰEưEDZEǰDưDưCưCƯBƯBŮAĮ@Į?Į?>;5C>( $&$%%$& "'%&s˳x-** |buoomlme%"";4^Qsd "$$$$##""! -c> x: $$ POTRll}xwqpjhca\ZWUFDPMKJ2, dLŰFɲHȱHDZGDZFDZGưEDZEưEƯDŮCîBB«A@??><8`V, %'%%%%&!!#%%&q͵PH?==>('( x_xqqpnmkpKB9
,'ZNl^{ "$%$$$#""!!! -c? x: QOTRon~|wvpnigb`ZYVSFCPMKK3- dLŰGȳIȱHȲHDzGƱFưEįEíCBA@>=;:997ui/$$&%%''&&$$$$#&sͶ¬ë«ĩ~k ! YYYJJK r`|ssqppnlqsaN! QGgZu!%$%%$$$#"! ! -c? x: %$ QPSQzy~}wuomgf`^ZWHGPNLK60 eLŰGɳIȱHDZHưGĮFDB@=:85320~//|n,+*'##''&'''' !~qdиíĮĭí쫪§[QI""" o`RvvutrppnncJ@eWn!$%%%%$##""!! -c? x: QPVSKJed_^]\ZYWVTSRPOMKJIGFDCB@??=64LJML82 dLưHȳJưHįFEB?<73z/s,|n*wi'rf%pc%ob#na#=8'##(('')') bZR̶ưůůůĮíĬ¬«F@; OE>}yywuusqponj2-*>6aTzi $&&&%$$##"!!" -c? x: )( IGfd^\[Y^\_]`^a_b`b`b`cacbdbececececroPN82#dLŮGưIGD@;5{0q*qe'g\$`U#QH"OG#MF"KD"NE B<"&%)('())* !JDBįʴŰƱưƯƯĮĭíì«aVN$"# TJB{}zyxwutsqpnqMB9 4.^Ruf %&&'&%%$$#""!!! .c? x: HG 65S=<981/))o&%e$#b$#a$#a$#a$#a##a#"a#"a#"a#"a#"a#"`$#b
O0*cKGGB=6w/sf*\R(HB(;7)0/,.,-**-*),))+('+)(**)+)(*)()&%'301кƱȳDzƲưưůůĮĭ쬫Īzzes~||zyxwvtspoubTF +'\Pqb %''''&&%$$#"""" .c? x: # -;>6ʌ2܈}0|0|0|0|0|0|0|0|0|0|0|0}0{2㖊@jID@8x1f\,ID+42,++.))0++/''*!"%$$'''))()*(*&%'""$)(*-*, #kaWDzɴȳȳȲDzƱŰưůĮĮ쬫ĩ~}{zyxwutrps{gU$"UJo`| $'''''&&%$$##"" .c? x: E C\gebdeeeeeeeeeeeeedaŶZ@=6g^.@=-,,/))/.,0.-.(&(&%(<98d\V}qd[V)')&&(*(+/-/~ӾdzɴɴɳȳDzDzƱůůĮĭìë«~}|zyxvusptrY! QGm^z $''('&'&%%$$### .c? x: I @RdHIKJJJJIHHHGGGGEEC?:~q4GB0--0++01/110/''),+-VPM²ǯƮ쪪ë522&%'%$&855ϻȵʵɴɴȳdzƲƱŰůůĮí¬«ª~}{zywutssj MCl]x %((((('&&%%$$##!/c? x: H @ScM˷W̹XW̸W̹U̸U̸U˸T̷T̷S̷S̷SʶR˵PȳOMH>g^5311++11/1312+*,('*ZTQîȱìνͼμλμͺ˺ŭ643(') #e\VҽʶʶɵɵɴɴDzDzƱưůůĮí¬«ª}|{yxwuttm"!! H?k\v %()))((''&&&$$$!/c? x: H @ScLʶV̸W˷V˷U˷U˷U˶T˶TʷSʶR˶RʵRɵQȳP®MI?SM4,+2//2322201'&)EBBİ˴пѿѿппоϽϽ˹Ŭ+*,(')+*+ӿɵʶʶɵɳɳdzDzƲŰƯŮĮĭ¬«~}}{yxvtvk%"! H?iZt %()*)((''&&&&$$"/c? x: H @ScL̷WX̷W˸V̸U̸U̷U̶U˶T˶S˶RʶRɴQįOJ?NI5)*22233230/2*)-ha\ȹθîíѿпооϽͻīyn%%'!!$c[UӾ˸˷ʷʶʵɴȴȳDzƱưƯůĮí¬«~}|zxwuuo.*) G>gZs %)***)(''''&%%%#0c? x: H @ScL˷W̸X̷W̸W̸W̸V˸V̷U˶T̷T˷SʵRƱPMCJD4++3544434..00/1z̷ȴ®İİïîî¬ѿппϽϼ«e]X !755Ҿ˷˷˷ʶɵʵȳȳDzƱŰƯĮĭì««~}{zxvvr50/ =6hZs &*****))'('&&&%#0c? x: H @ScL˸XY̸X̸X̸W̷V̸V̷U˷U˷U˶SȴR®OGSN8-,4544445//1969лƳıƲűűűİįïîѿпν«966 !yoʷ̸˸˷ʶɶɴȴȳDzƱŰůŮíìì«~}|zxxwr3// :4j\v &+*++**))('''&�c? x: H @ScL̸YYY̸X̸X̸W˸W̸V̷V̷UɵSűQL`Y;**4655546001646ӿƳǴȵǴƴƳƲűűűİïîѿѿμǯx !OIGλͺ̹˸˷ʶʵɵȳȳDzDZưůŮĭììª~|{yxxr1-, :4l^x!'*+,++*)*((('&&$1c? x: H @ScL˸YZYY̹X̸W̷W˷W˷V˶UǴSűPyB115656546325314ǵɶɶɵȵȵǴǴƳųƲűűİﮬоѿRLI))+̹̹˹˷ʶʵʴȳdzdzƱŰůįĮȯȰŭŬ}|{yzr.*) A:n_z!(++,,+*+)))((''%1c? x: H @ScM̸ZZYYY̸X˸X̸W̸WɵUɴRK<97326656656-,0{ɷʹʸʸʸɸɶɶȵȵȴdzƳŲűŰİﮬϽǯ #{oŬ̺ͺͺ̹˸˷ʶʵʴɴȲDzƱŰůíɱaXN953XQGyǭ}|zzr&%$ LCpa|"),,--,+**))((('%1c? x: H @ScM̹Zͺ[̹ZZYXXW̷VȵUıQc\?//6878878--/hb_Ͼ̻˺˺˺˹˹ʸʸʸɷɶȵȵǴƴƳűűİðî¬ůWQNZSO«μͻκ̸̹˷ɶɶɴȳDzDzűůȲ<85 " /,,tĪ}|{{u%$% LCsd#*-----,+++)()((&1c? x: H @ScM̹[ͺ\̹ZZZYYXʶV̹VJ547757778324GDE˾˻ͼ̻̻̻˺˺˹˹ʸɷɷɶȵǴǴƳŲűŰİïпɳD@?ʸѿλμͺ̹˸˷ʶɶɴȳDzDzïϸoeY )(('%&)'(tgYȮ}{}l"!# MEvg%+-..-,,,++***((&2c? x: H @ScM̸[ͺ\̹[ZZ̸ZY̹YʶWdzT`Y?/07:99989.-0˻ξνμͼͼͼͼ̻˺˺˹˹ʸɷȶȵǴƴƳŲűİﮬ®f]ZŮλϼμͺ̹̹˸ʶɶʵɴȲDzįѺ^VN )'(&%& g\Qª~|yb " TJzj &,-...--,+++*)))'2c? x: H @ScM̹\κ]\ͺ[ιZZ̹Z˷XκXN96987998:324VQQ˼ϿϿϿξξνͽͼͼ̼̻˺˸ʸʸɷȶȵȴǴųűİİï˴|ɰνϽϽμͻ̺˸ʶʵɵɴdzŰкsh\ )() f]QǯĬ|}l[ "!! "'% [P~n (-/.//.--,,,+*)*'3c? t8 H @ScM̹[λ]ͺ\ͺ\ͺ\̺ZZʷYκXphD008:9::9:113οϿϾνμͼ̼˻˺˹ʸʸɷȶȵǴƳűűİ®ưŵпϾϽϼλͺͺ̹˷ʶʶɵȳDzɴKE@ i_Tȱĭ}çi[O$## "+) bVt!)../....,,,+**))'3bA g2 H @Sc®M̹]λ^κ\ι\ι[κ\̹[κZTFC<76:<:;436NJKɼϿϾννͼͼ̺˹˸ʸɷȶȵȴƳŲŰİ®îппоϽμλ̸̹˷ʶʵɴɳƱ̷oíư«¬«~XOF $## "0, gZs$+012111100////..,3`D xP% H @Sc®N]λ]κ]κ\κ\ι\˸[ѽZN44:;:;<:=004}xϿξννͼͻ˺˹ʸɷɷȵǴƴƲűİﮬѿѿоϼϼλ̹̹˸˷ʵʵȳȳƱɳϷůĮĮ¬«|@:6 $## "@=)|q6FT˺Zо]]^^^^^^^^^^^^^]nF e; H @ScN̹^λ^ͻ^ͻ]κ\κ\˸[ҽ[kdE23;=;<:8;:9;Ͽννμ̻̻˹˹ʷɶȵȵƴŲűŰïîѿпнϽμͺ̸̹˸˶ʵɵȳȳƱİůůîìë«x(&' !!#"$ ";5 f^-~v9ꘐDᢙIᡘI矖IꟕH쟕H쟕H쟕H쟕H쟕H쟕H쟕H쟕H쟕H쟕H쟕H쟕H잕HKzn0 f4 H @ScNͻ^λ_ͻ^λ]ͺ]\ϻ\WMJA76<=;=669UONϿοξμͼ̻̹˸ʸɶɵȴƳųűıïѿпϽϼλͺ̸̹˷ʶʶʵȳDzDzưŰįĭì«|g "#"###$#"#
;+ R>,S?-O<+M:)K9)K9)K9)K9)K9)K9)K9)K9)K9)K9)K9)K8)J8)N;*2& p 5 H @Sc®Nλ_ϼ_Ϻ^λ_κ^̹]ӿ]S87;=;===>103xroϿξνͼ̼˺˹ʸɷȵȵǴŲűİįонϼλͺ̸̹˷ʶʵɴȳDzDZưůŮĭ¬«ŪnaT %%%$!##+' T9!w\ԣ}ԣ}إ٦٦٦٦٦٦٦ڦڧڧڧڧڧ٦ૃdL s7 H @Sc®Nκ_ϼ`λ_λ^Ϻ^̹^Կ^O44<><>=<>325ξͽͽͼ̺˹ʹɸɶȵǴƳŰİïîѿоϼμͻ̹˸ʶʶɴȳdzƲưůůĮìNGB &&&$ #"4+ ^> ޤz]ŗsjmmlllkkkjjjjihiԢ}aJ t7 H @Sc®Nκ_ϼaμ_ϻ_λ_̹^ӿ^ogH66=?=?;;==<>Ͽννͼ̺˹˹ɷȵȵǴŲưݯҿпϽϼμͻ̸˷ʶʵɵɳdzƲưůŮĭ¬«|/--""#%%&$!#!<. gD$ܪ}`ŗs̙rסyԟwҝtћsϙr̘pʖoȔmƒlĐjhfecdҡ|aJ t7 H @Sc®Nͻ`ϼaϻaϼ`ϼ`̺_Ѿ][VD76=?>?;:?>?:9;LIJпννͼ˺˹˹ɷȶȵƳűűïíѿоϽϼλͺ̹˷˶ɶʴȴdzDZŰƯĮĭ¬«ū^TM (((&#%$,) V;&yP * رeɚvНvۥ|עy֠xӟwҝvќtΙr͘q˖oʕnǓmőkiggӢ|aJ t7 H @Sc¯Nμbнbϼaμbλ`ӿ`YHEA=A?@@?A769kfeϿνμ̼˺˹ʷɶȵǵŲİİ®¬ѿоϽμͻͺ̷˷ɵɴȳȲƱŰůĮí¬«ǭm !$)()&&''&(+XA'nJ,[ - ֵfʜwӠxߨۥ|٣{آz֡yԟwҝuЛtΙr̘p˗pɕnǓlőjiҢ|aJ t7 H @Sc®OμcнdϽcнbͻbcU66?B@AA?B668qnmϿϽͼ̻˺ʸɷȵǵdzƱŰïпоϼμͻ̸˷ʶʵȴȳDzƱŰůĭì«ƭYPJ #))*'$')2.0oO+vO/` .!նgʜwԡz᪁ݧ~ۥ|ڤ{آz֡xԟvҝuЛtΚs͘q˖pɕnǓliҡ|aJ t7 H @Sc®OμcнdмcнcͻbcV77?B@AB@B87;jecϿνμ̻˹ʸɶȵǵƳűİ®ѿоϽμͻͺ̹˸ʶʶɴȳdzDzŰůîì¬ŭ0.0&&(*(*'#',K=6[.~U1e / նgʜw֢{㬂ިݧ~ܥ}ڤ{آz֠xԟwҝuЛtϚs͘q˗oɕnjҡ|aJ t7 H @Sc®OϼcнdнdмcλbdW77@CABB@C::>[UUϿνͼ̺˹ʸɶȵǴƲŰðпоϼμͻ̸˶ʶʵɳȳDzƱůůíìʲwj\ #+++('*(+*3jN5;^Bm4`3i 0!շgʜw٥~簅⬃᪁ੀݧ~ۦ|ڤ{آz֠xԞvӞvќtϚr͘qlҡ|aJ t7 H @Sc®OϼeѾfоeоdμdeX99@CCBBAC?=@IFHϿνͽ̻˹ʸɷȵƴƲİïѿоϽμλͺ̹˸˷ʵʴȴdzƱưůŭ˳yk##'-,,*)+)&)5bKCkGv6c3k 0!շgʝwڦ~鱆䭄⫂᪀ߩݧ~ۥ|٣{עy֠wԞwҝuЛsϙslҡ|aJ t7 H ASc®OϽeѾfоeоeμdfY99ADCBB@C@>BDBDϾν̻̺˹ʷɶȵƳűį®поϼμͻ̸̹˷ʶʵɴȳDzƱůĮĮGA>%%(,,-*&).>6?aJtK}6e4k 0"նg˝xܧ곈毅䭃㬂᫁ߩݧ~ۥ|٣{עz֠xԟvҝuћtmҡ|aJ t7 H ASc®OϽfѾgнfнeͻdfY88BECDBACBAB?>@Ͽνͽ̻˹˸ɶȵǴƲŰïѿонϼλͺ˷ʶʵɴȳDzƱưí͵wg#%'-,.++-*(*:fPIoP~N7e4k 0"նg˝xݩ谇毅宄㬃᫁ߩݧ~ۥ|٣{آz֠xԞwӝumҡ|aJ t7 I ASc¯OϽfѾgоfнfϽef\DCDBBDCBDDCF769Ͼμ̻˺˹ʷȵǴƲŰð®пϾϼμͺ̸˷ʶɵɳȲDzŰDZ@<<((*.-.+'*1@9GhPzTO7f5k 1"Ӷg˝x߫ﶋ겈豆簅宄㬃᪁ߨݧ~ۦ|ڤ{آz֠x՟woҠ|bK s6 I ASbOϽgҿhоgоfнfgaPMGA?DCBDEDF87:}{νͼ̻̹ʸɶȴƳűİïѿоϽμλ̸̹˷ʶʵɴȳDzįиymc%%(/-/-,-,)+?mVQwWWP8f5k!2#θhʜx봉곉鱇篆宄㬃᫁ߩݧܦ}ڤ|آzסxÓoѠ{cL m4 I ARfïM¯QñSðRðRïQ¯QOXSE?>EDDEECE>&HxOsOtOvKuAw|u4e_*[V"B?+CBFECECCEEEF;:<ξͼͻ˺ʸɶȴƲűİ®пϾϽϼͺ˸˷ʶʵƱӼxl('+0/0/.01/1,[C-Y4d8l9o:o;p?u7p';)lצ˛w˛w˛w˛w˛w˛w˛w˛w˛w˛w˜w˜w˜w˜w˜x͝xРzd |c s^:hfʞw^ۚsZjVHFIDDEEDEGDG=;?jggονͼ̺˸ɶȵƳŲݯѿоϽμλ̺̹˷ʶƳѺ534.-/0/10.0 +:#B(E+F+G+G,G+D*jN|}ον̼˺ɷȵǴƳűİ®ооϼλͺʶ̸˵\UR)*-324113,+-STU**+
]
&0$
b٦将籇籇籇籇籇籇籇籇籇籇貇㯅ɚu l dT˛wĖqעyעyޥz}e?AEGFGFDFFEGDCFDCEſϿνͼ̺˹ȷȴƳűİ®ппнλͻ˸κϺe\U)*-434314.,.ONP|{~''( \ % l dT˛wĕq֡yסzۣzpFEGFEHFEGEDGGFI>=?hdeξͼ̺˹ɷǴǴűİï¬понλ˸ѽg`Y**-435435,+-EDF(() \ % l dT˛wĖrأ{ڤ|֡yޥ{r`>?EIGIFEHFEGHGI<;>Ͼν̻˹ʸǵƴŲŰïѿϾͼ̻ëð_WT**.546546..0BAC(() \ % l dT˛wĖrڥ|ܦ}٣{٣{֠xaVQ?AFJGHFEHFEHGEI=;;Ͼν̻˹ʸȵǴŲŰïѿϾϾìëGDD,-/667657.-/=<>(() \ % l dT˛wŗsܦ}ިܦ}٣{ަ|pQLLDDGHGHFEHHEIEEGCADϾνͻ˺ʸȵƴıð®îDZǰld_214003879657.-/BAC(() \ % l dT˛wŗsިੀݨ~ܦ}أz}iBCFGFHIFIGEIHFIEDFB?AϿν̻ʹȷƴȵʷ˷̶̼vZUS757--16677795460/0RQR(() \ % l dTʛwƗtઁ⫂ߩާܦ}أzߧ|}fCCGFEHIHIFFHHFIGEH<:>vrs;̻νоѾҽƳrkePLK547-.1003768:9:989657647ffg(() \ % l dTʛwƘtᬂ㭄᫂ੀާ~ۦ}أ{|fNKJACGJHIGEHGFHIGI<;>NKOɹŸ{rl\WU@>@10400423599:;:<<9:879339.-1>=>~(() \ % l dTʛwƘt㭃殄㬃᪂ߨާ~ܦ}أ{}oaVQ?AFHGIIGIGEHIHJCBE:8;QNPſŶ}upb\[B>@53710422599;<;<=;<=;<:8;659119657_[Df^.@@=ڟ(() \ % l dTʛwƘt宅谆䮄㬃᪁ߩާܦ}أzަ|Ϝuj[DDHBCGIGIHFIHFIIHKBBD:9<@?B^Z\~ʿyugb_NHG=;>769004437;:<><>?=??>>=<<;:<87;12:76:GD;vmC@̻[@?><؟(() \ % l dTʛvǘu簆鲇簆宄㬃ઁߩި~ܦ}٣{ۤ{ަ{hbWR@BFDDGIFIGEHHGIIHJFEH@?B87;<:>CADHGIRNPmhhqnmokjwro|vtvpnlgeokihddOLMFEFA@B<;=64722677:;:=>=?@>@B@AB@@>=><;=98=44;34;98;IF=nfCHMιQïIп]@A?>ء(() \ % l dTʚvșu鲈볉鲇簅宄㬂᫁ੀި~ܦ}٣|עzޥ{Мus`UNM@BGFFIHFIHGHIGHIGIIHJGFHEDGCBD@?B<;?::=;;=98<88;99<:9=:9;::<==?>=?@?AAABDBCDBCBAB@?@==?:9?66>44=98>;:=NK@c]C}sHKO̸RкS̶RɵSI_AA?>ؠ(() \ % l dTʚvșv곉겈豇毆䮄㬂᪁ߨݨۦ}ڤ{֡yآyۣyltbNHFAAE@@H@?GCBFGEGGFHGFGGEGGFHHHGIFHHFGHFGFEGFEGFDFFDEECECBCBAC>ؠ(() \ % l eTʛvɚuﶌ볈鱇谆殄䬃⪁ߨݧ~ۥ}ڤ{ӞwƗrգ|T@.·E}Sc]JVSLCBGA@F??F??E>=E<ؠ))* Z # l eTʚvŗt䯆簈密㭅ᬃંީݨۦ~٤}ע{աzӠxӟxΛto˜yR=+SZıWd^YUW{rNf`KleOf`KumLRRR~QSWWYñZҾ\Ҿ\Ҿ[Ҿ[ѽ[ϻZYʷY˷X˷X˷W̷W˷W˸V̷U̷U˶T˶T̷UJ_AA@?ԟ,,- R n eQϟyʚwǘtșușuȘuǘuǘuǘtǘtǘtƘtƘtƗsŘsŗsÖrȚuѠ|hM7VʸYɶ]mijhhggfeedddcbbbaҾ_λ_λ_κ^ϻ]λ]λ]μ]ϻ\λ\λ[ϻ[λZͺYYͺXXWVϺWïM_CFECǟ556 ^> k dZɚuգ}Ҡ{Ҡ{Ҡ{Ҡ{Ҡ{Ҡ{Ҡ{Ҡ{Ҡ{ҡ{ҡ{ҡ{ҡ{ҡ{ҡ{գ}˜wdHuø[ȶUQɷ^dz[Ǵ[ƴZƴZdzZǴZdzYƳYƳXƲXƲWƲWűVŲVŲVűUűUűUƲTƲTŲTűSűSűRıRűQŰQİQŰPŰPŰOïOįOįNįNïMŰNE̼[HONLIIKn ,
$
e e d_d]d]d^c^c^c^c^c^c^c^c^c^c^c^c^c^c_f]e5+Ⱥ^fƴSȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVȶVǵTgQ`]ZjkmJ = u
Mʼ`ʼ`ʼ`ɻ_ɻ_ɻ_ɻ_ɻ_ɻ_ɻ`ɻ_ɻ_ɻ_ɻ_ɻ_ɻ`ɻ`ɻ_ɻ_ɻ_ɻ_ɻ`ɻ`ɻ`ɻ`ɻ_ɻ`ɻ`ɻ`ɻ`ɻ`ɻ`ɻ_ɻ`ɻ`ɻ`ɻ`ɻ`ɻ`ɻ_ʻ`ɺ_鸧JZVG+nouBvuw>{{}=||}<||}<||}<{|}<{|}<{|}<{|}<{{}<{{}<{{}<{{|<{{|<{{|<{{|qpr !!! eknmmmmmmmmmmmmmmmmeɗ~ lM
eI
bG aF `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D ^B eH |g _`M ^^azz| ? ? ? ? ? ( 0 ` $ a w l :Cq
" ' & & & & & & & Ȭ
bQ# ' &
P7
< N|s9gMH(ID&JE&ID&IE&JE%ID$JE%KF&MG% I< @? @ !*!* *$_ P ] ǵQĮ?ů@î?ư>;4124ʶHpjDLMWSRSQQTQQL'0 !+l R ¹p ¯F B9
;2`Q |^줤ii$-
) 6 vm3 i ðH$¨& $
^Sd`I,1 #
"* >N R Ĺm ¯H%%+&~cAOkDA4$ -(RN;>CPPDD22 (
}I,Hȭ(j] jU;XzO~OQ9."
GD6llSWFF>> 5= A " 7%
w
(,¯H' ,&#[UT~RWB5(
RO>𰰷ijRV<;ssGGJP N =u 5d6f6d6d6d7c3f7tMȭD~$r]D`XYzSA6)
JC zuTyyLO@@ddDDCI < F 6gS\ʒZȐZǐ]ɑM9}S˯Df[
}Ya\aL?1 1*
-|wWꄆabFIPP@@<<<<<<;;;;;;;;::>=QR7= y K 6gcoΝl˚m̛i˘M8{Q˰E[R ad`eUG6 @7zl!BEGECCXZDCJKIIIIIIHHHHGGHHCCUZ CH O 7grȜիӨzѤj̙M8{Q˯Ewj% wYkdd_(# 60j\!)β }kLBGZZBBGGHHHHHHHHFFAA]`9= (
=c 7g̥ܸׯyУh˘M:|QéE/=5/oifh_*%" '#VJr ĨcUjFJ[\JKEFDEDDEFLM^];; i ki [ :hܵըoϜP=~Q､D͵4l_'dVDtjhidB8-
MBm çqaXDDUSXUXVWVXTOK=M˶D@į?î>í<;¬9ì8«9ë72ma'ixwpoUiWBlQcSA
-(vf:[gddcahHr S| KI\^\qomlomkiZX?>MηFŮCƯBůAŮ@Į>ĭ=ì;ĭ:4^T'&$%xb}}pZ 67: #E;0A90 OD6B;<;;:?~9 kaW) GF\hf}|ljYW?>MηGůDưCƯBŮ@Į?í>Ů=8VN) A;5{ũr xy{.04TF7}^
.)n#$"! Ƭ&C ji^$ DC\po}|kiZW?>MθHůEưEƯCưBưAƯ@ǯ<|o2 MG@Ůŭ# bce urrl[H
RH %$"! ĩ'A jg\" JI\^]hg\\VUNMHG77NϹKĮF>4tg)bX!^T$''&<88ɳ¬ìūk &"!q{qty]?7 &%$" Ī(A jg\# FCn}tYyoW{rX|sXvZwoU鲣PC~q5C>&)'#744MHE<99 xïƱůìū~ywti 0+{ ('%$!ū)A jg\# μSѽQҾRҽPѽOϻNԾNDMH1 'JFHƶϼd\V?;:ɶʵDzƱůì~zvq,((&#v )('&"ū*A jg\# PijWɵWʶWʵVȴTͷSF:82&&/vȲͶĮпƮIDBxlédzȴDZůì|yu4/-" r **('$ū,A jg]$ ƵV̷WX˶VϹUNB?6**1ƳðİîпƯVPLн˸ʶȳƱĮŮȰȮ{x61/! t ++*(%Ƭ-A jh]$ ƵW̸YY˷XмVjbA!#-ǵɷȶǴƲİ˴yo˷ʶdzDzYQHXPF}y2.-'%{".-,*'ƭ/A jh]% ƵW̸Z̸[ӾZQ++1d_\̼ͼ̻˺ʸȶdzıDzë̹˸ȴк}
VOGw)'*/+",+*)%ū-A jh\$ ƵW[̹\\skG))2пξ̻˹ɷǵŲï̻ѿϼͺ˷ʶ~mĭŭq #D=!2İ;ï:î:î96ɴ=I Jd ƵW̹\м^ɶ[FC:OLOпν̻ʸȵƲŰоμ̹ʶʵкů«Ūyd 24#xEᛇP薂M엃N엃O엃O띈Qi]2 / ƵW̹]`Y//3ytqξ̻ʸȵƲįоλ̸ɵƱưĮªȭi\P !@.fʗuÑqonjĒqU@3 2 ƶX˹_cU))2ϿͼʸȵŲîϽͺ˷ɴDzůìB:8 +')Y-,/Q_ZYoe`vmIWP@- k9h7i7k7l6n:j j m eștߧ|q`W57=jgfп̻ȵİϾĬʷTNK&&)xwyvrw \ j }`Ǚt~pIHJ99<ξ̻̺ι̶íJFE''*}|}noq eѵpdppof j z^ʚvި嬀iDEH88=~~οxpPMO))288;ppr c j x[˛w宄ߩnYRP25;MKNǻ|w_[\=m=kAn,cD[OL?7a[iU=d[(JMNNKL8= HxjМjϜlԞ>|DE<p]Kfc0(%" 0ZSVTJL:9::::998888LO&*y :# )q P}ɃҪѨpϝ:vE^R LAzD/sZojxY
gY=POMJLGLHLHDV"U @b P NO I@idSJy-gFָ7wj& fplb5.*
cV1Tw`~YxQZ&@>B@;9G饝@AACE6Ҹ8^T"(%(qousNB7yh0x~i]"8I{ "$JVTa_b`a_HGNӹC˲B˲?ʱ=ë9ȯ93<7 %#%rwkXCOB3iYE# "2, /}||y&/+ ,a_|{{yhfEDL˴DCí@>ɱ=7+) >9:{ĨXMAkmq++,o\Grdæ% ,D> rp١jhHGM̵FɳF͵EηD=2/ OHGȯA;6qrsiWCv1+)E<"$"2D@% 9dcwwbbSR;;PӻI=v,xk%E?"MHH̵ĭǭ{f,+-bTE|u_QD)%"'$ 2D?# jYXXXKj`.;7,\UOwmd314vտîĮīyzy~jV !¨(& 3D?# ̺SӾTӾSQŰKFA-NJOɲεXRMdz˶ƱĮɯ}}w_ !é*("4D?# ijWʶYʷX̸VMH4\W\ѻιðο̵dzƱŮzzc $ê-*%6C?# ƵVʷY\F>=EͺоɸʷǴűϾѾɶι'&'v©§ta$"&ǭ.+§%7E@# ŴW̹\Կ^MH7ον˺ȶƲоͻƯȬrdV+(8><;BOI%p y ijWѾ_Y?==ȾϿͻɷdz®о˷ͷíǭWME+"ckfhuX Y @2# òWbTFEJͼɷŲϽ̸dzŰĭ421&N8ǘrޥ|КsϘp` \ F5) òWdSHGN̻ȵįѿκʶŰͶ|k 2-7{TƕqҞwӝua
[ E5( òWfY@?GϾʸƲϼ˸Dz˶N@?:qXChʕsݧ~ަ|c_ B3' ôXwμ]蟒R98=̻ǵîоȶp *'?n8]ǔrޫԢ{աzj 7 \F6o oKnC>>ͽǵ®Ͼǭ402]dbv^id@.!bե#e*k*o#ߢv ǘt oUߧ}q`48?кŮ977rrt| C Ɨu oT٥}wcW;>DȽunnPLN873}} I lTDon ǘt oTૃ鱆䫀}eGA@HGNa`gmkrmkpb`eTRTJGDNJ;f_=FM L ǘt qQգ}إ~Ӡzڣ}dާSRLLNRVκYYVR𧧯 1 n o i&g$i%|n ĩ_3[___^[˺XĴVUóTZlLSQVA ?( 5W5 lh5[S*Uh^%Tf]&X>8 A I Į %2 A ıHX,WM I?{Qz{
% 6 - 49uf u[E\D+ddWqqWXoSlƐ7]MuLdPfP/h>3 FXZ__*.Y/j x̧pڴl_hR'izeL82e^75>=8A =<@2001w~czcM.NF1vhR;2#scF ][}omXVF=ٻ@}*]RAj|pA:8UL ^hzR onv}|TSM6}q*h^R̲qnmliNC)ɧ# dQ]Tof?tzqϹzåXL:!ȭ,- ŴTPXwD̶nƫ^R? ʲ*- aPRzrξ˺dzѿıéPI;HSs? fQQͻűμк6O?ʞ{՛yaM hFNǵçlhZ5yUҦ|ܦ|pT joe_vlno}P=0?i ᫃ĕr{ogttNp) 102 ̝xa⫃dEŕIʞHɱLʵIʷò |gW pgmodeler-0.9.4/apps/pgmodeler-ch/res/windows_ico.qrc 0000664 0000000 0000000 00000000102 14160100006 0022614 0 ustar 00root root 0000000 0000000 IDI_ICON1 ICON DISCARDABLE "windows_ico.ico" pgmodeler-0.9.4/apps/pgmodeler-ch/src/ 0000775 0000000 0000000 00000000000 14160100006 0017566 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-ch/src/crashhandlerform.cpp 0000664 0000000 0000000 00000015025 14160100006 0023617 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "crashhandlerform.h"
#include "messagebox.h"
#include "guiutilsns.h"
#include "utilsns.h"
const QString CrashHandlerForm::AnalysisMode("-analysis-mode");
CrashHandlerForm::CrashHandlerForm(bool analysis_mode, QWidget *parent, Qt::WindowFlags f) : BugReportForm(parent, f)
{
QFile input;
QString buf;
QWidget *wgt=new QWidget;
QHBoxLayout *layout=new QHBoxLayout;
setWindowTitle(tr("pgModeler crash handler"));
stack_txt=new QPlainTextEdit(this);
stack_txt->setReadOnly(true);
stack_txt->setFont(QFont("Source Code Pro"));
stack_txt->setLineWrapMode(QPlainTextEdit::NoWrap);
layout->addWidget(stack_txt);
layout->setContentsMargins(4,4,4,4);
wgt->setLayout(layout);
logo_lbl->setPixmap(QPixmap(QString(":/images/images/crashhandler.png")));
report_twg->addTab(wgt, tr("Stack trace"));
//Open for reading the stack trace file generated on the last crash
input.setFileName(GlobalAttributes::getTemporaryFilePath(GlobalAttributes::StacktraceFile));
input.open(QFile::ReadOnly);
if(input.isOpen())
{
buf=input.readAll();
input.close();
//Removes the stack trace file
QDir stack_file;
stack_file.remove(GlobalAttributes::getTemporaryFilePath(GlobalAttributes::StacktraceFile));
//Shows the stacktrace loaded on the widget
stack_txt->setPlainText(buf);
}
//Creating an input field in order to select the input report file
input_wgt=new QWidget(this);
input_wgt->setSizePolicy(QSizePolicy::Expanding, QSizePolicy::Preferred);
layout=new QHBoxLayout(input_wgt);
layout->setContentsMargins(0, 0, 0, 0);
input_lbl=new QLabel(input_wgt);
input_lbl->setText(tr("Input:"));
layout->addWidget(input_lbl);
input_sel = new FileSelectorWidget(this);
input_sel->setFileDialogTitle(tr("Select bug report file"));
input_sel->setFileMode(QFileDialog::ExistingFile);
input_sel->setAcceptMode(QFileDialog::AcceptOpen);
input_sel->setNameFilters({ tr("pgModeler bug report (*.bug)"), tr("All files (*.*)") });
input_sel->setToolTip(tr("Load report file for analysis"));
layout->addWidget(input_sel);
save_tb=new QToolButton(input_wgt);
save_tb->setIcon(QPixmap(GuiUtilsNs::getIconPath("save")));
save_tb->setSizePolicy(attach_tb->sizePolicy());
save_tb->setToolButtonStyle(attach_tb->toolButtonStyle());
save_tb->setIconSize(attach_tb->iconSize());
save_tb->setToolTip(tr("Save the attached model file on the filesystem"));
save_tb->setEnabled(false);
attach_wgt->layout()->addWidget(save_tb);
report_tab_grid->removeWidget(details_gb);
report_tab_grid->removeWidget(output_wgt);
report_tab_grid->removeWidget(message_frm);
report_tab_grid->addWidget(input_wgt);
report_tab_grid->addWidget(details_gb);
report_tab_grid->addWidget(output_wgt);
report_tab_grid->addWidget(message_frm);
setAnalysisMode(analysis_mode);
connect(input_sel, SIGNAL(s_fileSelected(QString)), this, SLOT(loadReport(QString)));
connect(input_sel, SIGNAL(s_selectorCleared()), model_txt, SLOT(clear()));
connect(input_sel, SIGNAL(s_selectorCleared()), details_txt, SLOT(clear()));
connect(input_sel, SIGNAL(s_selectorCleared()), stack_txt, SLOT(clear()));
connect(save_tb, SIGNAL(clicked()), this, SLOT(saveModel()));
connect(model_txt, &QPlainTextEdit::textChanged, [&](){
save_tb->setEnabled(!model_txt->toPlainText().isEmpty());
});
}
void CrashHandlerForm::loadReport(QString filename)
{
QFile input;
QFileInfo fi;
char *buf=nullptr;
Messagebox msgbox;
fi.setFile(filename);
input.setFileName(filename);
input.open(QFile::ReadOnly);
//Raises an error if the file could not be opened
if(!input.isOpen())
msgbox.show(Exception::getErrorMessage(ErrorCode::FileDirectoryNotAccessed).arg(filename), Messagebox::ErrorIcon);
else
{
QByteArray uncomp_buf;
QString buf_aux, str_aux;
int i, idx;
QPlainTextEdit *txt_widgets[]={ details_txt, model_txt , stack_txt};
//Creates a text buffer
buf=new char[fi.size()];
//Reads the file storing it on the buffer
input.read(buf, fi.size());
input.close();
//Uncompress the buffer
uncomp_buf.append(buf, fi.size());
uncomp_buf=qUncompress(uncomp_buf);
delete[](buf);
buf=nullptr;
buf_aux=QString(uncomp_buf.data());
i=idx=0;
//Showing the sections of the uncompressed buffer on the respective widgets
while(i < buf_aux.size() && idx <= 2)
{
if(buf_aux.at(i).toLatin1()!=CharDelimiter)
str_aux.append(buf_aux.at(i));
else
{
txt_widgets[idx++]->setPlainText(str_aux);
str_aux.clear();
}
i++;
}
}
}
void CrashHandlerForm::saveModel()
{
QFileDialog file_dlg;
try
{
file_dlg.setDefaultSuffix(QString("dbm"));
file_dlg.setWindowTitle(tr("Save model"));
file_dlg.setNameFilter(tr("Database model (*.dbm);;All files (*.*)"));
file_dlg.setFileMode(QFileDialog::AnyFile);
file_dlg.setAcceptMode(QFileDialog::AcceptSave);
file_dlg.setModal(true);
if(file_dlg.exec()==QFileDialog::Accepted)
UtilsNs::saveFile(file_dlg.selectedFiles().at(0), model_txt->toPlainText().toUtf8());
}
catch(Exception &e)
{
Messagebox msgbox;
msgbox.show(e);
}
}
void CrashHandlerForm::setAnalysisMode(bool value)
{
output_wgt->setEnabled(!value);
attach_tb->setEnabled(!value);
attach_mod_chk->setEnabled(!value);
save_tb->setVisible(value);
create_btn->setVisible(!value);
input_wgt->setVisible(value);
if(value)
{
title_lbl->setText(tr("pgModeler crash handler"));
msg_lbl->setText(tr("Bug report analysis mode activated."));
}
else
{
title_lbl->setText(tr("Oops! pgModeler just crashed!"));
msg_lbl->setText(tr("We apologize for what happened! It is clear that a nasty bug caused that. Please fill out the form below describing your actions before pgModeler quit unexpectedly. This will help on bug extermination and improve the software."));
}
}
QByteArray CrashHandlerForm::generateReportBuffer()
{
QByteArray buf=BugReportForm::generateReportBuffer();
buf.append(stack_txt->toPlainText().toUtf8());
buf.append(CharDelimiter);
return buf;
}
pgmodeler-0.9.4/apps/pgmodeler-ch/src/crashhandlerform.h 0000664 0000000 0000000 00000003474 14160100006 0023271 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
/**
\ingroup pgmodeler-ch
\class CrashHandlerForm
\brief Implements the pgModeler's crash handler enabling the generation an analysis of crash report files.
*/
#ifndef CRASH_HANDLER_H
#define CRASH_HANDLER_H
#include
#include "tools/bugreportform.h"
class CrashHandlerForm: public BugReportForm {
private:
Q_OBJECT
//! \brief Display the stacktrace
QPlainTextEdit *stack_txt;
//! \brief Container for widget that handles input report file
QWidget *input_wgt;
QLabel *input_lbl;
FileSelectorWidget *input_sel;
//! \brief Triggers the model saving to filesystem
QToolButton *save_tb;
void setAnalysisMode(bool value);
//! \brief Generates a report buffer containing the issue details, model and stacktrace
QByteArray generateReportBuffer();
public:
//! \brief Analysis mode argument
static const QString AnalysisMode;
CrashHandlerForm(bool analysis_mode=false, QWidget * parent = nullptr, Qt::WindowFlags f = Qt::Widget);
private slots:
//! \brief Load a report file showing its contents on the form
void loadReport(QString filename);
void saveModel();
};
#endif
pgmodeler-0.9.4/apps/pgmodeler-ch/src/main.cpp 0000664 0000000 0000000 00000003032 14160100006 0021214 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "crashhandlerform.h"
#include "application.h"
#include
#include "guiutilsns.h"
int main(int argc, char **argv)
{
try
{
Application::setAttribute(Qt::AA_UseHighDpiPixmaps);
Application::setAttribute(Qt::AA_EnableHighDpiScaling);
Application app(argc,argv);
QStringList args = app.arguments();
QTranslator translator;
//Loads the ui translation for crashhandler
translator.load(QLocale::system().name(), GlobalAttributes::getLanguagesDir());
app.installTranslator(&translator);
CrashHandlerForm crashhandler(args.size() > 1 && args[1]==CrashHandlerForm::AnalysisMode);
GuiUtilsNs::resizeDialog(&crashhandler);
crashhandler.show();
app.exec();
return 0;
}
catch(Exception &e)
{
QTextStream out(stdout);
out << e.getExceptionsText();
return enum_cast(e.getErrorCode());
}
}
pgmodeler-0.9.4/apps/pgmodeler-cli/ 0000775 0000000 0000000 00000000000 14160100006 0017154 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-cli/pgmodeler-cli.pro 0000664 0000000 0000000 00000001456 14160100006 0022427 0 ustar 00root root 0000000 0000000 include(../../pgmodeler.pri)
CONFIG += console
TEMPLATE = app
TARGET = pgmodeler-cli
windows:RC_FILE = res/windows_ico.qrc
windows: RCC_DIR = src/
windows: DESTDIR = $$PWD
SOURCES += src/main.cpp \
src/pgmodelercliapp.cpp
HEADERS += src/pgmodelercliapp.h
unix|windows: LIBS += $$LIBGUI_LIB \
$$LIBCANVAS_LIB \
$$LIBCONNECTOR_LIB \
$$LIBCORE_LIB \
$$LIBPARSERS_LIB \
$$LIBUTILS_LIB
INCLUDEPATH += $$LIBGUI_INC \
$$LIBCANVAS_INC \
$$LIBCONNECTOR_INC \
$$LIBCORE_INC \
$$LIBPARSERS_INC \
$$LIBUTILS_INC
DEPENDPATH += $$LIBGUI_ROOT \
$$LIBCANVAS_ROOT \
$$LIBCONNECTOR_ROOT \
$$LIBCORE_ROOT \
$$LIBPARSERS_ROOT \
$$LIBUTILS_ROOT
# Deployment settings
target.path = $$BINDIR
INSTALLS = target
pgmodeler-0.9.4/apps/pgmodeler-cli/res/ 0000775 0000000 0000000 00000000000 14160100006 0017745 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-cli/res/windows_ico.ico 0000664 0000000 0000000 00000442472 14160100006 0023002 0 ustar 00root root 0000000 0000000 F @@ (B ( S >[ ( @
-) 2-
/ K K
K K K
K FRUTScgef_cag]a_gZ_]gY][fW[YfTYWfTYWfPUS]7;9" U S0?Ș4ᘉ41zn,{o+1{N܀~}|z~z~x{~w|zgmj ȸX ƵVD5% VK1+>6
rcd{~AGD@FCAHEGOJIPLGPKBMH@FC^cauzxJQM ǷX ƵVD5"C;;0#YE/)!" {x\uxw!% .#]vcpvXr_.#% BIFy~|JRM " " ?]6m`4+"tM~PnF( ggZ}!7,Qo\4RB'F7)H:'E7!>1 9-EOK|~KSN /Z .X8(pK%gE%gE"eEVuBΰ5:3t]DYUz`A("~g4MBPt`%J:'L=(M>$H9KVRIQL gV3_M/\J*VDQ_YBIE
@r ;kceuСqΞY^\370%_d|Y/(!71lZwkvljg_ySoBr_YjcAHD Dt >mc{ʢٲzѤY][8@9 r_KjgnR)# fg`Xpgmj}g{ezcxbwX{mfuoKSO
9fkɦpʞR[\3i]&93,dokj|qsqnsNY^q ZW PNOMOMONKIqisFDCBA«:Ĭ6/1- YMAtpgxXE:.&"yhOvsf] 0<[ yw VTÓfdjhgeSQskvŰDƯAŮ?Ů>ĭ<ĭ:3WN$40+r]wyhSRJCMHCF=3-(#D;9chgg`$%h ^\Ɠ~qoSRskvƱFưDưBƯ@Ư>8SL'C=8qiYWU{|}[O@n\H'#p$" 1-)n dcɓonRQskwDzGDZFíB>:bY-HC>~ªq^[YXNDic.)"dW##! 2-)n `^~sqlib_WT~unF;wk0cZ-QI)?;6DZìq_\RGnvoE<3MD#%#!3-)n [ `CXﵥUUTKof7MH;qi`}~rXRMɴưíyuXL?A:#'%#4,)n ǷY ĴVBʷVVTMbZ9YTQ®îym˷ȴưí«}yaTG=6%)'%5,)n ǷY ²VBʷX̸XʵUxnAXTRµ˸Ǵűïνz°̸ɴDZ{h|aTH@:',)(6,)n ǷY ²VBʷYκ[QMJBͼ̺ɷǴű±λ˷ʵ~rdaXNZOEKC ,/-+8/,h ǷY ²VB˸[ϻ]yIgcaν˹ȵıоͺ˷«IB;LG'ACCC@.+J ǷY ²VB˹\˸]e_EϾ̺ȶűϽ̹ʵDZìy351JQ ôZ L7Eul6of2of3of3of3nf2md1ja0g_/g_/jb0md1of2g_-;;.Ń픘{||v|yekh9=;> l Ǹ[tƴO?î@í??><9411471!@3!@3"@3"A3"A4"A4"A4"B4!A3& mpokqn PWS 9& H0H0&
&m xr9įD)]Q :1)}VWUT~SRyOD7)
=:#V[Y 1)5VG|LrZ&J:%H9%H:%I:&I:&I:&I;&J;%H:)#psrntp PWS 'pJ !^>3c4c2`2_2_2_2_2_2_,ZqFůD(0,p\E\ZXWVmKC7)qi7X^\(;3EfYFjY]lè/XD(O?)P@)P@)Q@)QA)QA*QA)P@-%tvuqws OWS (rL "bA5fCvMMMMMMJ~4gqIǰD&$! xW^\[[rP*$
UKJ[a^/C;SvgctAhW3\L-XF,XF-XF-XG-XG-YG,WF 0(wyxsyv BIF (rL #bB5eO`ɓ`Ȓ`Ȓ`Ȓ`Ȓ_ȒT4gqIDZE{l$;3+`a`^^r]F?7}lJ\c`6KCaul~X~nV{lV|mQxiEo^8eS1`M0_L1`M1aM0_L 4+y|{tzv 497 (rL #cB5eXn͜m̛m̛m̛l̛eɕT4gqIȲEyj$A8.cdba`lO81`S{:\c`=SKlmg}f}e|d{czay`x[sP|jCr`:lY6iU3gR 8-{|w}z 153 (rL #bB5e`|Ҧ{ѥ{ѥzѤrΟeɖT4gqIȱF{(0*&agedc`TF670ZP]caEZRxvtsrpomlkjga{YuN~k(C7|} 485 (rL #bB4eiװ֮֯ӨrΟeɖT4gqIưF-1, q_Kkhgfd_H=2,(]dbLbY}|zyxvutso9RH 7<9 (rL #cB4erݺ۷زөrΟeɖT4gqIŰF1j^%.)&|_ljhgf`NB5_gd?QJb}r`|q`{p_{p^zo]yn\ymZxmZwlYwkXvjWvjVuiUuhRrf2G? ;?= (rL #bB4e{ğٳөsϠeʖT4grIŰFª2/61 C;3hmkjhgbcSA OWTNWSNWSNWTNXTOXUOYUPYVPZVQZWQ[XR\XR\YS]YS]YT^ZZd` 6:8
3c{۽ֳѪy̢mș`ÑQ4gtKŰG3ë3y*! TI=lnlkihfxdK~~ytzwo
N d e e e e e eg*U@pFsCq@o>n DC65y10n00m00m00m00m00m10o'&U[i:|NvJuJuJvJvJvKvKtINŰH5ª5ª42\R% udPrpnmkigaTK@"##"#"A< h]!~(,Hu}_txnd_e + QO ON!,(&ftqomkih`D:1D;o_ĭ=ĭ<ì;ì:ë9ë9ë8«7ª63,LE! rbPwtrqokcc}]6/(" THn:muUn{yvspnklh ~ ' RQ ONĭ=ĭ<ĭ;Ĭ:ì9«85-PH" 2.+fyvu~cdUEB91-(#.)#J?3cSB" 4.gY7Lvv}|}}}}}h{j
3 RQ NMĭ=ĭ<Ĭ;ì:7.E?# NF>n}{xveS(%# 778GGH??@G=3ZM= PFv'CCCCCBBBAîEJ 7 RQ NLĭ=ĭ<90?:$ %$$j^Q}g&#"BBC^PA`,($71qa ##"! %I 7 RQ MK<\Zxvjh]ZNKFDIDzJDZFǰEưDưCƯBƯAů@Ů?Ů>«<4C>' ",*)~o`zjX &&'92,dl_PA%"`S "#"! %I 7 RQ LK<^]xvjh]ZNKFDIdzKDZGDZFDZEǰDưCůBŮAĮ?ì>8OH*!!#.,+wfvb ((*5/)~bpmvZ PEw#$#"! &I 7 RQ KJ<:8bY-%$%,++xiììy72/<<>99:.*'~dtqoi:3-@8|l"%$#"! 'I 7 RP ML<\[}|{zsrkjca[YSQKIIH螑LdzLƱHEA:3x.|n*yk(aW)+)('&(vk_įůĭìªub*'' '%$s^yuspoZM?2-rc"%%$#"! (I 7 GF FE*YWZWTQSPSPSPSPSPTQKHy䠓KİKC:~q1`W+JD(<7%52&41$-+&&%(_WPȳƱůĮì«loaRzd|zxusrtbN(%hZ"&&%$#"!)I 7 b d TfWRQQQQQQPSA~q5NH/42,-,-@==b[VwneukcJEC(')pf]ȴɴDzƱŰĮí«|zwusu\ #!bU!''&%$#"*I 7
t ôXpǵUɵSɵSɵRɵQɴQȴPȳO®K@_W453/-,/MHGvμѿѾ_XR0//{̸ɴȳDzưůí¬~|yvu{_" ZO!(('&%$#+I 7 u ³WpȵU̸W̸V̷U˷T˶SʶRƲOCRL5/.1978|tl³ĮѿоѾQLHRLHñ˷ʵȳDzưůĭ«~{xwd&$$ VK!))(''%$,J 7 u ³WpȵV̸W̸W̷V˷U˷TɵRHQL7//2B?@ıƲİï®ѿA=<κ˷ʵɴDzưůí«}zxj,)( VK"**)((&%,J 7 u ³WpȵV̸X̸X̸W̷V˷UOc[=114?=>ʷȵǴƳŲıį®ѿ~tksiaλ̹˷ʶɴDzƱůĭ«|zi*'' YN$++**)(&-J 7 u ³WpȵW̸Y̹Y̸X̸WʵU}F877989̺˹ʸɷɶȵdzƲıï¬ld\±λ̹˷ʵɴDzư|o`D?:pdV~|f&$$! ]R&,,,**('.J 7 u ³WpȶW̹[ZYXQOK<326oieɹνͼ̻̺˹ʸɶȵdzŲİîѾͻ̹˷ʵȳɳ1/. "MF@~f&$$$" dX (..-++*(/J 7 u ³WpȶX\ͺ[Z̹YI879DBBϿϾνͼ̻˹ʸɶǴƲűįôѿϼͺ̹˷ɵɴLFAKE@~ªs_"!#*( pb *..-++*(/J
2 u ³WpȶXͺ]ͺ\κ[ıW^XB548pkhϿξͼ̺˹ɷȵƳűîϿоϼͺ̸ʷɵɳŮªrdT !3/"r->îCïCïBîBîBîA®AİDQ
r u ³WpȶXͺ^κ]ϻ\TEC>;9<Ͽνͼ˺ʸȶdzűïѿоμͺ̸ʶɴȳDZĮìYOE "(( XQ*w@yA߅v@v@v@v@w@w@wAla1b u ³WpɶYλ_λ^ϼ]O;:urpϾͼ˹ɶdzűîоϼͺ˸ʵȳƱůíĬs0..(,+0iL,WxYԠzੀܦ~٣zՠxѝuΙrʕoŕpaJ9 f u ³Wpɷ[Ͻdнdƴ`^YH<;?sonξ̻ʸȵƲİѿϽλ̹ʶɴDzưĮe\Q'&(.B8=@c`aϿͼ˺ɷǴű®оμ˷ɵȳưư|965*,,;mTGu2ayZף}簆䭃ܦ}٣{ՠxќuȗsaJ9 f
t ³Wpɷ[нfоfɷcb]K?>BURTξ̻ʸȵƲïпϼͺ̸ʶȳDZíi_V*(+4H>MsN3czZ٥~촊豇䮄᪁ݧ~٣{ՠxʙtbK9 c m ĴXoɸZʸ\ʸ[ȷZskKA@DHFHϿͼ˹ɶdzİϽλ̹ʶɴɴx644-0/AuZSL~3d~]ף}氇㭄ૂݨڥ}ע{ӟxətqWB H
`V" ƸZ P3ƶYvĴXxUGbX@CBEBACξ̺ʷǴűîоμ˷ʶRLH,+-%=1)sM0[0\*V|qTĕrșuəușuȘtǘtǘtǗtǘtޚvZo v\ x^
pnv_IFGCADdabϿͻʸȵƲïпϼͺ̸űnd\/.0889LQPW`^Zea[fbT^[$# 9* QsW hghhhhgx[ }_ |^ŗsϜvĕq]SODCFFEGпͼ˹ɶƳİѿϽλɵ~sh424768lkn''' > }_ {^ŗsӠxآzs`FEHDCF[YZν˺ɷǴİñ{qh757657lkm&&' ? }_ {^ŗs֢zܦ}̛vn^UDDGDCEmkkξ̺ʸɵdzĴ^XT435::;srt&&' ? }_ {]ŗs٥}ߩݦ}rgZSEEHDCFb`aͻ±umgSOM:9;325EDF&&' ? }_ {]ŗsܧ㬃ߨݦ}ÕsucXGFIDCFLJM{yyözt_[XGEE:9;548879NJ87<98;?=C?>B>=A=<@<>?k d cm0o=n=n=n=n=n=n=n=i7±Yɹ[ȸZȸZȸZȸYȸYȸYȸYȸYȸYȷYȷYȷYȷYȷYȷYȷXȷXȷXȷXɹZ߸Vj|zzzzzzzr^^` ɾe GO P P P P P P P P P P P P P P P P P P P P G ! (
' : D H I I I I I I I I I I I I I I I I I I I I I I I I H E > 4.5<@BDCCCCCCCCCCDDDDBAAAAAAAAAAAAAAA>8
- !
" H j } qm:?;m. ͷJ 72YN(" 5e
MSP݄~u{x]d`GMJ* J 3
Oõ[ڻWT첥RRRRRRRRRRQPPNMLLLLMOPPQRRID? DKI昜~~~~}}}}|||||{{{{~z~z~z~z~w~rw~z~w}{x~|~agdELH ̷I )ɺ^bȶUɷUɷUɷUɷUɷUɷUɷUɷUɷUɷUǶTƴS°RPMKJIIIKMO±RŴSǵTν\Ϳd_]9w}|qwurxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrwvrrӣcqutsxvu{yv|zrxvsywsyw{z}T[W:?;' ̷I )Ⱥ]ȶU0))(((''&&%$" yr~m{k{j~mry #Fɻ`poNrxvsywsywsywsywsywsywsywsywrywrywrywrywrywrywrywrywrywrywrywrywrywrywrywrywrywqwuھhlqojpnpvtqwuz}z~rxvsywsywu{y_fbIPL>]e` ̷I )Ⱥ]ȷU,$##""!! z~lp`gXcTaS
bT
cUhYp`|jvCƸ^xwWsywtzxw|z{~||}}}}~~~~z}swvuywy}|}u{ysywtzxdkgKRNJOVR RXU ̷I )Ⱥ]ȷU-$$$##"! q`SA80* -' ,' /);3 J? UI ZM bT
n^l|>[yxYx~|}orqlpnmponqporqpsrqtsrutsvutwvtwvuxvuxvuxvuxvuxvuxvuxvuxvuxvuxvuxvuxvuxvuwvuwvuwvuwvtwusvutwutwvtwvw|ztzxekhKRNKOVR OWT ̷I )Ⱥ]ȷU-%%$$#"! l^/)
+% D:
SG ZM fW
vf7TxwY}FGF
uuusywekhKRNKOVR OWT ̷I )Ⱥ]ȷU-%%$$$"! OE
3,
LA VJ aT|o.JuuZ%'&
eeetzxfliJRMKOVR OWT ̷I )Ⱥ]ȷU.&&%%$#! I@
! J?
UIi^'}@rsY$&% % % % % % % % % % + &D-,J3,J2,J3,K3,K3,K3,K3,K3,K3,K3">)( & ' ' ' ' ' ' deetzxfmjJQMKOVR OWT ̷I )Ⱥ]ȷV.'&&%$" KB
E7&dN4M@5(!
I?
]S"um7noY#&% "*!*!*!*!*!*!*!*!*!3$lpѶLnS-","-"-#-#-#-#-#
dfetzxgmjJQMKOVR OWT ̷I )Ⱥ]ȷV/''&%$!_S
mXAxKzLxLsJz_@E7%
(#
VM ib1lnY#'% % -#-#-#-#-#-#-#-$-#5&v{QrX0$/%/%/%/%/%/%0% dfetzxhnkJQMKOVR OWT ˶I )Ⱥ]ȷV/('&%$o
lW@{NzMzLyLyKyKwIb?<1%
G@ b[.kmZ"(%
( 2'1'2'2'2'2'2(3(2' 8*6[AFlQEkPEkPEkPEkPEkPEkPEkPFlQDiO)F5 4) 4) 4) 4) 4) 5) 5* 5*# efftzxhokIQLKOVQ OWT (Ⱥ]ȷV/(('&!3.]K7|P|O{O{NzMzLyLyLyKrHRA.
/+^W,lm["(% +" 5) 4) 6*4) 4* 5* 5* 5* 5* 6*5)4(4(4(4(5(5)5)5)5)5)6* 6+ 7+ 7+ 7+ 7+ 7+ 7+ 7+%
efftzxiolIQLKOVQ OWT wf ȹ]ȷV/)('%eXG9+yP~Q}P|P|O{N{N{MzMyLyLuJE9.
ZT+mo]")&
/% :. ;./W;+M8 ;- 9- 9. :. :. :. :. :. :. :. :/ ;/ ;/ ;/ ;/ ;/ ;/ ;/ ;/ 1 >1 >1 >1 >1 >1 >2 >2 >2 >2 ?2!?2!?2!?2!?2!?2!?2!?2!@2!@2*" egftzyjqmIPLKOVQ OWT # 7 D I J J J J J J J J J J J J J I QYɷV0))'`T hVCWUTS~S~R~Q}Q}P|P{O{N{MvN-%
OJ(tub"+' 6+#B5!A3hqȬfp9bH"H5!B4"A4"B4"B5"B5"B5#B5#B5#C5#C5#C5#C5#C5#C6#C6#C6#D6#D6#D6#D6$E6.$ egfx}|kqnIPLKNUQ OWT > c z VɸV1*)%2,80*|WWVUUTT~S~R~Q}Q}P|P}OoM#
WQ,y{e%.*(A70OB,M>isԻq{:gJ(N:#F6$F7$F8$F8$F8$F8$F8$F8$G8$G8%G8%G8%G9%G9%G9%G9%H9%H9%H90&
egf|mspHPKKNUQ OWT L37%9 d SʸV1**~n!s_K[YXWVVUUTS~S~QR{QO@1
qi7i'0, 2K@=\O;[MIqXjuзGsV(N<&J;&J;'J;'J<'K<'K<'K<'K<'K<'K<'K<'K<'L<'L='L='L='L=2) fgfntqGOKKNUQ OWT A| .Wn4c4c2a2_1_1_1_1_1_1_1_1_1_1_1_1_1_1_/["I-ٲQʸV1*)A:1+&|YZZYXXXWVUTTTmJG;/
84 Em'1- 6QFCcUAaTAaS>aQ@eRKs\]j{Ǫ+U@'M>'N>(N>(N>(N>(N?(N?(O?(O?(O?(O?(O?(O?(O?(O@(O@(O@5* fggpvsGNJKNUQ OWT ?w /[|9o7i7h7i7i7i7i7i7i7i7i7i7i7i7i7i7h7j8m%R3߱QʸV2+(3.aRC^\[[ZYYXXWV~ZaO3
YN=Yu*40% A\RPrdOqbdrѺUf>eS1YI,VD+UD,VE,VE,VE,VE,VE,VE,VE,VE,VE,WE,WF,WF,WF,WF :/
fhgryuFMILS[V 6<: ?w /[{8l=lUČVċUċUċUċUċUċUċVċUËUċVċUċVČP8h7k$R3߱QʸV2,pc".)$]`_^]]\\[Z[nYBSH Bõ]w+51'"FbWVykTwh̳|ZlMtbMqbLqbHn_=fU1\K-YG-YG-YG-YG.ZG.ZG.YG.YH.ZH.ZH.ZH.ZH.ZH.[H =1 fhgsyvDKGOmwq cmj ?w /[{7l?m\Ɛ\Ɛ\Ɛ\Ɛ\Ɛ\Ɛ\Ɛ\Ə\Ɛ\Ɛ\Ə\Ə\ƐYŎQ8h7k$R3߱QʸV2,D= I?7baa``_^]]\\LB: PExh~ Aµ\y,62 )%Li]^r[o̲y]qV}lUzkUzkTzjSyjSxiRxiKsc>iW4aN0^K0^K0^L0_L0_L0_L0_L0_L0_L1_L1_L1`M @3 fhgtzwBIER ?w /[{7lAocȕcȔcȔcɔcȔcȔcȔbȔcȔcɕcȔcȔaǓZŎQ8h7k$R3߱QʸV3-:4]N=cbbaa`_^^]\B:5A8ZMj\q/:6#0+Zwkomlkkjiih~g}f}f}e|d{c{czbyayax`x_w\uR~mGuc?o\7jV4hS4hS4hT4hT#F9 bid{}BIEW ?w /[{7kHtxУwТxТxТwТwУwУwТwУuϡo͝hʘaǓZŎQ8h7k$R3߱QʸW5/WM!H?8hggfeddcbaa`UH9 B:RGYNfYt0;7%2-`swutssrrqpponnmlkjjihhggeb|\wTqI|hAxc=u_(L>
aic~ELHW ?w /[{7kJuӨ~ӧ~Ҩ~Ө~ӧӧ~Ө~Ө|ѦvСo͝hʘaȓZŎQ8h7k$R3߱QʸW5©0zk&)%"}^ihgffeedcbb~Z?5+5/NCWKq1=8'4/du{yxwwvutssrrqpoonnmlkjjihhhfb|]x;YM$ akfGNJW ?w /[{6kLwխլլլլլլԪ}ҦvϢo͝hʘbȓZŎQ8h7k$R3߱QʸW5ë1* fVGjiihggfeedcc}_5.+%"J@q2>9)61j}~}}||{zyyxwvvuttsrrqppoonHfZ*$bmiIPMW ?w /[{6kOxױױױױװױׯԫ|ѦvϢo͝hʘaǓZŎQ8h7k$R3߱QʸW51/KD +'%|_ljiihhgfedddx\2,( vzq4@;+73m~}}|{zzyxwwvuutsrrqpJg[ ,&cmiKSPW ?w /[{6kQzڶڶڶڶڶٴװԫ}Ҧvϡo͝hʘaǓZŏQ8h7k$R3߱QʸW62ê1{) OD9ilkjihhgffeddy]4.)msr5B=-95o~}}||{zyyxwwvuutMj_ .(bliNVRW ?w /[{6kS{ݻݻݺݺܹڴװԫ}ҦvϢo͝hʘaȓZŏQ8h7k$R3߱QʸW622/D= m]Mnmlkjiihgfede~_H=4nsr7D?+62=MGDVOCUNBUNBUNBUNBUMAUMATMATMATM@TL@TL@TL@SL?SK?SK>SK>SK>RJ=RJ=RJ=RJ=RJv /[{6kU}߿߿ܹٴװԫ}ҦvϢo͝hʘaǓZŎQ8h7k$R3߱QʸW6©22ª2z*#!" nXomllkjihhgfee^\N@msqEPK/<7.:6.:5.:5-95-95-95-95-95-95,94,94,94,94+94+83+83+83+83+83*83*83*83*83*73*72)72)72)72)71)71)71)72/@9oxuT[WV /Z|6kX~ܺڵװԫ|ҦvТo͝hʘaǓZŎQ8h7k%R3ݲQʸW7ª3322^T$61.~aommmlkjihhgeeht`K# fkix{zbhfageaheageageageahebhfcigdjhdkielifmjfmjgmkgnlhomipmjqnkrolspltqmtrnusovsowtpwtpxuqyvrzwszxt|yt|y~T[XJ .Y6jZ߿ݺڵװԫ}ҧwТo͝h˘aȓ[ŏQ8h7k&T5سRʸW8ª332ª3/:5 >70jqnnllkjihhgfeeoV0*$EIIz~IPM0
+|R6kX~ܿٺղҭЩ}ΤvˠqɛjǗdē]WN8g7k'X7ϵSʸV84433ë3+)& KB;kqonmmlkjiihfefy[TLDahe 2 A G I I I I I I I I I I I I I H F%kG8m>jRzPyNwLvKuItGsFrDqCoAn?m=l ! cI2 )X
1 1`:1a;/^9-Z7-Y6-X6-X6-X6-X6-X6-X6-X6-X6-X6-X6-X6-X6-X6+V4+< ҳRʸW9ª6ª5ª5ª4ª44ê31IB""!!xfRsrqponmllkihhgfepV;66 ! !" @; XP cY uh!|&)++2Ʒ`O&=Hтqzupkfa\W[ x ? ;: 87VRQVTSQQPPOPOPOPOPOPOPOPOPOPOPOPOPOPOQO%$d[Q ѸSV﹪UTSSSSSSSSSSSSSSSTfȶU9«6ª6ª5ª5ª4ª4©3ê31JD&%#"w_trqppommlkjihgfew^7/(D;UIbTzi &̺YF0=ˀnztnid_YT[ x = =< ?>`ecPOOMOMOMOMOMOMOMOMOMOMOMOMOMOMOMNLfd10vf]'i˹XɷVɷVɸVɷVɷVɷVɷVɸVɸVɸVɷVɷVɷVɷVɷVɷVɷVɷVȶVI:«7ª6«6«5ª5ª4ª43ë3294 @82ptsrqponmlkjihgffxZ5/,# I?XLhZp &˹YG0=̀oztoid_YU\ s ; =< @>`_^=>>===<<<<9ë7ë7«6«6ª6ª5©4320r)! rcSwttrqpponmkjiihffsZ,(&,(PE\Opax &ɸXF0=̀p~ytnic^XT^ h 6 =< @>`_^B@QORPRPRPRPRPRPRPRPRPRPRPRPRPQOB@[Y21vf]'dEưBƯBƯAƯAů@Ů@ů?Ů?Ů>Ů>ĭ=ĭ=ĭ<ĭ<ĭ;Ĭ;Ĭ:ì:ì9ì9ì9ë8ë7ë7«7ª6ª5431-'40 A:4qvutsqqponllkjihgfkR! 70TIbTzi%ǶWF/<lwwurpmkhfda_\ZWW_
b 4 =< @>`_]DBXVYWYVYWYWYWYWYWYWYWYWYVYWWUSQB@[Y21vf]'dEưCưBƯBƯAůAůAů@Ů?Ů?Ů?Ů>ĭ=ĭ=ĭ<ĭ<ĭ<Ĭ;Ĭ;ì:ì9ì9ë8ë8ë7«7ª6542-~(LD ! 50-oxvutsrqqooomhfeehiiXFG>YMk\t#±UE/=с]
i : =< @>`_]FD_\`]_]`]_]`^`^_]_^_^_]`]_\YVSPB@[Y21vf]'dEưCưBưBƯBůAůAŮ@ů@Ů?Ů?Ů>Ů>Į=ĭ=ĭ=ĭ<Ĭ;ĭ;Ĭ:Ĭ:ì9ì9ë8ë8«7652.|'D>! ZNDxywvuttsrnrZxeQYME70)5.(4.':3,`RB}gM^PD:+'PE_Rxg RE#'D|NNOOOOOOOOOOOOOOON5f y D =< @>`_]HFecgegdgefegefefefdgdfeec`^YWSQB@[Y21vf]'dFưDưCưCƯBƯBƯAůAů@ů@Ů?Ů?Ů>ŭ>Ů=Į=ĭ=ĭ<ĭ;ĭ;Ĭ;ì:ì:ì9«8763.x(C=! MD=q{yxwvuumn^N:4. LA5u[/*(>6XLj\s NW??@퓇@쓇@듇@듇@듇@듇@듇@듇@듇@듇@듇@듇@듇@듇@듇@듇@땈@rg, K =< @>`_]JHljmkmkmlmlmlmlmlmlmlljge`^YWSPB?[Y21vf]'dFưDǰDưCưCƯBƯBƯAůAů@Ů@Ů?Ů?Ů?Ů>ĭ=ĭ=ĭ=ĭ<ĭ;ĭ;Ĭ;ì:ì9874/xj'62! -*(seWy}|{zyxwt_830ubNr`K'#PF`SxhAYʻ]ξ_ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ο`ξ_iI M =< @>`_]LJrqtststststrtrtstssqnlge`^YWSPB@[Y21vf]'dFưDǰDưDưCưCưCƯBƯAůAůAů@Ů?Ů?Ů?ŭ>ĭ=ĭ=ĭ<ĭ<Ĭ<ĭ;ì;«985/re'1.! C<7k~}|{zz{iW&## 778VVVfefhhigfgUUV aRAfA93A9ZNn_z(03455544443333222215ͻ[J N =< @>`_]NMyx{z{z{z{z{y{z{zzxtsnlge`^YWSPB@[Y21vf]'dFƱEǰEưDưDưCƯCƯBƯBƯBƯAů@ů@Ů@Ů?Ů?Ů>Ů>ĭ=ĭ=ĭ<Ĭ<«;961oc('%" ! ! ! "!"ZPGx~}}|l.++"!"WVW tbNknV *&THeWp !"""!! #̺ZJ N =< @>`_]PO{ztsnlfe`^YWSPB@[Y21vf]'dFƱFƱEDZEưDưDưDưCưBƯBƯAůAů@ů@Ů?Ů?Ů?Ů>Į>ĭ=ĭ<ì<:72sg**(# "! !! ! &$%seW~}gYK%%&112:41gigH?6F=_Rxg !""""!!! $̺ZJ N =< @>`^]RQ{ztsmlfe`^YWSPB@[Y21vf]'dGDZFDZFDZEǰEǰDưDưDưCƯBƯBƯBƯAƯ@Ů@Ů?Ů?Ů>Ů>Ů=ĭ=;94tg,+)$!!""!"!!" 300te}F>8fff334# mWnjjmX 92YMo`{ "###"!! $̻ZJ N =< @>`^]TS{ztsnlge`^YWSPB@[Y21vf]'dGDZGDZFDZFǰFDZEưDưDưDưCưCůBƯAƯAů@ů@Ů@Ů?Ů?ĭ=¬=;6r/.,%"!##"#""# !72/l~=71 767 o^Nmllje81,&#TIgZs "####""!! %̻ZJ N =< @>`^\VU{zusnlge`^YWSPB@[Y21vf]'dGDZGDZGDZGDZFDZEDZEưEưDưCưCƯCƯBƯBůAů@ů@Ů?Ů?ì><9y084'#"$$#$#"$! ":63rªQHB ^^_<<= gXHpomllkhXH KAbT}l "#$###""!! %̻ZJ N =< @>`^\XW{ztsnlge`^YWSPB@[Y21vf]'dGDZHDZHȱGDZGDZFDZEDZEǰEưDưCƯCůBĮAĮAí@í?ì?ì>=:4@;(#"%$$$$#%!!#:63rëªn`S 99:@@@ fWGqqpomllx\%" >7]Puf "$$$$##""!! &̻ZJ N =< @>`^\ZY{zusnlge`^YWSQB@[Y21vg]'dGȲHȲHDzHDZGDZFDZFǰEưEůDĮCíB¬AA??==<;6VN+$$%%$%%$%##$;65sĭì«p*() nnohhh cUGstrqpnmmi93.2-YMo`{ !$$%$$##""!! &̻ZJ N =< @>`^\\[{zusnlge`^YWRQB@[Y32xi`(dHȲIȲIDzHDzGDZGưFůEíDCA?><:98764\T,'&'%%&%%&$#$2/0xůĭí쬫ZPI ! !rrrttt TJBwvtsrqpnmmeVH%"TIi[u !$%%%$$#"""!! &̻ZJ N =< @>`^\\[}|wupojhdb][WTPN@?[Y54}nd*dHȲIȲIDZHưGįFEC@>;8520{.y-x-w,k`*-,(&%'&%'%%&*()tfŰůįĮíí쫪u720 >84pywuusrponn~jT J@eWp $%%%%$###""!! '̻ZJ N ;: @>``^IH]\\[ZYXWVUUSRQQOOMMKKIIGGEECCA><][65qf+dHȲJDZIůGFC@=84{0s,zl*tg'oc%l`#j^#i]"cX#84'&%('&('&'&%'kaXïƱưůůĮĭíìì«~j831 0,+~g|yxwutsrpond/*(D;aT|k $&&&%%$$##""!! '̻ZJ N 87 <;`ba_]][][][][]\]\^\^\^\^\^\^\^\^\^\^\ge0/zmc*dGưIîHEA=7}2r-tg)e[']S%VL#C<$B<&@;%?;%@:#;7$(')(')('(%%'WOKȳDzƱƱưůŮĮĭìì«vWNF3/,1-*D=6k~|zyxwutsqpok70*81^Qxh $&&&&%%$$##""!! (̻ZJ N 54 54/@?~NKIE@=o:8e85a74_74_74_74_74_74_74_74_74_74_74_74_63`&#=pe,cGHD?8|2xk-dZ*LE)B=)1/+/-+.,*((*('*'(*''*'&))))(()(()''(=97˶ȳȳDzƲƱưƯůĮĭíì«zxz}}{zyxvutsqpnH>8.)ZOtd $'&''&%%$$##""! (̻ZJ N {" }
I´WṬS糦PﱤOOOOOOOOOOOOOOOXdCC<5sh/UN,>:,1/-,+-++-+*,)(+)(+211634855844422*)+('))()'&(ZSN¯ʶɴɴȳDzDzƱƱŰůĮĭì쫪~}|{zywvusrqqp`R(%YMpa~ $''''&&%%$$##""!(̻ZJ N yfĶZdɸXʹYʹYʹYʹYʹYʹYʹYʹYʹYʹYʹYʹYʹYʹYʹXɷXŴVN=:~q3RL.75/-,/-,.-,.,+-+*,534VPL{qh|qh<88(')(()-,-ti˶ʶʵɴȳȳDzƲƱưůĮĮí쫪~}|{zxwutsrr{hQ'$XLn_| $'((''&&%%$$###!)̻ZJ N xfŶ[ɸXJİOİNįNįMïMïMïMïLïLïLïK®K®KJIGD>7d[2;80..0.-0/./--.-,.A>=qhaǶҿѾнϽϽλKFC(')(')311̸ʶʵɴɴȳdzƲƱưůůĮíìì«~}|{yxwutsslU! NDm^z $((((''&&%%$$$#")̻ZJ N xfŶ[ɷXƱPW̸V̷V˷U˷U˷T˶T˶T˶S˶RʶRʵQʵPɴOűMICy9RL3101/.10.0/.0--/>;>x̼Űî¬ѿпооϽϼѾy311'&(QKHð̹˷ʷʶʵɴɳȳDzDZưưůĮíì«}|zyxwuuyb&$% G?hZu %)**)((('''&%%$$*̺ZJ N xfŶ[ɸXŲR̹X̸W̸W̷W̷V̷U˷U˷U˷T˷TʶSɴRïOIu=9731032132130/1LHGƲűıİįïîîѿпоннλzpf)(*/./ϻ̸˸˶ʶʵɴɳȳDzƱưƯůĮíì«~}|zyxvvi-*+ F=i[u &)***))((('&&&%$+̺ZJ N xfŶ[ɸXŲRY̸X̸X̸W̸W̷V̷V̷U˷U˷TʵSƲQL|@?=6224324214103YSQȵƳƲŲűűŰİİï®ѿпоѿKFC&&(kb\̹̹̹˸˷ʶʵɵɳȳDzDZƱŰůĮí쫪~}{zyxvh,)* F>k]x &**+**))((''&&&$+̺ZJ N xfŶ[ɸXƲRY̸Y̸X̸X̸W˸W̷V̷V˷U˶TȴSOEEB8225435435112VQO˷ȵȵǴǴƳƲŲŲűŰİïîѿо1/1B>=λ̸̹˷ʶʶɵɴȳDzDzƱŰįĮíì«~}{yxx}e)&' G?m_z!'*+,+**)))((''&%+̺ZJ N xfŶ[ɸXƲRZ̹Y̸X̸X̸X̸W˷W˷V˷VʵTƱRKc\<325446435213IFE̹ɷɶȶȵȵǴǴǴƳƲűűıİïîѿѿͻkd]*),~Ѿͺ̸̹˷ʶɶʵɴȳDzƱƱůůĭíìĭ~}|zyyyb&#$ I@o`|!(+,,,+***))((''&,̺ZJ N xfŶ[ɸXƲSZYY̸Y̸X̸X̸W̸W˷VɴT®PtB767546546335GDDͺ˹ʸʸɷɷɷȶȵȵǴǴƳƲűűİİïѿ755ncXϼλͺͺ̸̹˷ʶʵɵɴȳDzƱưƯŮĮlQJBOHAsb~}|zzs\ KBqb~#),,,,,+***)((('&,̺ZJ N xfŶ[ɸXƲSͺ[ZZ̹Y̸Y̸X̸X̸W˶VdzTJIF:547657546979μ̺̺˹˹˹˸ʸʸɷɶɶȵǴǴƳƲűűİïî¬ѿriaKFDƴϼλͺͺ̸̹˷ʶʶɵɳȳDzƱưůůxl^('(!!#! "$"$^UK}|{{r\ ! MDsd #*-,--,++**))((('-̺ZJ N xfŶ[ɸXƳTͺ\ZZZYX̸X̸XʶVRldA548767657546qjfȸνͼͼͼ̻̻̺˺˹˹ʸʸɷɶȵȴǴƳƲűŰİï®NIGѿϼλͻ̸˷ʶʵɴɴȳDzƱȱ~410$$%%$&$$%"!#841y~}{{p[ ! NEwh %+--.--,++***)(('-̺ZJ N xfŶ[ɸXƳTͺ\[[ZZYX̷XɵVMDA:768768657FDDϾξνννͼͼ̼̻˺˹˹ʸʸɷȶȵȵǴƳŲűİį®vmgнϼμͻ̸̹˷ʶʵɴȳȲDzɴu&%'%%&%$&##%.,+ve~|}oZ ! !%# UK{k &,...--,,,++**))(-̺ZJ M xfŶ[ɸXƳUκ]ͺ\ͺ[[ZZ̹Y˷XŲUvmD769879869657zsϿϿϿξξννͼͼ̻̻˺˹ʸʸɷɶȵǴƴƳűűİîî~uϾонϼμͻͺ̹˸˷ʶʵɴȳDzɴ}0.-%%&$#%.-,ud}}m_U ! ! !-* bUo (-.//.---,++***)(.̺ZK K xfŶ[ɸXdzUλ]ͺ\ͺ\ͺ[[Z̸Y˷XPHE=77987:768NJJĸϿϾϾννͼͼ̻̺˺˹ʸɸɷȵǴdzƳűűİîîξ̻понϼλͺ̹˸˶ʶɵɴȳDzưvg)()20/yi¬ì~{IA; ! " !0, fZt!).////.--,,++**)(.̺ZL x C xfŶ[ɸXdzUλ^κ]ͺ\ͺ\[ͺ[̸ZʷXzI:9;98:98:657~vqϾξνμͼ̻̺˹˸ʸɷȵǵǴƳŲűİïî̻ѿѿоϽϼλͺͺ̹˷ʶʶɵɴȳDzįosĮĭ¬«z?:5 !! " !72 i\ x$,0111100///..---,0˹YM
a 4 xfŶ[ɸXǴVλ^κ]κ]ͺ\ͺ\ͺ[̸Z¯Vf`D87;:8:98:A?@ϿϾνμͼ̻̺˹ʸɷɶȵǴƳƲűİïîпоϽϼλͺ̸˸ʷʶɴȳȲDzȲDZůĭìëªu:52! ""!"! "C>&uj0>JPƳRǵSǵSǵSǵSǵSǵSǵRǵRǵSǵSǵSǵSǵSǵSƴRcO x L $ xfŶ[ɸXǴVϻ_λ^κ]κ]κ\\ZSGD>:9;:9;879d^]˾Ͽξνͼͼ̺˹˸ʸɷȵǵǴƳűİï®ѿпоϽμλͺ̸˷ʶʵɴȳDzDzưůĮíì«zf&%&#""#"#! "HC&pg3BOTﵩTUTTTTTTTTTTTTTTU<
x D xfŶ[ɸXǴWλ_λ^κ^κ]κ]ͺ\̸ZM=<=;:<:9<768|οξνͼ̻˺˹ʸɷȵǴǴƳűİïѿпϾϼμͻ̸̸˷ʶʵɴȳDzƱưůĮíì«yjZ!!"#####$
( 3(4*1'/%.%.%.%.%.%.%.%.%.%.%.%.%.%.%)! } F xfŶ[ɸXǴWϼ`λ_κ^λ^κ]\˸ZtlH98<<:<;9=;>:9<\WWϿξνͼ̺˹ʸɷȵȴƳŲűİîѿпоϽμͻ̹˸˷ʶɵɴdzƲưŰůĭì«o.,-$$%$$%$#$ B0 ^>1:)乌kn˙sМuΛt͙r˘qʖpȕnƓmŒlÑkihgedc˛wx[ J xfŶ[ɸXȴXϼaϻ`λ`ϻ_λ_λ^UDB@=<>=<>98;{yϿξͼͼ̺˹ʸɷȵǴƳƲŰð®¬ѿпнϼλͻ̸˷ʶɵɴȳDzƱưůĮìì«xi[##%%%&%$&#%% L5!fD4>,⾐npҞwסyՠwԞvѝuЛsΙr̗p˖oɔmƓlđjÏigfe˛wx[ J xfŶ[ɸXȵXϼbϼaμ`ϼ`ϻ_λ^P@>?>:8;Ͽξνͼ̺˹ʸɷȵǴƳűİïѿоϽμλͺ̸˷ʶʵɳȳDzƱůĮĭì¬OHC$#%&%&%$&".) X;$oI6A.ppӟx٣{֡yՠxӞvҝuϛs͙q̗pʖoȔmƒlőjÏihf˛wx[ J xfŶ[ɸXȵYнbϼaμaϼ`ϻ`λ^rjK;:?>=?>=?<:<Ͽνμ̻̺˹ʸɶȵǴƳűİîпоϽμͻ̹˷ʶʵɴȳDzƱưůĮììªu411%%&&%'&%'$C4#dB'wO8D0ĔrÔqաyۤ|أzסxՠxӞvќtϚs͙r̘pʖoȔmƒlđjÐig˛wx[ J xfŶ[ɸXȵYнcϼbϼaϼaϼ`ʷ^nfJ<;?>=@>=?>=?Ͽνͼͻ̺˹ʷȶȵǴƲűð®ѿонϼμͺ̸˷ʶʵȳȲDzƱůĮíì«}o`&&('&''%''**(V>&mI*U:F2ƕrÕr֢zݦ}ڤ|أzסyՠxӞvќtϚs͙r̗pʕoȔmƒkőkh˛wx[ J xfŶ[ɸXȵZнcϼbϼbϼbϼaȶ^leJ=<@?>@>=@@>AϿνͼ̻̹ʸɷȵȴƳűİïѿоϽμͺͺ̹˸ʶʵɴȳDzƱưůĮíìªNGB&%''&('%')81,jJ*vO,Y;H3ǖsĖrؤ|ިܦ}ڥ|٣{סyՠxӞvќuЛs͙r̗pʖoȔmǓli˛wx[ J xfŶ[ɸXɵZнdϽcϼbϼbϼbȶ_lfK==@?>A?>@@>AϿνͼ̺˹ʸɷȵǴƲűİîѿпоϼλͺ̸˷ʶɵȳDzDZưůĮí쫪r0//('((')'&(,K<1xT-V.];I4ǗtĖrڥ}ިܦ~ڥ|٣zסyՠwӞvҝuϛsΙr̗pʖoɔnj˛wx[ J xfŶ[ɸXɵ[нeнdϽcϼcϼbȶ_mfK>=A@?A@?A?=@Ͼν̼̺˹ʸɶȵƳűűð®ѿоϽμͻ̹˷ʶʵɳȳDzƱŰŮĮì«mcV'&()()('))0-2iM6]0[0`;J5ȗtŖsۧ⫂ੀިܦ~ڥ|٣zסyՠxԞwѝuЛtΙr̘q˖ok˛wx[ J xfŶ[ɸXȶ[оeнdнdнcнbɷ`mgL>>B@?A@?A=<>Ͽξͼ̻˹˹ɷȵǴƲűİîпϽϼλͺ˸˶ʵɴȳDzƲưůĮíëë};75(())(*('),B7:\BA@BA@B=;>Ͽνͼ̺˹ʸɶȵdzƲűïѿоϼμͻ̸˷ʶʵɴȳDzưůĮĭìëyl_)(**)**)***+4_IAhAn4c1c))***+*(*.@8>^HrEu5e2dAb]^Ͽνͼ̻˹ʸɶȵǴƲűïпоϼλͺ̸˷ʶɵȳȲƱưůĮĭ}o`,+-+*,+*++--8fOFlM|Hy6f2e B x Ʒ[bƴTǵUǵUǵUȵUȶVʷVRKHFDBEDBDCBD?>AϿνͼ̺˹ɷȶǴƳűİîѿоϽϼͻ̸˷ʶʵȴdzDz_WQ,,..-/.,.-0/?oWNsTTQFx6g3fBR;ɘuĖsު將㮅⭄ଃߪݩܧڦ~٥}ף{֢zԠyӟxҞwƖpɚvcm Q , = 0 MȺ]Ⱥ]Ⱥ]ɺ]Ⱥ]õZڼW䷪T읒NGECDCFDCEDBEB@CgccϾμ̻˹ʸɷȵdzŲİïонϼλ̸˷ʶʵɴȳDzyk202.-/.-/../)L;)vO1\5d6g6h6g8l4gDU<̚v̜wƗtƗtƗtƗtƗsƗsƗsƗsƗsŗsƗsƗsŗsŖsŖsĖrџzj : + ? M6
'&%y#pC=nW7fN>'>1 6*=98EDGDCFDCECBDLKLĿϿνͼ̺ʸɷȶǴƲűðî¬пнϼλͺ̸˷ʶɴʵ@=<.-//.0/-/'3. Y<&qK+T-Y.Z/[/[/[(|R9G2ƭd齑nqŗsƘtƗtƘtƘtƘtƘtƘtƘtƘtƘtƘtƘtƘtƘtƗtݵi ,!iǘtĖrqptaUBBEEDFECFDCEA?BϿξͼ̺˸ʸȶǴƳűİîпоϼλͺ̸˷ʶ˶VPK/.00/1//0.-/
_<.#3lS> lRpVpVpVpVpVpVpVpVpVpVpVpVpVqVsX "oПyqÔqĕroYHEFEDGEDFECFCBDYUWϾͼ̻˹ʸɷȵƳűİîѿонμλ̸˷˷ïka[/.00010/10/1NNPqqs(() V # #oʛvƕqҝvМtmUNLEDGFDGEDFEDFDCEϿνͻ˹ʸɷȵǴŲıïѿпϽϼλͺ̸̹űzof5351021020/1DCElkn,,- X $ #oʛvʙsأz֠xϛusaVDCGFEGFDGFDGDCESPPϿνͼ̺ʸɷȵǴƲűįпоϼλͺɵvj534112213001BACvux,,- X $ #oʚv˚tڤ{עyآxfKHIFEHFEGFDGEDGCBD{wxпξͼ̺˹ʸȶǴƳűİîпоϽλλŲyp867213214203979onp,,- X $ #oʚv̛uܦ}٣zآyѝvucWEDHFEHFEHFEGEDGGFIϾͼ̻˹ʸȶǴƳűİïѿоннkc^86832432431398:nmo,,- X $ #oʚvΜvާ~ۥ|٣{٣zp\SOFEHGEHGEGFEGEDFLIIϾν̻˹ʸɶǴƳűİî¬ɷSNK324435435324989rqs,,- X $ #oʚvϝwੀݧ~ۥ|٣{آziNJKFEHGFHFEHFEGEDFPNPϾνͻ˺ʸɷȵdzűıŰîпd]Y;9;435546546324A@Bzy{,,- X $ #oʚvОx⫁ߨݧ~ۥ|ڤ{סyxcLIJFFHGFHGEHFEHECFIGJϿν̼˹ʸɷɶɵŲ̽}ohbMIH98:446657657546546POQ,,- X $ #oʚvџy䭃ߩݧ~ۥ|ڤ{עy|eNJKGFHGFHGFHGEHFEGECEiefϿννμ˹IJzsYTRHEE668658658769768768657?=?YY[,,- X $ #oʚvҡz宄⬂᪁ߩݧ~ۥ|٣{آyfWPNFFIGFIFEHGFHFEHDBEMKN{xwͽ̻µz]XVOLL98;87:87987998:98:879869658;:8,+(^]`,,- X $ #oʚuԢ{簆䭃⬂᪁ߨݧ~ۥ|٣{עyngZSEEHGFHGFIGEHGEHEDGCBDNLNpmm¾tlhe`]QNN=;=:9<98:98;;:<;:;:9;:9;98:76:879@>;`Y;:<:9<;:==;><;=<:=;:<;:<:9<87<87;@>wDHFͿbKC hhm蚚,,- X $ #oɚu֤}볉豇毅䮄㬂ઁߩݧ~ۥ}ڤ{٣zՠxik]UIGIFEHGFHGEHGEHFEHFDGEDFCBDCADCBDCBDHEGURSWUUWUU[XX^ZZ[WWTRRUSSRPQFCE@>@?>@>=@=<><;>>=?>=?>=@>=?><>=<>=<>;:=:9=:9=<:YS@{qEJNƲPɴPIcLD iin蛛,,- X $ #oɚuإ~겈豇毆䭄㬂᪁ߩݧ~ۥ|ڤ{آzآy̚t{d_UPHFIGFIGEHGEHGEHFEGFEGEDGEDFEDFDCFCBEBBDBADB@CA@CA@BA@CA@BA?BA@BA@BA@B@?A@?A@?A?>@>=@<<@<;?=;?=?MI@b[CmfEKNQdzRʵRɵRʵRʵRJdLD ijn蛛,,- X $ #oɚu٦촊겉豇毅䮄⬂᪁ߩݧ~ۥ}٣{עzסyϛtl~gZPGIFBFEHEDHDCGECGEDGFEGFDFEDFDCFDCEDCEDBECBDCBDCBDCACB@C@?B@?B?>B?>A@?A?>A>=@QMC^YE_YEphGNNQƲUdzT˷U̷TʶTʶTʶT˶T˶SʶSJdLD ijn蛛,,- W $ #oɚuۨ촊볉鱇簆宄䬃⫁ੀާܥ}ڤ{٣zϜuĖrƗtlZ4ՠPNrjN_[M^ZMNKICAGCBFDBFDCFCBECBFBAE@@D@?D@?D??CGFDYUGYTGZVGe_IOPPUIJWŲWȴW̸X̹W̸W˷W˷W̷V˷V˷U˷U˶U˶T˶T˶SJdLE ijn蛛--. U # & oɚuҡ{氇㭅ᬄૂުݨۧڥ~ؤ}ף{աzԠyҟxўwɘrqŗtxd9̾aƳRɷ_ɷd±b]YYT~TT~SRVVUTVZZı[ȵ[̸\ͺ\κ[Z̹Z̹Z̹Y̸Y̸Y̸X̸X̸W̸W˸V̷V˷V˷U˷T˶T˶TJdNF kko四001 { K }_ 0&pѠzƗsƘtƗtƗtƗtƗtƗtƗtƗtƗtƗtƗsƗsƗsƗsŗs̜wəvtB˾aIJR̹aѿgѿfffeоdϼcϼcλbϼbѽbѾaѾaѾaн`λ_λ_λ_λ^κ]κ]κ]κ\ͺ\ͺ[[ZZY̹Y̹X̸X̸W̸W̸V̷V˷U˷U˷TJdUM!ootܛ::< Y 6 y[ TA/mҡ{Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|Ԣ|ƗtLͿaðPŲXɶ]ɶ]ɶ\ɶ\ɶ[ȶ[ȶZɵZȵZȵZȵYȴYȴXȵXȴXǴWǴWǴVǴVdzVǴVdzUdzUƳUƳTƳTƳSƲSƲSƲRƲRƲQŲQƲQŲPƱPűOűOŰOIdg])xx}̡PPQo - vZ qVfDhdhcgcfdfdfdfdfdfdfdfdfdfdfdfdfdfdfdg\I^d̻[ǵUǶVǶVǶVǶVǶVǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǶUǵUǶUǵUǵUǵUǵUǵUɷVg{5sxx~ߖۖۖۖۖۖۖۖۖۖۖۖۖۖۖۖۖgfiH
A A9óVʼ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʻ_ʼ_ŶYݧ=N.2ETUV ]^`cdfefgdfgdfgdfgdfgdfgdfgdfgdfgdfgdfgdfgdfgdfgdfgghjLLN A A611111111111111111111111111111111111111111145 ? ? PNG
IHDR \rf IDATxg-u&~;2y
I zы\KU]53jV͔V[35?zzzLzQTH*QE#ѓ @x`c2cϏm"} }x|{9y2##bo'O ?9~
!=/t ʟ: ݀ }> @`f _3
Pp0aW?m{MǏJD#"O~ Q `
]0A
cD۶:GN\@x}AK<={疝W] !Џ(_O U6mZعcG*f0~ { /X!ƈG6<`( ?2SB! %;n]O?Nu]ѓhbM9عia d>_K!sa/ h4 | #F\6))v\v=O % xU^0@ ,.. rfT6/̠!Vf O&nܰ.O@rEt'}q d0?
?)~$yS 㥳si{ò1|_mFJ~ 3C bOdVl 9&@pY!j`(eVL=#?sf.eu hemӤ^%B;liyyS]ըgΞA| 3*PUؖ x `+-~D 8
sG}_avasu Ah +d8,ת@ saz/ rRR\')eN/&S$w'D$ʾ}E~G[Rz=aܗD('贕-9)tf:ͧd4hIڻ'N`:襁~J/0~50 i&ieeen$A_p)J$Oy lܺ
h &hU ",YhV
QbLRD"E"BLY$A^-'W|SWV7E{dwEVID4Ox&Nɦ^R!!,rA"d%
IWW%Z̅UGKd%x4
f;@3"a#8+)R㘐S7@8qN< F06i U
h#tg&iY,=k*_:I/u+8UoM--4]{MR6׀Ū:jD:E&0&wP- @I!rŲHCgVp/ge 7M̩rcFsNLbvFB g"1;N;
Μ6-1xHֿDM`@ |* k_yB6gʛ6Mn`!s0cvB'b%9ȜC? - 0MFKۥjy]@ '~3Yy7-)e,\s=B=HE0) n&@ۂ
Ŭ> 0u!{ Dgp 'p$!S2m^%֦p 1,yV>ͤ )IXV c]wktt: G + 8{ h&d2SJ^BDD,$[[i4}hc;Ϊ%c -xtLIp 3%(ϕض|Ό YxٷK7S=!#ͥsc6OdVdw@|\@1WYeԘ2QMe)*H02s1P/^3p]ׁ;
A9F6W۶ ؘZ0 Q^< EfmLaZY1Iv
*(@GvM6vB@s##F?f :,~5-y* i3-",cefp *1s77݊1u Mj'][.~G3|TDT/$w @UwZj *w FD0b; tfhLHe / \D َD%DVeRGqF
~z7zՆv xwp0ӟ7
V`3: VyCPS==0sׇai/ȯG ;1 #&d0@8BA Epv-?GG HD|/8КW̝M(hI"C;t.B! 7:s"F"$ x=\ s®^ᣛΧ0Uc'jě\mzgg{F7?fE@yaw >4Ėxs Qf-&֕TpHcd:TTK؛`a.
tn q0O@ǟ' <h~xf]I}zlX"clѶmNb _؈
ذiDh(b 6ع #ڶADa͈ظq6oކݗBca `e4B5g?t:d2d2tfgΜ2f
"ɓ8z0Μ9 Otq <^乫Pmݎ0C}Us$l8A}E: %=
]H@Gܜco8 `3Ѧh4R IP}GiJ ' cpc{?pKqW?MF`˖ ع"\y1i4MӨ۠64J1 KT8v(O tSNa: cei {Ϝ@3 c<a:
fg7 %Kv`v<'u
F{ x2gпPnۅ#^m.,0ր9gMo:p "' 98gx Ŗe쯂Zq0
`nq{v:Fv ޡ=E]s%eflܴ
W]s=n~1L0L䃞>uJeh%=k$d7Ɣ[AZ4!X!3\su׃9V9y
O<( =agCchBUUl? 푢`
Ėyff ;{z_ 4C >ym@zDUSyLeiiK/7t#n
>~i[,X$+/B
,hCѣ$\ɛY⮓ضhebO(/n, l^÷x48q )bĉQU hCnm0N1 K* f.eS^ fA9] E"л-kt6qw' mʗ'$<8~PN% l,d:ڭG]l06=v8oۮNpu!$ #Q!؈?F p
|"p (^ qZ%g}Mq`m+ `xTgA洨FV$
'
NmpR/
{>wqd#vQ\J!4F䯾# Żq+Nx[sx?=$ΠNq) N0pi<㘟߀˯ ۷o(ES^K߾3Epb5O@:.x @~VO ^_u6r!, 0& 6l;~}v_XNA kV^6%!2E%3 tZQsy.@js YQq1{2L' f}8]?{9 #S簲1^YvA0tDdơC~7r3c
uKuK sl^i~@P_hAηqq?.Z G¬< s_ L;LvU c=:mD)C1x$D`K_5s:ؼc'6o{;ڕ^| <8y=u Kg7P +
` ѣ6mp* P
M N_U|:F ˁc#1>{ 99ت%AEi Uʹm v+ M26K ;cp,+2-@W(B@Ž%qI9U A쒄Hޅ"!!3cF ܲ3
^n|# xq~,/BIR$utnC|~;JΡ%%PWdb<|6 ͏Jߗu\3K9[G9(L"l۶
oxP L`F)'3pUfQJQ_3Nᆷ Ub.ObQ4
b0 bm6CF Ȇ-+s
xݷ)G`љxKK"e" ܙ p/ްregh=XJE*.x9]'?ۏ<t!`)@$rZ5-`Y|( yHə'H͂CˍQ@l,lڈ/0u+U q)|_eF#'ɕk1ĥغ aPu?O'o
E;")nޚ4?yU淾ɯ~ڌزV TU㕋"DQMYt-bI9*@n5Nh0啈Zjy=P]T(jN
LEL? u{ |-Jrĕo|3~q7c d %b4_* :%,c2 :
MkCB$FV ~W~mK8q
ɔHߍ
r7cE;S3p]CްB Dv(v2 W|Q *vc%cm( Vף{M"N#atcӮޟ5 E0} &"Fcǰ啕yi6-6U
?Oi~DƏ ;u*?c I$~Ce$ikII;|Q
GH>J1!)3O .ފN=RQ@H ňe@N+\y2U8Nm-lM (>x1gT%0]|4Z]w݅3g`yy+Q*7ic(Ɇ#HD B~hןp.l]aZv*M}2$&J۶_$v -
)j!վJ)'"y.RZJ <$Qd.p s)%%+-DYsSl; M8Zh
_;){0G 85yO'KK8x`Lq ] Ee @ ;?Y n!5Ehvi&"K1zvg;nIin">[/R!7vMv1]"|>V( v8kkFT_ J;LC)T>LaՅ>zx'~
bؤ
>e}qv,c2$wmDT;!mDa ( w%pa21f/>2Dk m l
MHBobc"NUP +THSBq'j]-Ycǩ S{"I MMx@FgUQҭ>/ J&K;23qoO!m*$!-x'|ss
yrE)!_a9.H"fMƂsӚi淼 W_s
zZwE-Jt_͟v PYLz"&>Cv}'{
yd*>p
HokUD,mKNJQRSѷI# ozPh_[z? De {qPZHId!>!a Lt-hBA D#Eh,^9GILʳSY
"iKv|(YD- *++Q$ .q} ?k~,o5\13g3- 33`8H*^xy t;7֏) `헸
8u| vobJ,9A/W_{5^|:?MKaE1Xf!2
MWBhA8^Ϸ ExkX@d5 ?J q̛g[9QH4p.1 Z2/+ "`cαH" cıOc bf8D?8T*wcQ) S V^U)G0߸mu5.aMz3d>Tafo*6lhV_kI>-mJb\
D ,$ȂE)V ^Wa}d SfS
d %03A9<'GsV ;Dp`"caV|W.?k8-\U 秞zzrӦZ" j
0 a?h m~ Q* F}u.x"yy?+dV>D;GOQ#N+.O|L**7jҋ+J4m1QPg\tG
P oT׆T0Dxh'ЬLwVQ_dр܀Maى, XL2*V vg. ?Sտ_uM YiFBUmvύ
?](cBDc00QC!*{ fq0a+oƯ.}<}ǾM) PLg˻
Gu`f
gO _:s| hkN7r31ܠpMצiY%j
;w^ 3eY朗56
;^b1,o|~-@v.$9Oqu ZqC]k/j܇} [JmJ$M̜hL=.GtmC7B' !icl ĶQmǹn̴E
*׃u/ T |sL^)O_xqoo=61U
j(TMA
rD4?g/#"Z!s<to~ݿ>gi]0_E ̃-[N.y۵B&ل UWjzJpDM,^)IEnUf9
㮿/ÄLHRI}~!+aw֝._ P
QÇMVr:H.pQ֔tQW?Y } ;/ [q\5]prsS,03`FFoP!vYJE4Ɖ˓|ܲ҅
[v-*XNSW+j@ &%'J6PfeLHWs+LGqy a XT ?ge4Ѡn'PV{fp ۰90ћP
r-9[0E:j$ 1s`"^ ;/ttX߳q )}33Saav;0-o p
Y W G ;`bt$*m \Y.r5],I60]B7.2/,țZ2UJuʲ3ܢ蔈'(]%NʌboqŧqQ
aJ_eٍܿ5B j@
lyđ1M!50>.Ys
PC2^&gl*'m!-0,! [ "W b5:fkr
B3vMU]~0mh)8+,iw6fz q>"5.
WH<~Ъ9ʸ _/_*Āɝ.,(lR7Xl
7"XJzcn[1Z`ʂ/&Y#GW4N˅#2qk+0j[khĩ?gI]E'ܪnuZb "u /%mu:(!_ ~rȖ~utN~/K.ۍ
*('8]udMb
P AE';%vNk ==G?"%4_)H*
tdHG%JEƥ7^FU? rĩ#,c2xtܠDĆ]5B]h.:d)_ݞLR6)9(#j(qH__??X n⡡tbNМ9
j*I B/ΗIVYGT':S0 .7+NiP9=-\- !K5]
fI+\Z2&#ptu
'tA6?Ҿ<(Lb,\60|$Oӭ G] &)Qf6yz[u*v^@(ޥp
f@/?^_XL@Zkaqe9/'0yK YhtC pw\m$ {)Т5WnyBm Zj]t`-Zu0LDj^KG\'2q%z:u%
C ]ZM.ґ~{rlW`ZL?LAo&'0X*BPU* jEٝų8X>}]j%u
⏡(BVYWdXW ݨUIv{#E Uoh O^n@-v7$ QY,EϬo]දUbsQ-g}8 ,8͊*=vgdYg"U\wrٟ`RW!x.z"Y@U=? iF-&\>Z+/WQn8bJ#}@_xռ̯N\#GW_]Qn%|lݒW#L^a
-̑YWB1 *%vyr ~n+v4{ 98: X2y()VE'/|~wՆZ I ~RdˊWqf\yո
oFo0,i:b; &QD\.KNn7_Aخa\*"0[% (W3:AM-!z[P nGAb{u_Btyʰ>:vwW(0腋_X{V"g=PRvʅE;l%1 q+i rh"l"ozQս\ +2/tjddԢM_5ez_]J)|nNIT~~t ϰ}(dHH ' n?5pmkFcؿ-B^ivGy>`zk r=7IpwO}Dύ"wL&<QA8/ [}O< _0$Jan\z
^epZtIB&+DF!?u
ilDޣ8 -xn -fIj:mٙTr76oX,sHꟃ^SGsaOM[W⼃d>T-&ABPTE5 x$ꆵ}ұ7$Wwqzkڳ(i! gqFU'Nx|fb:j0Nڬ\ZrUߢ#bT8MI?U_p/Xג`Λ|8E *1BU"6춼=&e2
듯cqc8/3v>kkupPh'4@+^^s-Ɣ",)Eq=.} LIA3Wv_,9QȮ7L0BUP ,
QHx _1͍pvPH] Ji!ͮ{w~Xq~t0" z7>&|N@-,C/YB<5a[w[PLL,A^][D8 % ]K]=U;R^f>E[:C@ppnCke{) OqqɸE3\@P\mg Jq5 QC,sl~Q )(6BZ}nޫJ+6=8:hf[aXGN^3w}?҄MLi(
ŀ)In2I=V%(;\W^ܣмׁ-$gG4
<[ y;H ة Wj#[tq Ii>6Aer4hlV[~>X4A ^_$K!u&Y)p^B$sc8qKW]
ʰ "#7>T:ݘU.%&,ϗ Y+ f23_&/'h
DƖӏzthkts[ U/
N+eYc]I@f]%YHe.) S%Y]@YYLuB^^isMD7p2Y:ue={L Sq!QdaCC2d" '[dա 딺_\LV
)`P*]h-;Ay! 8sI!Q&=
.4E黧]hsÓ fe ӱ$M AЁq HBc&,'q w,ک(!;dwWmO@Ԝ7R4K@.:*Zg/'O)EgfNn vq|SUSH÷e.n͟;Y)>b/(hO
pm&ss1^lrE=HM53PF_Ww~vS|/QN4tq>M>9!O.bVލFP #o 3(bIPw1 :lE(&qOxlqe{nrf૰%(nEx:ץR5/pQ60 =6He]5/*4 D5̏bFvi{ jxA3mL[SN[g7hwwvw\^c9ʹѮ EIs2Zc]M7 .Ȍu}_N/ ]j}~;QsT+[D
Y|S`.Gg $*D;%bX;]nZ{D( Tp9ރ+J!3وyWAeDsܘ@2˴ \y;eo*kDmFJD3I?4~8 ;
~WA/#٣k ź POH
*uX |^$pkZ;mEa]=#BҧA7=?\R.B9txw
TR (ySErk {^w22!neSR=46ؾ2 FlT954"Nc\Rl>~Pu *B!m0cRcM2@:^:\Lfw۴u(#[án9%>KA9o/ч亚ZTC;ׅ ʄr
=F.kiUr\UrNVY B}S(aK(blqMVOOa}S+o'U y%"}Ýם"ɒȀ-YNJATñ
jCB Ǚw(M".*BjʐXy>MQ,l+n Mptewb{zd`u3dҖgIj[(PX=gv/yaѽ׳;JܪBjCatHWEJ
AflZ,lٮ'IL NӺF[:hji~Gd U(܉hS EխWm0CX n;ő6Ss|T2&vksD`Z!V'
H|v [%" 7_ToV>Vt"J[EfƐYzG^ ߣ<鳊u,u_VME -E}n'R`k.r.云rPF qt)i8Әy4rawGݼ(|no uŪg#˱Z7)]u M眃)ny䮑{L5i$c0l zCO,g3rys'c
AK&66):FS' [RDDVi[W6,2f CE !
I ?E.%#v]g|\]1c:b&SN ̔R P$3MTJ'mRLH}nn,9R>ϱ~
yr_P${6l =-ux:ZJWL$Jx4X'I䬡ts4@DD,@W \C-m Gv5;9ZEW"'q ZQgY)iXȑ{FaQ S,#|܈M&-ͮT 3L@A R/L%g Q sgN 'u-y }+^p6Ĉjl)iF O~QdOc1k fhQH)v&&bn%+mš6!zg1y[ld\d!='!ޔQS,4!R`ɯ +j~:D^
,#Se\>OkHd<%]`nPC) xRC22/Xֱ;|/"QKopB(*KN PIR,Rd$I"S(M9 G D/\Do1K
a{bQfV
"Q,XAe(HV`V݄IU. kJ{0JOޞ Px2Ní %^m;B}|fN#9>P~`EW73瀿c
@R+cV2\s$~t(ɗ12P 4Y n>BY0s&aUm
iݝVиve"ojY
Fһ_
Cv `^!Y,KI0(qL V(Ա."S6_:A ."5j{-09p3f7lO)OӳbLa\ JHOQ~E.>3=$e3[ 8=
2Q3vn"B3l؊:} Ӷ)7W%\1Щ8#⤥L.r
t I6YAew> ))S@w5nb8:Q,ҹS=[JȊ" aVlv?RT]
݈D
ؼu'
" yM& mkd}M()"%o{9'<ޙKUrd.< g9Z_,_RDPE0
4K&*I+g ^@r
Eq2 XJƜWDYe52yEL:,lܒP;_t"F4K*A1ئ>ʡ~HF[wi~G||$1q)hK #Yh#ಫ1ڻ'Y~&4tvl늴|'7m*je+'+eH ( Msz'0kBNNHUV 6_ޔ%q8w@@E}b;2*F: OP@r"͈" Vy|qug&cwOi(v} ň;CDf:lI*9#ނh1 {1:_hv.G$
-<"M[0a|x2 %
jR2H,rO7dLb'ЉD
1i1 bmD+DЫR?i2ZsS|"UHk
#+9bMb: g1a%X [LeZE! 92+0ClpUqL4;ڔ b Udž-BmȫP 3u ^>
jjm#?^'PP&{,jmcot;':ug l4V:?qTv w"ɪ#J oE rX#d8Y{$ ^Ac' 8
I2vm) u rtCmߏCQ,)NQ;nQLW~~O:3 DD0 `M.ӘL'ϑ]ͱaN m f6
D9s !Ta k*WtpVV JKL!zPUjd2031ڶy1_JYw'( Kkeo) g>f!.AؾkҞd,I.+R_&gi $}S MX))zs2"zgQ4u]$`Zխ݇ өi#a4U
+Y\O-vekʮ{NkJF2?99_]x#ږni6 f1"ԕ{v ZgN/ƆW|_Bu&T0#y3 #>
D xeqn UxTX$68ȋh [v`O*N rH o1;?Z oZSY..G a`PS S v5[7
u1h?*OĀ[[7KbOuT\ZW'qlD DG}v `Y(4| % %Ȇ#R2l*uuѧ, lڼ -, H2P GfGD4&㳧 c`{ }
c^f,=Xė|(%( >ͷY#"ª;G4"Q"eV`
CkˊHLjcK<"= ˮ`hծ(o$1
qOmv]AAِKCfnymI bz
;6]rz0o{ `| p3O?HH# k !
$0*$Q GK4?[ltӶ̧
F,7Nвe*V.A>-6[R9$s:B|n''mFݱCғl(Go E볠DVbɻVˡIMRnC<̣%WK\?f1bq|X -Cx'0f^Q3۲s[bvVl؈ A ajt ={0 BB%MȭݼP+ @AsymX]zQ1NOaii s Kr.j5 E(S揽zw, pԢ
* f
%hXj.D1rOgEiJꔨ{EHKO u>(^p hhk`ZiFBKd[QnMKy#y /_^fzX>5fw ;
I!
3 ~03i߈g uUt F#`Ea:Nr{5}ET# "}As9
1Wv}2N0)A@T=ԡPAUU~43m ]Cv 1rk#s"80`) `("=rJ' 12aTU7mEs4t:/uGPK " f V :'[ N/d
NRG`ໄ&?zNEӕ4 f7mB;m/2.$"}Kڊ`*{u'g;?v~G:}_`ҝz uMhpEP:"\os6whE
@ i:i:S+q ?\NgFb p HJ`I ,\q<=+ꥴIW̽'b({WVn{JdF1NڙZA:xc@8`M^PYU-Þ(I k ;|29͉
b3)() a+g@ ~=Cwķ>8y = },+T-87,|[;|C)9P2[[)ak[mOR9G~( vT2s- !h9V- 6 X@RsH`x2pM/=''8&Rx>߉QxJ
BaAt*NO9Wy\R+!PbEX>{{{ǎ ɉ;_K )[2dі` hi8E|K#^#>2ii
C Bvg``d$rMavn@QeyT D$ WdJ@ tF~ ͯ.1Yg@ Iza} ;Rt <&I;!a} N&iB4?lS. f !'>}&X De8$`%FtTu#s`KkZ H. RBʔU GTuGs'Oa ˺q?2꺟.J CF cT(JS`Fl[\rزy]CI&'
ns|v]D ?tUgH\]>qrıB"H߇E^V(p}w*m*(XDлv_D
CBr/>' ~++:I؍ y!`0ܺR-' ;ߥRpHUkDhҷ+Pa/ͥh'4N ;+.P9dLĚ**`ofі@v0:DGGj7fN =}sx[_FUl :ad
XBʨJ>rW`q[^ ۚƦb(7yX21 IUnmgKzq.?s* S YI?[nϷ;T}SF͵Unql.3Ia$¢G|smM. TV#JyJ'x{Q`%jii]i<~7RxM)$
a!U?hڮ1BVʣ
0f,<@Y]ݤN#L#H5
ZJruV d43,a'uBe5nFq d#d$ 8|h?g@ ݏ/ZΏq2t2pp 1ԙ r
5*r̨> } b iC ;"q~LHK Ngefo/mC+nlZLF+\5@_j|.s<
!0-mұ9eO7p<i 2k?SV.2ꪕ5 !:XĒ1fv^e2P/`7 w`
߿ncY Q
j/3%p.Dr+
`[WuS.G.W{< .W1?v_k
y>kSwS("65m,\s#{;034EC]aŗ7܆b NYm`
@.L |'WWHO9-DSrLq2|˟P1Tz} oou#ӵ6i)p-龪;mr{!]G%~~G I iQuO? 6m ;]+T{nmg*2.Zt0t2iFmM ^7Uo[v UȂsǺ(: =QNv:RY;PH(3o{ F/8,W
8ya~ob :+R5\by0 ,΅ J+둋%ܳV<Bz O|h) [0ز X + sm$ʵ5#"6n݁7lR<Wy ]o{6m\L'yaEt 7*1h\]Y;4
9>_c]0!ĭE UB][
aCfzWލG~װyvMƾLK>8D(Bw'Iwg 3~ um;qeWa:ΐEHsw.$h-ڲd|Oyٶ-6lَ\m_-;/)qmxed 8{~CmnLGW\uז(=K hHkXԡc-sLV-<ڙ_X}
Yt'a @#{ & L&вRYTUU
6o݆m
A(Y ҂ 4 /@{
D}{ O?xD۷mu^iLqKu3nR 3 ,/ u o戦ix]rs1BYh:Ջ59i͈ 3WT
mG۸C;t8ipTގ9U(| 7m'}XWJ@L6QZ}# g1s{nɪ0{|/_k=}: $l"WA̜ǭtᡤ]C^@w]0]{'=TU`[J{߱[ؤ>1TGY*;SB'"kAB
(V/'Y:z v R>zu!ԅKb 4S=Llnr}P&CfS[u0AAU!vs]_^½2XY^eǡ`)r őI. #jvq1ݺ~x֮PCxP5"qe0ϛbBiW/Zb
&d&e/*[Xj-٨
1Љ/}#z 9GMO$)-|9P]` C}ŵpm@} }[URK J0rp Ǭ;$M4Eaw612_|w!Nqj4Fo (w uH,)f֡ 8?C." /(A>er)ĴcX )r
V\O^(K6-l#5Mv
nYV([_!-̙DT B}/Bre`FEǎ 7-/{LO7yC̮1dٙDL۶%:w- <~om.[mYѽ11PJd-x+t*DS"%WULVD1 2mz7gN5~v&kЯȫDu*dH>q~q]?^ηX}$]Vd5=s$I79UBrFPo݁
/<@OVV܁k Aŧϗ *̫XsZm /<(RB-F\}hb[V1Kk Rߐ Ib1mc $z[0P M !AV V^NCTOK`$hD 2^Lqm7ņ5~Iv'ɑ}#X cml!7Ty37@v
u`zn ^]2MPHM ai4S8uhŲmry+4x |phg e=K&k?0
Kg{|/,ppXꪇm;0ܴ1\U˩Y&F$gWLS,Et͏(
K3lzIZ} rLDIv vͨչ ,=cx+s*.OHjsbp.K9 ]c< Z>/1bUA)(}Y
QCԃD-]r |Ѱ@ :} ?ġcei TUZKҏA?Ӆ `Z@ #%Duz(`y }ϡ1ˮW
e uB~"-Rb6{8#EE \
Uf̔)rsEJSdQФ!J+ˋj2 nf!d_a%͔ dҭlxnSo[CN ?xow| W|+s:ҘYQ͏`N5E X^Z_, }W@T5K/Oq!J榨p6f-*|.#~<@fqMgX4);X(b#s;')!} +-1>o%h::B?^j:+=Cy㒨0W7 p}zX9Ci30b9gKdTr3`r8Cy^J :?ވwK
1 c]vrR 4'y8gNC܌ f|LG# N*#G9@3Sb岢0Ii(^óxb~4pE$D]U%S@0%
BӘ|$Oǽc C(gTTpVOD9eŭ9N&F9(9
lX?ih%o߹mtbRƜr-~MJ!/ Y76Y}6%9aSgKo nx
F(7ɲJ{tF|xhųɿWxƛn}?Mh&.T'Ca4E;6e1;%D Pd'stP`*.D^!U:dJ2%O' \d#:= 䴃PN\V# $xR||i$AHҹ4 X. 7aXU0Bv1mضIT@O<>:E }/>?;/p;?Cu
,I)A Ugl) {T1c]bnΤ VY|Oféי5ϴSo3)1suD]?OgWY'-Ey
T$7$)vh<_ĦJ3 u>gF ]$
`rB I$ù>Ą$Ћáo e:okW 6Djt:Y<
m]LQi]ceg /N
d]:{w/p_u;q
o`n>$Bj!$0i#= ?}ϣMm ^Ֆ-+$)(D9Yj
-Aȑr57A-y3ҶOd'E/ ۺ]9PEĘ
>{dʌ "Χ=ڋpJ($r_JkPUuKfE4@dư_a
Y_P/)O8)xvqtVBZYFrL7EY"+P+
=4شy'n]ظk7؍j8Lh`F3Ё]_Þg $˓E#Jl!Mw}gquoxyĻgװ ?r[4-'l9c,Wr([y]O|gC)D j(bLwj m60wR{`" D0P͢MQ
S
@"S%/f Q1qðr-뚄Ь/1;c/Oe(bg0
^ O&4b|H$
O _,@i|^i1@Ws (: mmjc!3"S4nVjBd|U**y fJ/LP"2%X3A}F@P&W \{UǫV w۶Ŷۚ#W`:>MoPu:W T)wI9VWݶ M GSO
!P\Ml!f&}۶ `lݲ ;/Åfݼ5 /P_Ѧ ,S}ArBպL||PG6mImsKt~g]\qaKvEHtb0%9X:xI![tYeZ $
뺸
j#1bU%F/[ Lg '?8}]f:gݣ `m.yok\Ia
R G Gh/tHRUփb,0oy6&o:A8v 7qvlr 6&w)0VdC5W4X?!Ĉإ'[3ί ^+b{< ]LrCyGNh
y@sUg#U}qVbL IeIzR$xJ_HCu`{rS@Z{> rx`ɛO3gT9D 0PqK T~$tt 1
P "! >ںgGhc LΞF߳
J#U#D}ZH_l7M;\s F Ll\RYFIQ0
WNQ#8Fmxsr>
NkYoWp$be)K *q5+Kr^Ȝp a16:džlcDqmmۖ[~B~ uj`!D
U\ rJU= hf2FPMh'cę)d
hVpӀpt10T@k`: #Ӡf bիq p6I$\\QeUU#,ъl-Qz+dF:(=_s{#B ތ?Ip#ESJQp:/XU*/hʩjp;5#m4H I;.@*A~Gp^n H:/8 f<'1>q"uʅ>oU]dF+= BpHDBUFjĺ&cq2F5 ̠N'cf8mii yj[m2]VuSybU 7
8yOj\vͩb-#Kt ү`pd/.8am(I&r`03L=L+Z== t|(F'}?k,l}* ᙳ Brh9/dчBMh]0_U@s~c+
.Е>^*q2 vy rKc c
0QSftEݐ2Ӣ9eqRѱ.YWyX$L#?ǿ-4ʹ$ O=z?c|kXb=z
ۨ/hMZI;
!q=4?PP0r(w)Q_Rԅbw
x
!~f1wz4d"\<^A?
-#2}368b"vIܳ 1u {>b d *j:U^m M Mr ܶbjg q)@fG]]v 9h1}r b q!$b2Cl]_/܀S1[^gaӵ: O>9(QxG?on"\ gEqVc(nG|kЍN \Hld)7@ U)HY`uY[SuH%8 z˯o~sz&OMړ9u-˯9q02ԳUVֹ
\Ոm ڶ)b&7iA6c
UXG FKPg+|
+F=7'0 SШ /m %A{6[^= ) <鞮60}"}Oi_d&iHGI~2O> ܟ=!>ܹpp $YP)d
@?2_ kي *hHHBXk-|mDlL.YcTņF~ͷ ?qbO.t{> U A3M%d'V]jE-
kf@ј̉(7BN:6[[ W 6"r*}}hOD`4V sap\* h|ז
Įre?lnUg@-ϔQЈ*٣1mjB\? ?ƣ1~7~_Z 82y?d4Ó2}rt7|{ Fa#FPi,*L@ 8@XVIeWC2PLD_ c߹z/%G 98k ]cU N/S"di)3
CH,r@UkB )0 o ]cH۞gx㛓& a4G8vp_Y B)>><7"ӯ| M ? f3x{gQյ-2>pۿضu+ڦU.څ}cxޖ+0O<Pw/[9 rsN8t c!p I$99 UJ U0b:ݬQbVyº -'FecP Jѭ$ 9Wܴ(3ɠ?۵ڋkVəbL'AFRHBħk(P}[w`O \t)J3/aNE>r &ZŞ\RZQ+,}ls8yr<2hce_ٟF4m*oID YiP -<-|S=D\z}-!J 9f2AQ!z 噓" R8kAv_sZ0OnJC v2$B.
=^ 'M'W4]ȕq*a
J҇k
[nC;O}8C :HJ¥
&Q_zK{˄u+a2 ه}_ ؗ!TX}c-0_{C.#0:q<^ImS @3moPBQfggъh3m3ųލ{?AU0&a}}[
#{ rVӶ||owU?Ty]ڋRA\"' {)D s[`DLa(_6[K]decs" 4qҡ/r @Y9!,|^0]| \yәJp
]# QjM.;рU`M\zޝw_/T
v!x`sDm1b#Dn(L&c<}@x b' nW
F^>PU5 >3g@7d9bصk@3mYj"L[n S,vG}?L13_ <~S8c_+-r}!;B jUA#'Ps{8 Ӧt:dJOS4:rA _~9'?IǓd ԙxSj2m hp1:s@˔uˋx~-4ew{ %XS C33h 63 r Nm/} ^z>+p9ڀ*T!i*uNZ@ >O%D?O܇o~{8zh/ڶIy1mÕlH^FOCPXuz)PYl84n2.d - 鲖u_ӕq.GX⭩^URN6˫)2;m e,k6G[\ b^ !3.w0
/ u I9dx3_s 2n|ћۘGmW; j[
af m3ͻި{5xIXZ\>رBTC@+{}z=\}5{8s Mm7uM;pމӧO$ JQ8,q
骮4BT :Ƥ\(kO ʴ葋v{qqkp(@" ֖Q[R>T :/ZEiw5g⋚([ ghXmh}싔H겫я-&|}@`FH_F6 FgNߌl0\X{o"35pzyIs `ff= '7ߌo]v& bLtIx0
u5B] }n /hN<cmw[E?q? ;r!A
#$%q[ߋ^Gz8|0 ߸xǻމo7nu]:
8aR ;я} /M3U\x2wy,>a:fN̬UsL*grDK܍ _ˁ)_4֨Pы8?: q xDk=!Z䵯A pZ+2+ۈ,t
^tؤ5yax`K #A<~LV܂Hm8s$W^&Tsي3QoG6l%#+`gWU@Uqqpݸ[7m133G#Mx\V~3tdjwÏ}'@
/nT∸y;p
ը{=
U/i/Ј .4*[1Glc#7:;rN
w 0: MھIcxr>s^綖 |P@:)'[j*ngkCrEdd͘>p=OL)eSp3,umyuh\W@-w([İ tKoz+ 8y m*Dn 'rسgO ssؼy 6lX L56iAf;8}긆& qf.Y}YUЫklz5^ :)f|C:~WҵUqL՞yU
|@MOZͯu*ܱsQ~~Zwsɾ~&ڶO,}nyf%0AG%bN >80 ZU|Df|%-0v_}[ )]Mnظy3aeȃ;B qe(,k4R>N xv V|F~cMп ?a,\x?,*$ܴ9Uv+ JWN8Nփ`b ງxp/ء]j1Kfj ( alq1Z`$_[o`~Vԣ8y0AUUK 6s B`߈
oE{hc~3i={vs@m\Clؼ۷oWm\a} ̸QKkwM*a> I?kI1չ>]J_膗D P
"\b7uϓnznrA5vpe-
]z wxHpN ܀SΜW 7 F]yNC9*v](y^ ݿ FlB*"` yފbp{]6Ws |8/ fx|t 磘EcP`o4y> zQz>9I[* n1EnŻ|O|;hWxN<|Bkmye#mDRޝ%LpG d<z #FZշy+0;:3 ~)4iC~
M'KK>u[ r>q? ^)P :, -V_H:~Q0C CJ߯t+iPwqY+ qʧ2Re rBRB'GNH St
P v]~Oc =* ?1m$m:$U(-܂x;? < AM'eg'&`ևfUlc:W );YI6, 1J/?;L$
I9?v\|~cTY3lFi/
p^qSEM4> e4 l}ӻ[& 6'G =( aaav p#mZw?xY%ː "7nF{̜
-047~놶\safYgz}22J96Jsr
# MLҵVޣt@.
i 3%GQ jJ\q, 0l ;A 2"~/}
XYBU2FhUUa3[ޅz88So2N'"F4[yEݻq?a ".V&TtGX}!Z$PB~V]EVQ;鰢4ҦZ@&$> 'jwDIlͽKt '鼼b@L a0r/̪[_0!n 6V+_Y9UxV6n O#Y gSIqBW G CaeSawO
5z ;ӑS y3XiA Ff nA&%< yr-M0ADɠk# HV $c\"X Z",NƝq| kF
^u-V!wf-%mgw)9okVM^Vv,ƌSz9o\GISݣ -%S'0" KF7#Tɂ1QQ6*\Ͳ[?pV+IQG8Нx{wg> \Z
^*F`4
SEA H'ҏXtgTr\p
f @!|,:n~ o' Ϯܹ:eny3T֯"HB-dx~|E 1O;wa\ dg0L۴ս\?38 py "TZMgk$}@ IXyr,vܥh[˚wLarA '-NOIp߳SK/
J@^wmz
=-9UDKPB8{ 0D" =H "ZE&GLox#0!!L YYpF u
~ 8_gKI"1,E[Ax ?
L p?x@Ud o: bLplѣ>jMeƂyj8{-QXی,x
r
t$"cGqĥFG֓2z%vY&6۹"9ӫK=sFb3{^d_ b3 nx>z j0T@g?30
fW?DF
|Is Dq g^ ?# -F̕dzdsk/lVk^;2m8< m:4;Fma2[G"#WڐxD qmǼTXv}Bm U5O?@Q7<+ ډsco` -73@}G ck -c룽&Գyo/E>3fffWyv鿊}fԈ"pD?BMhb@ӼFW'1!/l :# *$ Ⱥ]@$-#EhB( Q^)hxIw \ǣܦp
3ڎ9 ʙ)Xa>!7Jak+u x:E@[isUS3@ph V5E",B^潅>Q i[ N?N/B\'}'R ;ݔ
Vr *NlȂP8~XNOɧQlٲ uuc=7{'/?I#{tSq9߷K;\9eѣGMd,p*arIfY|{v~f'3跪C蹼0hSp87R- dan7F3gݹjOs m
ꯀ`XE'QqoֆAu ޭح6_g۵hjY͗$mv#ͮ0#mÝ q3QLpx68BGyTBr/x xٷ Iޖ*IC dnn{q?{x駟{ ; c`́. ׆3uMy>~G |a8v)#%F
4
)1Xv)23eA; A@Z3.v]1x4Gtek'D!
v`E +zfp5[?
9- !V]E$tϟK1?' "(
oaˁj \S UYJOUt* N2\{HsqǨ|^~AoC?@3=`}c^WRE*ᐢ8wk
]40*v>'Ĥ9Hs:g\`o4jhT-ʲ`ccNؿ`v#>-oL$Sf|<8 vD1p>&ܨPQj~
~tB͗Y[.Bޮ\К. &I3J%r0(!EU;%wE_E\ ¤W.z(LM~ZsyƆsZ]Y7⅋{ztaWBqU8i_}W>+Ut띆59^)EС;{^t{=gfޣ{L3k3?;WW + %PIl@'c
)RVݝ<5 U2.ՅF4xBXP^B~]&cӝio
|-A!Υbf#&.Dީ6g9/}?_N)bK,Kl)EY2 ä[{].b%h Ș̄/8¦zcT# &01xKUW+
њ8*Fh42v/g~%CYyt(Fv=O SEj\5zG ƫx!61WZn|v̈́=$=:k_9RР3n:s |IM~L "uxOԆ2o]Ǭ߸IbUFAdvՔ9y}fmeA]1Ia눭{G6j+mۜǿ]<ȓ An,-kl8 ### @ ) G>ט|&*yیf q<řp`ɍ1tS<3y)2UGWN\'ί7lB l7_Ͽ瑲@ /[0U)>p}v /lNZE"> !`V4Pae;nk=.ʆCJ0co"R+AxTvt Jw* 3'
V^L5_a嘽jv9|?[hl;4V7w{|ѸpGdKs_;ﰱOېNa<̣Q
JpFo6J܉F+\c2:x aھr/ |gّ{Tu lT%VnVT%Micl~߰ F _ḩU5$ZO4aO0+/Sٷ$3ÈRU )זQSF$x(}fw#&/A/ x%]`3?{W~76HF}<DE3pD6IacQRkxo-V,g
1]=N$!|ƥ6-b 4
ʍ|J2>mۅ9;gq&7
GV-*)QUw a`$L-RdkˠO~$ŵ˶ODC ~{DBo XS
s @ 8O]'V]z.fS"S 9Ai!IJW)Pgg yEw$v1!2 ѸPncNDHR'xŪ4 "fw. Dw p_qz>
;lV
ۢ` 8[ݒ!oE mOʚ Ω0e^4wCםȫиXg.&TyϿ۹ċ?p\THgAdvflIxu QJH*DTzV;U/6h WX
XmKQ
]Tϥ=nx
I{~GKvw e}n YqDKI#9AɭuU5 ?N~}XsQ4I}~v?#jR[&Ndx!kOs ϾGoc UԱ6e
ߍ>/BQC.%nTxAX}LuWmjNxKm>M>^jq/T{CL۸;-@ /& }7l>c_c Gdoz{(o\C=7} @ ,0glvܟ/v>#~寡#-
;/s
Lj(N(sdj{3 ) J3[{+ߎ8/W߸*#L:-G~76 UJ (Mpz@4'Bq-s! B
gFGZ1R&~
UaB)s: {s㘡[8z.1Xɯq?H5jb;6[H{aqm6FF _enTJH3ep^b\DDu E>q uxȩsGL**M
9c
)ȋei7\e!AN?ˇS @ U{&&ط[w UE'7(W n̞} vd룻8Dz/-k7l )Hޏ9hswi2$m6lUdLJ+;fT2R Evјy5zcIeb"C^0,Ő(1t >eY0, E9q,M#o
}.@ fm5خm *6?NqMxuҰga7 xOx#>#Pp{ tؽ M֚f5$4Z[-gnf&JpFc jg]Jt p_ۗ62о_ @)Eijϧ+1Ra8(D@ &NVL'ɾ(4$nN(UTg:
Ðui.Z0ڡxe؎M o8Ƌ駣B"^7FMth4LMњ!L13;+1 /oxoW,6wbmT*>H
WG߽!UMzQaϋ!|pg\OK EQ*n)<uwP-Xm-G<ڵ`lp-g*W{Ze$} ]R:BV,j9TP0=w3ߵt"Z0Y\@ V6ԍ&iE{~]{v3=?Ϯ&tl t5"a
uAY}$0*Wط"#B= V {=>EaK ڍTkbxE1,Ѯ"(0n4Aw 8 4 Iݶ
R1TM3E+ zc'IJA',kP+f!5PuSx;\=>
{^D\_9)+q--tMМenq2p +WD\|=z9:J $C*ߜƬu?.ϭ᳟S1Éjt6,^KoϲT $hM)zJ)tj ~Pc@jE / $vo 9.5 Q[NOM iGfW_r0UR1[lYU9Q*?Ky[Y(`BAY "ʔf昿AۤS4ffiL-o,!Ơv/Flsb0-k
A\S$~t[S76D7d8 2
6B͘]mY)EHqK|aB D 9 6HaϛXj*$#(E4xn{qǘ& y /~5S^ڍG9C)3*q{ ܈hJST@7[V3E:5E65M6= cDfSBw5E^2 & {92u~RG6\MIMXƌ c> et{]ÁMBɕ Oɶ R0 6Ə %w
!@
Mρ &@<َJXqhLS] Q
qjgIM!_/h 8a}bTe6 V(V\X漈s ق"GB%)*k6!iuH[mVB@f+nTOcA'h >0Bi yIￗSgOpiVWWٸ`})% 2 FO`)ʂzoa>@iMd47R`}0ኄz
À*P69 ]S%b1۰<
2CՎ
9y?f^e~a]
?ťʔ%T0Yp@'T33hkyH
!Nۯ@7fl4[$&i@]ds @ H4P`O<3?7\_ً8]5J|-`Ĺ1ֱ7 6z=C
uq\SS:!]
2qa#njz֝p8蓑ǒv8i C:H2=m?|cNB|k/+ȋ!v
STR%)&[; GMTcorL }Թm{ E54р$E%u&* &kOߗ! l+OkR)Lә0?ĵ嫼{uΞ;͛ A)L H]"eNУ`0tqĽn 1p[- vP`
tVT&M ;W|z J Me֍Xlj|U[a$=[J@R̷Hچn %R&Z ?_}T ~btjB_#\=b+e?Fl[(rP)!#Q
-i Wqsl\##ιVKg !Uz乳͔(eKI0 @SG
i6vT&Kׂ_UB75?ѹsmRMI=ýbllݷrӌr} 'ы* {gfG r|8 Hĸ7;
/F.gCL˪T3FDD|;o'y%ߒύVSEiJŀi - MݠW:q9N~.ڵKXtE$~N)fkb&[5yR gNq_(q .,f# @^\j:m.Q >)cȎ d/ii\+;
X& - VL/4>Ó[O.[ߑpF9 xNҔW/Ʊg* yp~NWx !P5@9q7, y+)a͑h<:.e73m`n=CL7gHH4:_djjѭ 6nm;0 8`q%JMi c@ 4SXf\Z= Gڃjw0dVq}v?67<
)F{A* uȕK w}F)>c?ܛ/pc
eY4Պ%2W/1v},!"qđ 0 1U3IKg@i)iU\z5{w KO: } %&/j[a "B@Y`ӌ`t A)eꩍ昈FЈhF?$ 09BAc|
.|6 ɨ>R!B?d97ӝݏʼn>V[IT9 8=nE;M9' :ooBhZZ"
k#9A, `L\9NV Ar[D A I 2Lw0yCYO$*A)zt7tׇ}TM(7@<7>N8vDT} &mJܕRBc[;M ŹӋG<^y!c+o^ۯpe*6mҷ:~ZEq] ;;M pl\?gk4&_ Jrb^9LWKF\)z
k n
|Jmek8
8Ư00K5VX~W% yI yvC5m0I::|bkxW9/|<7.CCݹI#u@A>(+dd@9PЮ;;N 8lTu`[j j }U1OԳ>`1pEBu0μO) W; MXŨl!OgeOUJ9~3#],IC<ƕ\v6'1E)Dv_urnliP
%ytsVf:IH,unopcuWx n.]G3]~e;Ѩ?0&o&4N
1I Fcp+-Xf k{mf lHNGz^o s8?^ڵ ,k^M
K`5.g@1U問) <WN ҕ<d MS!F
Ro Pv/],v{XHT)JE0ϙnrx0)-!Qnpe2.yrFJc ' 6?Wh`s>h2 b$w꯰akRGot0*v>*KxU
f9:Zsq~O?+qu.*z^`šr!l^ UL ?)J| FVb< (8 @Qh C$F?-~]rz`79koc6Q !b5'Qg ށ[Q[:J -Q*n ޜK꿆e~o& P%i>&GPLQE5
2O~?TQ
qG PC q r
ZAwi;eP ~0g79lͷtRʦOjoy[oF>^
SonxH hi4YT@!ċt\x?Q>tC}1u 6C~h=W: T` ڵ~k75,߯\@wTbU8B*ees=~9{!j!/V&@ 4*wjB1~?35yl[f4ɛ`@q[Xf! !LA7d~.q"Ó/<+4* $ x!R~%Μ:a+L\-Q/8#1a%8<# yRa{'K|p}Ν~7ׇHA
[?>Ȫ$(vLw (3mǤ\)=Kx4w4l#[toZ)WxᅣvG5dAC8jbY p&ъ kW)$U, S4 9j i e:@Wvo"Hla%WnyDf@|ME ؆ l(_V?I|,R?:LaEkʂSQ^H?G5i\c Põ 0?3B_ْUɻL乯$A 0 $7ڋte FwVqjDa@ 2
U8rUEY%_"AϳnkWfѶ~ˣD侓L=
~5:nJ̉_| _kO(FYؽU-jJ @! P+|˫X:/ Ӌv%Ւقm&6?/SEb&jhѨiǾHq4~ݙV~P.svc$O"!b}
t{9:=}2 V懏ZDD7[sЭUnuFVG)G eıތY'#=b|
n
%~ǟ- ;To
O 6%]z4jvg(.pb<:a%oX?J}CLUC}ѨFY/X9.7RV0*Hv[O4,B8cM dRs 6mj+"f#{ޣ,Zi
[\9wpMliTU3K**,
O
y:Zur]x/P~囔GLE=3K_t7~W<WC09T5є@l6y8Yz|8B^oW|Ζ6Hfw-&)ZiQEb;쁛`M %E 9oOlnw
-XZ^bc[S)6tZiA9BQ ExSPagNlj'>ϟ0Zm9 7`Ô%G4[Ff[;4! 8Z D?j(M(4eR$蘦)NITub4Q |_ pP`qTSK]kT!Dx(WWϧ^r:IQדWt^Y'hIR$ T {P>60Imf AJri/)1 bqV!6f}}_K7Qޒ/
Ri5 .خU&NUn3G1VF Vhm;^K~ _
M_7q=NZI)aaiڨ++_
eڽ2l-8C76&M"W9.( e
͝K7я Y6z~p_e8C~;U5h t7
pPmULP$HJC{/(BuN/8TUtN(ظUwp{?އazNT4,gi1 p&}2]4nE;g '] 6XHtj e(G ʲM<@2 z "r!mw \쉠2۵W k?CH ʆ̖wHNXp D]YKSH3TAl;40:L3$ M 6r#"þkQr;%V1;{nBw"08/T )@TXcP4_NMc.fWvu l"O^ lF)Jh4ы{}0Lk*f!LLS* I1oz @qƅ@1(([ݭr٭!f
NQ:<Ls*8^UMHPMbHr>Eq=MH(r m1&4jf fwOHJH,FvnIiHҪgÀJ2$M9x
nBoM"`"4!MR벆(ttW |ƩHM&)YRU=D > 1KY!:Ga{:FƵ.Qs 0=_TChnO!k-Tnm2Yg
)rTHhVE5y/3pq!5ɸ"ΎF U׀ַJ~$"di㏓e5yԿ0Bލ|IEL^syԳDiL}ɕrɞ|}~Q {ܸk @+EJL[F_̟5%$V2~lP6&iI:i*QZl re3D)v-yI{xp4=@> }&{{KeeucZП w ϱGsAEbvv@5F+4КB ۠<>C,yD HYAr<Q%ceF Z-t
"iHZmfP~FL$UQP
FhZ|幯D" ?cj5ЀߏT}U!Xp!,/ߠݨ3?]'gCk~ޫPUyn,:" }ɇ_[߁ wPw`k$Cb}h-M4$&I0\sՀPJIQ t VjlFy쾊>_Pvf(y
^hIEX7eI'χc&̈Ez7x\]i! ?õYc*-q?tji
V E( _B+[淡] h6DeM4Ag:M-.@k[4R6b7%BB=[*+iN%2SPc¹R4Z+$%MR4%l,zmVFvA CMpW |jHU W1# Do
WIڞfai P&9,1er
&X 淂D9 od$
JkRʈ`1%Zic{v|>c>z2R{s aK'IB IRpOAa-áP[_G)Ah,Dd=]i LJW~;/ c,OyY d H!E)
pxwmX?M4,C'5
564$lpj|iLa7nFnVWW]];.xOXySMh&S@k=Sb֚4M(˒nw,kNH Ɉ0;Wmy
S$"SHYVG|mQ\%(S?y]YC`yy:{S< >tsNN8zfKl4M#"hhd0->I5t76X^YA)a[J'=@Wlm_J<*s, Rvbb ē
wt$SｚVsYi53]F7\rme߁_=JÏp(ϟ-'նW@e
2|$-$~e
]6M&,^4n7W}DN^t *O :Y4>QQ 㵩}^q?3FF&c0fɱwEQsҵk_8s~|
K}Z#s|vޕWHf ӷ}ԒD)Is&d,kͫTiGJ]h4|ȕ^c [w }_wΖRʔEC)eђlHYf"&"A|(Q2Pi!4 ]MVO 0h>Z eJ5qm+kw:3/Sf
._ӬPW\ gY c$h o.-~1ԠvNAf⛐:IS[^pzϲf+++\t` ZcNO D*iuYt72`p 8 ؗR)
U Ùٙɧ gOvկ/<̌uSacf_^k8 qkݗ ]7,E@u UVcz\fDe3UQ1(X^KY[_yݗ_zr
lW% + ''=3>
c ;fgbܒNʍٹɧxx~6zig}耉
G(6D%Gb >ȞD#7M:jlF cBgɲd0 ̍KySg79(6w%/ R
?enPhS ;=9
`iClxԈLu4 50i&Mmv由
&GvØcU&_)ɵ>OOU3M| wWS,OsX! X_c=Cl
Twjc 9ჿH[)ƾ!>JE1fe0{sOΜ>(XƏ2>K@Bt60Mk>v 5
K*ۨRPJ\-GOQU]XIqS y [0w#E]d@m%| $'sPU
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include
#include "pgmodelercliapp.h"
#include "qtcompat/qtextstreamcompat.h"
int main(int argc, char **argv)
{
QTextStream out(stdout);
#ifdef DEMO_VERSION
out << QtCompat::endl;
out << QString("pgModeler ") << GlobalAttributes::PgModelerVersion << QT_TR_NOOP(" command line interface.") << QtCompat::endl;
out << QT_TR_NOOP("PostgreSQL Database Modeler Project - pgmodeler.io") << QtCompat::endl;
out << QT_TR_NOOP("Copyright 2006-2020 Raphael A. Silva ") << QtCompat::endl;
out << QT_TR_NOOP("\n** CLI disabled in demonstration version! **") << QtCompat::endl << QtCompat::endl;
#else
try
{
#ifdef Q_OS_LINUX
/* Workaround to make the CLI work on Linux systems without graphical interface.
* Details at https://github.com/pgmodeler/pgmodeler/issues/1604 */
qputenv("QT_QPA_PLATFORM", "offscreen");
#endif
PgModelerCliApp pgmodeler_cli(argc, argv);
QTranslator translator(&pgmodeler_cli);
//Tries to load the ui translation according to the system's locale
translator.load(QLocale::system().name(), GlobalAttributes::getLanguagesDir());
//Installs the translator on the application
pgmodeler_cli.installTranslator(&translator);
//Executes the cli
return pgmodeler_cli.exec();
}
catch(Exception &e)
{
out << QtCompat::endl;
out << e.getExceptionsText();
out << QString("** pgmodeler-cli aborted due to critical error(s). **") << QtCompat::endl << QtCompat::endl;
return (e.getErrorCode()==ErrorCode::Custom ? -1 : enum_cast(e.getErrorCode()));
}
#endif
}
pgmodeler-0.9.4/apps/pgmodeler-cli/src/pgmodelercliapp.cpp 0000664 0000000 0000000 00000265611 14160100006 0023631 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "pgmodelercliapp.h"
#include "qtcompat/qtextstreamcompat.h"
#include "qtcompat/splitbehaviorcompat.h"
#include "utilsns.h"
QTextStream PgModelerCliApp::out(stdout);
const QRegExp PgModelerCliApp::PasswordRegExp=QRegExp("(password)(=)(.)*( )");
const QString PgModelerCliApp::PasswordPlaceholder("password=******");
const QString PgModelerCliApp::AllChildren("all");
const QString PgModelerCliApp::Input("--input");
const QString PgModelerCliApp::Output("--output");
const QString PgModelerCliApp::InputDb("--input-db");
const QString PgModelerCliApp::ExportToFile("--export-to-file");
const QString PgModelerCliApp::ExportToPng("--export-to-png");
const QString PgModelerCliApp::ExportToSvg("--export-to-svg");
const QString PgModelerCliApp::ExportToDbms("--export-to-dbms");
const QString PgModelerCliApp::ExportToDict("--export-to-dict");
const QString PgModelerCliApp::ImportDb("--import-db");
const QString PgModelerCliApp::NoIndex("--no-index");
const QString PgModelerCliApp::Split("--split");
const QString PgModelerCliApp::Diff("--diff");
const QString PgModelerCliApp::DropDatabase("--drop-database");
const QString PgModelerCliApp::DropObjects("--drop-objects");
const QString PgModelerCliApp::PgSqlVer("--pgsql-ver");
const QString PgModelerCliApp::Help("--help");
const QString PgModelerCliApp::ShowGrid("--show-grid");
const QString PgModelerCliApp::ShowDelimiters("--show-delimiters");
const QString PgModelerCliApp::PageByPage("--page-by-page");
const QString PgModelerCliApp::IgnoreDuplicates("--ignore-duplicates");
const QString PgModelerCliApp::IgnoreErrorCodes("--ignore-error-codes");
const QString PgModelerCliApp::ConnAlias("--conn-alias");
const QString PgModelerCliApp::Host("--host");
const QString PgModelerCliApp::Port("--port");
const QString PgModelerCliApp::User("--user");
const QString PgModelerCliApp::Passwd("--passwd");
const QString PgModelerCliApp::InitialDb("--initial-db");
const QString PgModelerCliApp::Silent("--silent");
const QString PgModelerCliApp::ListConns("--list-conns");
const QString PgModelerCliApp::Simulate("--simulate");
const QString PgModelerCliApp::FixModel("--fix-model");
const QString PgModelerCliApp::FixTries("--fix-tries");
const QString PgModelerCliApp::ZoomFactor("--zoom");
const QString PgModelerCliApp::UseTmpNames("--use-tmp-names");
const QString PgModelerCliApp::DbmMimeType("--dbm-mime-type");
const QString PgModelerCliApp::Install("install");
const QString PgModelerCliApp::Uninstall("uninstall");
const QString PgModelerCliApp::SystemWide("--system-wide");
const QString PgModelerCliApp::IgnoreImportErrors("--ignore-errors");
const QString PgModelerCliApp::ImportSystemObjs("--import-sys-objs");
const QString PgModelerCliApp::ImportExtensionObjs("--import-ext-objs");
const QString PgModelerCliApp::DebugMode("--debug-mode");
const QString PgModelerCliApp::FilterObjects("--filter-objects");
const QString PgModelerCliApp::MatchByName("--match-by-name");
const QString PgModelerCliApp::ForceChildren("--force-children");
const QString PgModelerCliApp::OnlyMatching("--only-matching");
const QString PgModelerCliApp::PartialDiff("--partial");
const QString PgModelerCliApp::Force("--force");
const QString PgModelerCliApp::StartDate("--start-date");
const QString PgModelerCliApp::EndDate("--end-date");
const QString PgModelerCliApp::CompareTo("--compare-to");
const QString PgModelerCliApp::SaveDiff("--save");
const QString PgModelerCliApp::ApplyDiff("--apply");
const QString PgModelerCliApp::NoDiffPreview("--no-preview");
const QString PgModelerCliApp::DropClusterObjs("--drop-cluster-objs");
const QString PgModelerCliApp::RevokePermissions("--revoke-perms");
const QString PgModelerCliApp::DropMissingObjs("--drop-missing");
const QString PgModelerCliApp::ForceDropColsConstrs("--force-drop-cols");
const QString PgModelerCliApp::RenameDb("--rename-db");
const QString PgModelerCliApp::NoSequenceReuse("--no-sequence-reuse");
const QString PgModelerCliApp::NoCascadeDrop("--no-cascade");
const QString PgModelerCliApp::ForceRecreateObjs("--force-recreate-objs");
const QString PgModelerCliApp::OnlyUnmodifiable("--only-unmodifiable");
const QString PgModelerCliApp::CreateConfigs("--create-configs");
const QString PgModelerCliApp::MissingOnly("--missing-only");
const QString PgModelerCliApp::TagExpr("<%1");
const QString PgModelerCliApp::EndTagExpr(" PgModelerCliApp::long_opts = {
{ Input, true }, { Output, true }, { InputDb, true },
{ ExportToFile, false }, { ExportToPng, false }, { ExportToSvg, false },
{ ExportToDbms, false }, { ImportDb, false }, { Diff, false },
{ DropDatabase, false }, { DropObjects, false }, { PgSqlVer, true },
{ Help, false }, { ShowGrid, false }, { ShowDelimiters, false },
{ PageByPage, false }, { IgnoreDuplicates, false }, { IgnoreErrorCodes, true },
{ ConnAlias, true }, { Host, true }, { Port, true },
{ User, true }, { Passwd, true }, { InitialDb, true },
{ ListConns, false }, { Simulate, false }, { FixModel, false },
{ FixTries, true }, { ZoomFactor, true }, { UseTmpNames, false },
{ DbmMimeType, true }, { IgnoreImportErrors, false }, { ImportSystemObjs, false },
{ ImportExtensionObjs, false }, { FilterObjects, true }, { ForceChildren, true },
{ OnlyMatching, false }, { MatchByName, false }, { DebugMode, false },
{ PartialDiff, false }, { StartDate, true }, { EndDate, true },
{ CompareTo, true }, { SaveDiff, false }, { ApplyDiff, false },
{ NoDiffPreview, false }, { DropClusterObjs, false }, { RevokePermissions, false },
{ DropMissingObjs, false }, { ForceDropColsConstrs, false }, { RenameDb, false },
{ NoSequenceReuse, false }, { NoCascadeDrop, false },
{ ForceRecreateObjs, false }, { OnlyUnmodifiable, false }, { ExportToDict, false },
{ NoIndex, false }, { Split, false }, { SystemWide, false },
{ CreateConfigs, false }, { Force, false }, { MissingOnly, false }
};
map PgModelerCliApp::accepted_opts = {
{{ Attributes::Connection }, { ConnAlias, Host, Port, User, Passwd, InitialDb }},
{{ ExportToFile }, { Input, Output, PgSqlVer, Split }},
{{ ExportToPng }, { Input, Output, ShowGrid, ShowDelimiters, PageByPage, ZoomFactor }},
{{ ExportToSvg }, { Input, Output, ShowGrid, ShowDelimiters }},
{{ ExportToDict }, { Input, Output, Split, NoIndex }},
{{ ExportToDbms }, { Input, PgSqlVer, IgnoreDuplicates, IgnoreErrorCodes,
DropDatabase, DropObjects, Simulate, UseTmpNames }},
{{ ImportDb }, { InputDb, Output, IgnoreImportErrors, ImportSystemObjs, ImportExtensionObjs,
FilterObjects, OnlyMatching, MatchByName, ForceChildren, DebugMode, ConnAlias,
Host, Port, User, Passwd, InitialDb }},
{{ Diff }, { Input, PgSqlVer, IgnoreDuplicates, IgnoreErrorCodes, CompareTo, PartialDiff, Force,
StartDate, EndDate, SaveDiff, ApplyDiff, NoDiffPreview, DropClusterObjs, RevokePermissions,
DropMissingObjs, ForceDropColsConstrs, RenameDb, NoCascadeDrop,
NoSequenceReuse, ForceRecreateObjs, OnlyUnmodifiable }},
{{ DbmMimeType }, { SystemWide, Force }},
{{ FixModel }, { Input, Output, FixTries }},
{{ ListConns }, {}},
{{ CreateConfigs }, {MissingOnly, Force}}
};
PgModelerCliApp::PgModelerCliApp(int argc, char **argv) : Application(argc, argv)
{
try
{
QString op, value, orig_op;
bool accepts_val=false;
attribs_map opts;
QStringList args = arguments();
model=nullptr;
scene=nullptr;
xmlparser=nullptr;
zoom=1;
export_hlp = nullptr;
import_hlp = nullptr;
diff_hlp = nullptr;
conn_conf = nullptr;
rel_conf = nullptr;
general_conf = nullptr;
// We extract the options values only if the help option is not present
if(args.size() > 1 && !args.contains(Help) && !args.contains(short_opts[Help]))
{
for(int i=1; i < argc; i++)
{
op = orig_op = argv[i];
//If the retrieved option starts with - it will be treated as a command option
if(op[0]=='-')
{
value.clear();
if(i < argc-1 && argv[i+1][0]!='-')
{
//If the next option does not starts with '-', is considered a value
value=argv[++i];
}
//Raises an error if the option is not recognized
if(!isOptionRecognized(op, accepts_val))
throw Exception(tr("Unrecognized option `%1'.").arg(orig_op), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
//Raises an error if the value is empty and the option accepts a value
if(accepts_val && value.isEmpty())
throw Exception(tr("Value not specified for option `%1'.").arg(orig_op), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
else if(!accepts_val && !value.isEmpty())
throw Exception(tr("Option `%1' does not accept values.").arg(orig_op), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
/* If we find a filter object parameter we append its parameter index so
* its value is not replaced by the next filter parameter found */
if(op == FilterObjects)
opts[QString("%1%2").arg(op).arg(i)] = value;
opts[op] = value;
}
}
}
//Validates and executes the options
parseOptions(opts);
if(!parsed_opts.empty())
{
model=new DatabaseModel;
xmlparser=model->getXMLParser();
silent_mode=(parsed_opts.count(Silent));
//If the export is to png or svg loads additional configurations
if(parsed_opts.count(ExportToPng) || parsed_opts.count(ExportToSvg) || parsed_opts.count(ImportDb))
{
connect(model, SIGNAL(s_objectAdded(BaseObject *)), this, SLOT(handleObjectAddition(BaseObject *)));
connect(model, SIGNAL(s_objectRemoved(BaseObject *)), this, SLOT(handleObjectRemoval(BaseObject *)));
//Creates a scene to
scene=new ObjectsScene;
scene->setParent(this);
scene->setSceneRect(QRectF(0,0,2000,2000));
//Load the general configuration including grid and delimiter options
GeneralConfigWidget conf_wgt;
conf_wgt.loadConfiguration();
//Load the objects styles
BaseObjectView::loadObjectsStyle();
}
if(parsed_opts.count(ExportToDbms) || parsed_opts.count(ImportDb) || parsed_opts.count(Diff))
{
configureConnection(false);
//Replacing the initial db parameter for the input database when reverse engineering
if((parsed_opts.count(ImportDb) || parsed_opts.count(Diff)) && !parsed_opts[InputDb].isEmpty())
connection.setConnectionParam(Connection::ParamDbName, parsed_opts[InputDb]);
}
if(parsed_opts.count(Diff))
{
configureConnection(true);
if(!extra_connection.isConfigured())
extra_connection = connection;
extra_connection.setConnectionParam(Connection::ParamDbName, parsed_opts[CompareTo]);
}
if(!silent_mode && export_hlp && import_hlp && diff_hlp)
{
connect(export_hlp, SIGNAL(s_progressUpdated(int,QString)), this, SLOT(updateProgress(int,QString)));
connect(export_hlp, SIGNAL(s_errorIgnored(QString,QString,QString)), this, SLOT(printIgnoredError(QString,QString,QString)));
connect(import_hlp, SIGNAL(s_progressUpdated(int,QString,ObjectType)), this, SLOT(updateProgress(int,QString)));
connect(diff_hlp, SIGNAL(s_progressUpdated(int,QString,ObjectType)), this, SLOT(updateProgress(int,QString)));
}
}
}
catch(Exception &e)
{
throw e;
}
}
PgModelerCliApp::~PgModelerCliApp()
{
if(scene)
delete scene;
delete model;
if(export_hlp)
delete export_hlp;
if(import_hlp)
delete import_hlp;
if(diff_hlp)
delete diff_hlp;
if(conn_conf)
delete conn_conf;
if(rel_conf)
delete rel_conf;
if(general_conf)
delete general_conf;
}
void PgModelerCliApp::printText(const QString &txt)
{
out << txt << QtCompat::endl;
}
void PgModelerCliApp::printMessage(const QString &txt)
{
if(!silent_mode)
printText(txt);
}
void PgModelerCliApp::configureConnection(bool extra_conn)
{
QString chr = (extra_conn ? "1" : "");
Connection *conn = (extra_conn ? &extra_connection : &connection);
//Getting the connection using its alias
if(parsed_opts.count(ConnAlias + chr))
{
if(!connections.count(parsed_opts[ConnAlias + chr]))
throw Exception(tr("Connection aliased as '%1' was not found in the configuration file.").arg(parsed_opts[ConnAlias + chr]),
ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
//Make a copy of the named connection
*conn = (*connections[parsed_opts[ConnAlias + chr]]);
}
else
{
conn->setConnectionParam(Connection::ParamServerFqdn, parsed_opts[Host + chr]);
conn->setConnectionParam(Connection::ParamUser, parsed_opts[User + chr]);
conn->setConnectionParam(Connection::ParamPort, parsed_opts[Port + chr]);
conn->setConnectionParam(Connection::ParamPassword, parsed_opts[Passwd + chr]);
conn->setConnectionParam(Connection::ParamDbName, parsed_opts[InitialDb + chr]);
}
}
bool PgModelerCliApp::isOptionRecognized(QString &op, bool &accepts_val)
{
bool found=false, append_chr = false;
if(op.endsWith('1'))
{
op.chop(1);
append_chr = true;
}
for(auto &itr : short_opts)
{
found=(op==itr.first || op==itr.second);
accepts_val=(found && long_opts[itr.first]);
if(found)
{
op = itr.first;
break;
}
}
if(append_chr) op += '1';
return found;
}
void PgModelerCliApp::showVersionInfo()
{
printMessage();
printMessage(tr("pgModeler command line interface.") );
printMessage(tr("Version ") + GlobalAttributes::PgModelerVersion + QString(" - %1 Qt %2").arg(GlobalAttributes::PgModelerBuildNumber).arg(QT_VERSION_STR));
printMessage(tr("PostgreSQL Database Modeler Project - pgmodeler.io") );
printMessage(tr("Copyright 2006-%1 Raphael Araújo e Silva ").arg(QDate::currentDate().year()));
printMessage();
}
void PgModelerCliApp::showMenu()
{
showVersionInfo();
printText(tr("Usage: pgmodeler-cli [OPTIONS]"));
printText(tr("This CLI tool provides several operations over models and databases without the need to perform them\nin pgModeler's graphical interface. All available options are described below."));
printText();
printText(tr("Operation mode options: "));
printText(tr(" %1, %2\t\t Export the input model to sql script file(s).").arg(short_opts[ExportToFile]).arg(ExportToFile));
printText(tr(" %1, %2\t\t Export the input model to a png image.").arg(short_opts[ExportToPng]).arg(ExportToPng) );
printText(tr(" %1, %2\t\t Export the input model to a svg file.").arg(short_opts[ExportToSvg]).arg(ExportToSvg) );
printText(tr(" %1, %2\t\t Export the input model to a data directory in HTML format.").arg(short_opts[ExportToDict]).arg(ExportToDict));
printText(tr(" %1, %2\t\t Export the input model directly to a PostgreSQL server.").arg(short_opts[ExportToDbms]).arg(ExportToDbms));
printText(tr(" %1, %2\t\t List available connections in file %3.").arg(short_opts[ListConns]).arg(ListConns).arg(GlobalAttributes::ConnectionsConf + GlobalAttributes::ConfigurationExt));
printText(tr(" %1, %2\t\t Import a database to an output file.").arg(short_opts[ImportDb]).arg(ImportDb));
printText(tr(" %1, %2\t\t\t Compares a model and a database or two databases generating the SQL script to sync the latter in relation to the first.").arg(short_opts[Diff]).arg(Diff));
printText(tr(" %1, %2\t\t Try to fix the structure of the input model file in order to make it loadable again.").arg(short_opts[FixModel]).arg(FixModel));
printText(tr(" %1, %2\t\t Create the pgModeler's configuration folder and files in the user's local storage.").arg(short_opts[CreateConfigs]).arg(CreateConfigs));
#ifndef Q_OS_MAC
printText(tr(" %1, %2 [ACTION]\t Handles the file association to .dbm files. The ACTION can be [%3 | %4].").arg(short_opts[DbmMimeType]).arg(DbmMimeType).arg(Install).arg(Uninstall));
#endif
printText(tr(" %1, %2\t\t\t Show this help menu.").arg(short_opts[Help]).arg(Help));
printText();
printText(tr("General options: "));
printText(tr(" %1, %2 [FILE]\t\t Input model file (.dbm). This is mandatory for export and fix operations.").arg(short_opts[Input]).arg(Input));
printText(tr(" %1, %2 [DBNAME]\t Input database name. This is mandatory for import operation.").arg(short_opts[InputDb]).arg(InputDb));
printText(tr(" %1, %2 [FILE|DIRECTORY] Output file or directory. This is mandatory for fixing model or exporting to file, png or svg.").arg(short_opts[Output]).arg(Output));
printText(tr(" %1, %2\t\t Force the PostgreSQL syntax to the specified version when generating SQL code. The version string must be in form major.minor.").arg(short_opts[PgSqlVer]).arg(PgSqlVer));
printText(tr(" %1, %2\t\t\t Silent execution. Only critical messages and errors are shown during process.").arg(short_opts[Silent]).arg(Silent));
printText();
printText(tr("SQL file export options: "));
printText(tr(" %1, %2\t\t\t The SQL file is generated per object. The files will be named in such a way to reflect the correct creation order of the objects.").arg(short_opts[Split]).arg(Split));
printText();
printText(tr("PNG and SVG export options: "));
printText(tr(" %1, %2\t\t Draws the grid in the exported image.").arg(short_opts[ShowGrid]).arg(ShowGrid));
printText(tr(" %1, %2\t Draws the page delimiters in the exported image.").arg(short_opts[ShowDelimiters]).arg(ShowDelimiters));
printText(tr(" %1, %2\t\t Each page will be exported in a separated png image. (Only for PNG images)").arg(short_opts[PageByPage]).arg(PageByPage));
printText(tr(" %1, %2 [FACTOR]\t\t Applies a zoom (in percent) before export to png image. Accepted zoom interval: %3-%4 (Only for PNG images)").arg(short_opts[ZoomFactor]).arg(ZoomFactor).arg(ModelWidget::MinimumZoom*100).arg(ModelWidget::MaximumZoom*100));
printText();
printText(tr("Data dictionary export options: "));
printText(tr(" %1, %2\t\t\t The data dictionaries are generated in separated files inside the selected output directory.").arg(short_opts[Split]).arg(Split));
printText(tr(" %1, %2\t\t Avoids the generation of the index that is used to help navigating through the data dictionary.").arg(short_opts[NoIndex]).arg(NoIndex));
printText();
printText(tr("Connection options: "));
printText(tr(" %1, %2 [ALIAS]\t Connection configuration alias to be used.").arg(short_opts[ConnAlias]).arg(ConnAlias));
printText(tr(" %1, %2 [HOST]\t\t PostgreSQL host in which a task will operate.").arg(short_opts[Host]).arg(Host));
printText(tr(" %1, %2 [PORT]\t\t PostgreSQL host listening port.").arg(short_opts[Port]).arg(Port));
printText(tr(" %1, %2 [USER]\t\t PostgreSQL username.").arg(short_opts[User]).arg(User));
printText(tr(" %1, %2 [PASSWORD]\t PostgreSQL user password.").arg(short_opts[Passwd]).arg(Passwd));
printText(tr(" %1, %2 [DBNAME]\t Connection's initial database.").arg(short_opts[InitialDb]).arg(InitialDb));
printText();
printText(tr("DBMS export options: "));
printText(tr(" %1, %2\t Ignores errors related to duplicated objects that eventually exist in the server.").arg(short_opts[IgnoreDuplicates]).arg(IgnoreDuplicates));
printText(tr(" %1, %2 [CODES] Ignores additional errors by their codes. A comma-separated list of alphanumeric codes should be provided.").arg(short_opts[IgnoreErrorCodes]).arg(IgnoreErrorCodes));
printText(tr(" %1, %2\t\t Drop the database before execute a export process.").arg(short_opts[DropDatabase]).arg(DropDatabase));
printText(tr(" %1, %2\t\t Runs the DROP commands attached to SQL-enabled objects.").arg(short_opts[DropObjects]).arg(DropObjects));
printText(tr(" %1, %2\t\t Simulates an export process by executing all steps but undoing any modification in the end.").arg(short_opts[Simulate]).arg(Simulate));
printText(tr(" %1, %2\t\t Generates temporary names for database, roles and tablespaces when in simulation mode.").arg(short_opts[UseTmpNames]).arg(UseTmpNames));
printText();
printText(tr("Database import options: "));
printText(tr(" %1, %2\t\t Ignore all errors and try to create as many as possible objects.").arg(short_opts[IgnoreImportErrors]).arg(IgnoreImportErrors));
printText(tr(" %1, %2\t Import system built-in objects. This option causes the model bloating due to the importing of unneeded objects.").arg(short_opts[ImportSystemObjs]).arg(ImportSystemObjs));
printText(tr(" %1, %2\t Import extension objects. This option causes the model bloating due to the importing of unneeded objects.").arg(short_opts[ImportExtensionObjs]).arg(ImportExtensionObjs));
printText(tr(" %1, %2 [FILTER] Causes the import process to import only those objects matching the filter(s). The FILTER should be in the form type:pattern:mode.").arg(short_opts[FilterObjects]).arg(FilterObjects));
printText(tr(" %1, %2\t\t Causes only objects matching the provided filter(s) to be imported. Those not matching filter(s) are discarded.").arg(short_opts[OnlyMatching]).arg(OnlyMatching));
printText(tr(" %1, %2\t\t Causes the objects matching to be performed over their names instead of their signature ([schema].[name]).").arg(short_opts[MatchByName]).arg(MatchByName));
printText(tr(" %1, %2 [OBJECTS] Forces the importing of children objects related to tables/views/foreign tables matched by the filter(s). The OBJECTS is a comma separated list types.").arg(short_opts[ForceChildren]).arg(ForceChildren));
printText(tr(" %1, %2\t\t Run import in debug mode printing all queries executed in the server.").arg(short_opts[DebugMode]).arg(DebugMode));
printText();
printText(tr("Diff options: "));
printText(tr(" %1, %2 [DBNAME]\t The database used in the comparison. All the SQL code generated is applied to it.").arg(short_opts[CompareTo]).arg(CompareTo));
printText(tr(" %1, %2\t\t Toggles the partial diff operation. A set of objects filters should be provided using the import option %3.").arg(short_opts[PartialDiff]).arg(PartialDiff).arg(FilterObjects));
printText(tr(" %1, %2\t\t\t Forces a full diff if the provided filters were not able to retrieve objects for a partial diff operation.").arg(short_opts[Force]).arg(Force));
printText(tr(" %1, %2\t\t Matches all database model objects in which modification date starts in the specified date. (Only for partial diff)").arg(short_opts[StartDate]).arg(StartDate));
printText(tr(" %1, %2\t\t Matches all database model objects in which modification date ends in the specified date. (Only for partial diff)").arg(short_opts[EndDate]).arg(EndDate));
printText(tr(" %1, %2\t\t\t Save the generated diff code to output file.").arg(short_opts[SaveDiff]).arg(SaveDiff));
printText(tr(" %1, %2\t\t\t Apply the generated diff code on the database server.").arg(short_opts[ApplyDiff]).arg(ApplyDiff));
printText(tr(" %1, %2\t\t Don't preview the generated diff code when applying it to the server.").arg(short_opts[NoDiffPreview]).arg(NoDiffPreview));
printText(tr(" %1, %2\t Drop cluster level objects like roles and tablespaces.").arg(short_opts[DropClusterObjs]).arg(DropClusterObjs));
printText(tr(" %1, %2\t\t Revoke permissions already set on the database. New permissions configured in the input model are still applied.").arg(short_opts[RevokePermissions]).arg(RevokePermissions));
printText(tr(" %1, %2\t\t Drop missing objects. Generates DROP commands for objects that are present in the input model but not in the compared database.").arg(short_opts[DropMissingObjs]).arg(DropMissingObjs));
printText(tr(" %1, %2\t Force the drop of missing columns and constraints. Causes only columns and constraints to be dropped, other missing objects aren't removed.").arg(short_opts[ForceDropColsConstrs]).arg(ForceDropColsConstrs));
printText(tr(" %1, %2\t\t Rename the destination database when the names of the involved databases are different.").arg(short_opts[RenameDb]).arg(RenameDb));
printText(tr(" %1, %2\t\t Don't drop objects in cascade mode.").arg(short_opts[NoCascadeDrop]).arg(NoCascadeDrop));
printText(tr(" %1, %2\t Don't reuse sequences on serial columns. Drop the old sequence assigned to a serial column and creates a new one.").arg(short_opts[NoSequenceReuse]).arg(NoSequenceReuse));
printText(tr(" %1, %2\t Force the recreating of objects. Instead of an ALTER command a DROP and CREATE commands are used to create a new version of the objects.").arg(short_opts[ForceRecreateObjs]).arg(ForceRecreateObjs));
printText(tr(" %1, %2\t Recreate only the unmodifiable objects. These objects are the ones which can't be changed via ALTER command.").arg(short_opts[OnlyUnmodifiable]).arg(OnlyUnmodifiable));
printText();
printText(tr("Model fix options: ") );
printText(tr(" %1, %2 [NUMBER]\t Model fix tries. When reaching the maximum count the invalid objects will be discarded.").arg(short_opts[FixTries]).arg(FixTries));
printText();
#ifndef Q_OS_MAC
printText(tr("File association options: "));
printText(tr(" %1, %2\t\t The file association to .dbm files will be applied in a system wide level instead of to the current user.").arg(short_opts[SystemWide]).arg(SystemWide));
printText(tr(" %1, %2 \t\t\t Forces the mime type install or uninstall. ").arg(short_opts[Force]).arg(Force));
printText();
#endif
printText(tr("Config files creation options: "));
printText(tr(" %1, %2 \t\t Copy only missing configuration files to the user's local storage.").arg(short_opts[MissingOnly]).arg(MissingOnly));
printText(tr(" %1, %2 \t\t\t Forces the recreation of all configuration files. This option implies the backup of the current settings.").arg(short_opts[Force]).arg(Force));
printText();
printText();
printText(tr("** The FILTER value in %1 option has the form type:pattern:mode. ").arg(FilterObjects));
printText(tr(" * The `type' is the type of object to be filtered and accepts the following values (invalid types ignored): "));
QStringList list;
QString child_list;
for(auto &type : BaseObject::getChildObjectTypes(ObjectType::Table))
{
if(type == ObjectType::Column)
continue;
list.append(BaseObject::getSchemaName(type));
}
list.sort();
child_list = list.join(", ");
QStringList fmt_types, lines, type_list = Catalog::getFilterableObjectNames();
int i = 0;
for(auto &type : type_list)
{
fmt_types.append(type);
i++;
if(i % 8 == 0 || i == type_list.size() - 1)
{
lines.append(QString(" > ") + fmt_types.join(", "));
fmt_types.clear();
}
}
printText(lines.join('\n'));
printText();
printText(tr(" * The `pattern' is the text pattern which is matched against the objects names."));
printText();
printText(tr(" * The `mode' is the way the pattern is matched. This one accepts two values: "));
printText(tr(" > `%1' causes the pattern to be used as a wildcard string while matching objects names.").arg(UtilsNs::FilterWildcard));
printText(tr(" > `%1' causes the pattern to be treated as a POSIX regular expression while matching objects names.").arg(UtilsNs::FilterRegExp));
printText();
printText(tr(" * The option %1 has effect only when used with %2 and will avoid discarding children of matched tables.").arg(ForceChildren).arg(OnlyMatching));
printText(tr(" Other tables eventually imported which are dependencies of the matched objects will have their children discarded."));
printText(tr(" The comma separated list of table children objects accepts the values:"));
printText(tr(" > %1").arg(child_list) );
printText(tr(" > Use the special keyword `%1' to force all children objects.").arg(AllChildren) );
printText();
printText(tr(" * NOTES: all comparisons during filtering process are case insensitive."));
printText(tr(" Using the filtering options may cause the importing of additional objects due to the automatic dependency resolution."));
printText();
printText(tr("** The diff process allows the usage all options related to the import operation."));
printText(tr(" It also accepts the following export operation options: `%1', `%2'").arg(IgnoreDuplicates).arg(IgnoreErrorCodes));
printText();
printText(tr("** The partial diff operation will always force the options %1 and %2 = %3 for more reliable results.").arg(OnlyMatching).arg(ForceChildren).arg(AllChildren));
printText(tr(" * The options %1 and %2 accepts the ISO8601 date/time format: yyyy-MM-dd hh:mm:ss").arg(StartDate).arg(EndDate));
printText();
printText(tr("** When running the diff using two databases (%1 and %2) there's the option to specify two separated connections/aliases.").arg(InputDb).arg(CompareTo));
printText(tr(" If only one connection is set then it will be used to import the input database as well to retrieve the database used in the comparison."));
printText(tr(" A second connection can be specified by appending a 1 to any connection configuration parameter listed above."));
printText(tr(" This causes the connection to be associated to %1 exclusively.").arg(CompareTo));
printText();
}
void PgModelerCliApp::listConnections()
{
map::iterator itr=connections.begin();
if(connections.empty())
printText(tr("There are no connections configured."));
else
{
unsigned id=0;
printText(tr("Available connections (alias : connection string)"));
while(itr != connections.end())
{
printText(QString("[") + QString::number(id++) + QString("] ") + itr->first + QString(" : ") +
itr->second->getConnectionString().replace(PasswordRegExp, PasswordPlaceholder));
itr++;
}
printText();
}
}
void PgModelerCliApp::parseOptions(attribs_map &opts)
{
//Loading connections
if(opts.count(ListConns) || opts.count(ExportToDbms) || opts.count(ImportDb) || opts.count(Diff))
{
conn_conf = new ConnectionsConfigWidget;
conn_conf->loadConfiguration();
conn_conf->getConnections(connections, false);
}
//Loading general and relationship settings when exporting to image formats
else if(opts.count(ExportToPng) || opts.count(ExportToSvg))
{
general_conf = new GeneralConfigWidget;
rel_conf = new RelationshipConfigWidget;
general_conf->loadConfiguration();
rel_conf->loadConfiguration();
}
//Creating the export/import/diff helpers when one of the operations are specified
if(opts.count(ExportToDbms) || opts.count(ExportToFile) ||
opts.count(ExportToPng) || opts.count(ExportToSvg) ||
opts.count(ExportToDict) || opts.count(ImportDb) ||
opts.count(Diff))
{
export_hlp = new ModelExportHelper;
import_hlp = new DatabaseImportHelper;
diff_hlp = new ModelsDiffHelper;
}
if(opts.empty() || opts.count(Help))
showMenu();
else
{
QString curr_op_mode;
int exp_mode_cnt = 0, other_modes_cnt = 0;
bool fix_model = (opts.count(FixModel) > 0),
upd_mime = (opts.count(DbmMimeType) > 0),
import_db = (opts.count(ImportDb) > 0),
diff = (opts.count(Diff) > 0),
create_configs= (opts.count(CreateConfigs) > 0),
list_conns = (opts.count(ListConns) > 0),
export_dbms = (opts.count(ExportToDbms) > 0);
for(auto &itr : accepted_opts)
{
if(itr.first == Attributes::Connection)
continue;
if(opts.count(itr.first))
{
curr_op_mode = itr.first;
if(itr.first == ExportToFile || itr.first == ExportToPng ||
itr.first == ExportToSvg || itr.first == ExportToDbms ||
itr.first == ExportToDict)
exp_mode_cnt++;
else
other_modes_cnt++;
}
}
if(opts.count(ZoomFactor))
zoom=opts[ZoomFactor].toDouble()/static_cast(100);
if(other_modes_cnt==0 && exp_mode_cnt==0)
throw Exception(tr("No operation mode was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if((exp_mode_cnt > 0 && (fix_model || upd_mime || import_db || diff || create_configs || list_conns)) || (exp_mode_cnt==0 && other_modes_cnt > 1))
throw Exception(tr("Multiple operation modes were specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!fix_model && !upd_mime && exp_mode_cnt > 1)
throw Exception(tr("Multiple export mode was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!list_conns && !upd_mime && !import_db && !diff && !create_configs && !opts.count(Input))
throw Exception(tr("No input file was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(import_db && !opts.count(InputDb))
throw Exception(tr("No input database was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!opts.count(ExportToDbms) && !upd_mime && !list_conns && !diff && !create_configs && !opts.count(Output))
throw Exception(tr("No output file was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!opts.count(ExportToDbms) && !upd_mime && !import_db && !list_conns && !create_configs &&
opts.count(Input) && opts.count(Output) &&
QFileInfo(opts[Input]).absoluteFilePath() == QFileInfo(opts[Output]).absoluteFilePath())
throw Exception(tr("Input file must be different from output!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(ExportToDbms) && !opts.count(ConnAlias) &&
(!opts.count(Host) || !opts.count(User) || !opts.count(Passwd) || !opts.count(InitialDb)) )
throw Exception(tr("Incomplete connection information!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(ExportToPng) && (zoom < ModelWidget::MinimumZoom || zoom > ModelWidget::MaximumZoom))
throw Exception(tr("Invalid zoom specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(upd_mime && opts[DbmMimeType]!=Install && opts[DbmMimeType]!=Uninstall)
throw Exception(tr("Invalid action specified to update mime option!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(create_configs && opts.count(Force) && opts.count(MissingOnly))
throw Exception(tr("The options `%1' and `%2' can't be used together when handling configuration files!").arg(Force).arg(MissingOnly), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(diff)
{
if(!opts.count(Input) && !opts.count(InputDb))
throw Exception(tr("No input file or database was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(Input) && opts.count(InputDb))
throw Exception(tr("The input file and database can't be used at the same time!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!opts.count(CompareTo))
throw Exception(tr("No database to be compared was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!opts.count(SaveDiff) && !opts.count(ApplyDiff))
throw Exception(tr("No diff action (save or apply) was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(SaveDiff) && opts[Output].isEmpty())
throw Exception(tr("No output file for the diff code was specified!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(PartialDiff) && !opts[Input].count() && (opts.count(StartDate) || opts.count(EndDate)))
throw Exception(tr("Date filters are allowed only on partial diff using an input model!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(PartialDiff) && opts.count(FilterObjects) && (opts.count(StartDate) || opts.count(EndDate)))
throw Exception(tr("Date filters and object filters can't be used together!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(opts.count(PartialDiff) && !opts.count(FilterObjects) && !opts.count(StartDate) && !opts.count(EndDate))
throw Exception(tr("Partial diff enabled but no object filter was provided!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
// For partial diff we force the --only-matching option and --force-children = all
if(opts.count(PartialDiff))
{
opts[ForceChildren] = AllChildren;
opts[OnlyMatching] = "";
}
// Validating the date formats in the provided start/end dates
QDateTime *dates[2] = { &start_date, &end_date };
QStringList dt_params = { StartDate, EndDate };
for(int idx = 0; idx < 2; idx++)
{
if(opts.count(dt_params[idx]))
{
*dates[idx] = QDateTime::fromString(opts[dt_params[idx]], Qt::ISODate);
if(!dates[idx]->isValid())
throw Exception(tr("Invalid date format `%1' in option `%2'!").arg(opts[dt_params[idx]]).arg(dt_params[idx]), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
}
}
/* If any of the dates are correctly parsed we need to force
* the signature name matching, the forced filtering of all table children objects
* and the only-matching option, so the objects can be correctly retrieved from
* the destination database */
if(start_date.isValid() || end_date.isValid())
{
parsed_opts.erase(MatchByName);
parsed_opts[ForceChildren] = AllChildren;
parsed_opts[OnlyMatching] = "";
}
}
//Converting input and output files to absolute paths to avoid that they are read/written on the app's working dir
if(opts.count(Input))
opts[Input]=QFileInfo(opts[Input]).absoluteFilePath();
if(opts.count(Output))
opts[Output]=QFileInfo(opts[Output]).absoluteFilePath();
/* Special treatment for filter parameters:
* Since it can be specified several filter parameter we need to join
* everything in a single string list so it can be passed to the import helper correctly */
if(opts.count(FilterObjects))
{
opts.erase(FilterObjects);
for(auto &op : opts)
{
if(op.first.contains(FilterObjects))
obj_filters.append(op.second);
}
}
/* Performing a final validation on the parsed options which consists
* in check if all provided options are compatible with the operation mode selected */
QStringList acc_opts = accepted_opts[curr_op_mode];
QString long_opt;
// Diff, import and export (to DBMS) share the same connection options
if(diff || import_db || export_dbms)
acc_opts.append(accepted_opts[Attributes::Connection]);
// Diff also accepts all import parameters
if(diff)
acc_opts.append(accepted_opts[ImportDb]);
for(auto &itr : opts)
{
long_opt = itr.first;
if(long_opt == curr_op_mode || long_opt == Silent)
continue;
/* Before validate the option we need to remove any appended number to the option name
* This happens for options related to objects filters and connections */
long_opt.remove(QRegExp("[0-9]+$"));
if(!acc_opts.contains(long_opt))
throw Exception(tr("The option `%1' is not accepted by the operation mode `%2'!").arg(long_opt).arg(curr_op_mode),
ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
}
parsed_opts = opts;
}
}
int PgModelerCliApp::exec()
{
try
{
if(!parsed_opts.empty())
{
showVersionInfo();
if(parsed_opts.count(ListConns))
listConnections();
else if(parsed_opts.count(FixModel))
fixModel();
else if(parsed_opts.count(DbmMimeType))
updateMimeType();
else if(parsed_opts.count(CreateConfigs))
createConfigurations();
else if(parsed_opts.count(ImportDb))
importDatabase();
else if(parsed_opts.count(Diff))
diffModelDatabase();
else
exportModel();
}
return 0;
}
catch(Exception &e)
{
throw e;
}
}
void PgModelerCliApp::updateProgress(int progress, QString msg, ObjectType)
{
if(progress > 0)
printMessage(QString("[%1%] ").arg(progress > 100 ? 100 : progress) + msg);
else
printMessage(msg);
}
void PgModelerCliApp::printIgnoredError(QString err_cod, QString err_msg, QString cmd)
{
printText();
printText(tr("** Error code `%1' found and ignored. Proceeding with export.").arg(err_cod));
printText(tr("** Command: %1").arg(cmd));
printText(err_msg);
printText();
}
void PgModelerCliApp::handleObjectAddition(BaseObject *object)
{
BaseGraphicObject *graph_obj=dynamic_cast(object);
if(graph_obj)
{
ObjectType obj_type=graph_obj->getObjectType();
QGraphicsItem *item=nullptr;
switch(obj_type)
{
case ObjectType::Table:
item=new TableView(dynamic_cast(graph_obj));
break;
case ObjectType::ForeignTable:
item=new TableView(dynamic_cast(graph_obj));
break;
case ObjectType::View:
item=new GraphicalView(dynamic_cast(graph_obj));
break;
case ObjectType::Relationship:
case ObjectType::BaseRelationship:
item=new RelationshipView(dynamic_cast(graph_obj));
break;
case ObjectType::Schema:
item=new SchemaView(dynamic_cast(graph_obj));
break;
default:
item=new StyledTextboxView(dynamic_cast(graph_obj));
break;
}
scene->addItem(item);
if(BaseTable::isBaseTable(obj_type))
dynamic_cast(graph_obj->getSchema())->setModified(true);
}
}
void PgModelerCliApp::handleObjectRemoval(BaseObject *object)
{
BaseGraphicObject *graph_obj=dynamic_cast(object);
if(graph_obj)
{
scene->removeItem(dynamic_cast(graph_obj->getOverlyingObject()));
//Updates the parent schema if the removed object were a table or view
if(graph_obj->getSchema() && BaseTable::isBaseTable(graph_obj->getObjectType()))
dynamic_cast(graph_obj->getSchema())->setModified(true);
}
}
void PgModelerCliApp::extractObjectXML()
{
QString buf, lin, def_xml, end_tag, pgmodeler_ver;
QTextStream ts;
QRegExp regexp(QString("^(\\<\\?xml)(.)*(\\<%1)( )*").arg(Attributes::DbModel)),
//[schema].[func_name](...OUT [type]...)
func_signature=QRegExp(QString("(\")(.)+(\\.)(.)+(\\()(.)*(OUT )(.)+(\\))(\")")),
//[,]OUT [schema].[type]
out_param=QRegExp(QString("(,)?(OUT )([a-z]|[0-9]|(\\.)|(\\_)|(\\-)|( )|(\\[)|(\\])|("))+((\\()([0-9])+(\\)))?"));
int start=-1, end=-1;
bool open_tag=false, close_tag=false, is_rel=false, short_tag=false, end_extract_rel;
printMessage(tr("Extracting objects' XML..."));
buf.append(UtilsNs::loadFile(parsed_opts[Input]));
// Extracting pgModeler version from input model
QRegExp ver_expr(AttributeExpr.arg(Attributes::PgModelerVersion));
start = ver_expr.indexIn(buf);
model_version = buf.mid(start, ver_expr.matchedLength());
model_version.remove(Attributes::PgModelerVersion);
model_version.remove(QRegExp("(\\\"|\\=| )+"));
if(!model_version.contains(QRegExp("(\\d\\.\\d\\.\\d)((\\-)(alpha|beta)(\\d))?")))
{
printMessage(tr("** WARNING: Could't determine the pgModeler version in which the input model was created!"));
printMessage(tr(" Some fix actions that depend on the model version will not be applied!"));
model_version.clear();
}
//Check if the file contains a valid header (for .dbm file)
start=regexp.indexIn(buf);
if(start < 0)
throw Exception(tr("Invalid input file! It seems that is not a pgModeler generated model or the file is corrupted!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
else
{
//Extracting layers informations from the tag
QRegExp dbm_regexp = QRegExp(TagExpr.arg(Attributes::DbModel)),
db_end_regexp = QRegExp(EndTagExpr.arg(Attributes::Database));
int attr_start =-1, attr_end = -1, dbm_start = dbm_regexp.indexIn(buf);
QString aux_buf = buf.mid(dbm_start, buf.indexOf(db_end_regexp) - dbm_start),
layers, active_layers, attr_expr = QString("(%1)( )*(=)(\")");
QList act_layers_ids;
//Layers names
attr_start = aux_buf.indexOf(Attributes::Layers);
attr_end = aux_buf.indexOf(Attributes::ActiveLayers);
layers = aux_buf.mid(attr_start, attr_end - attr_start);
layers.remove(QRegExp(attr_expr.arg(Attributes::Layers)));
layers.remove('"');
model->setLayers(layers.trimmed().split(',', QtCompat::SkipEmptyParts));
//Active layers
attr_start = attr_end;
attr_end = aux_buf.indexOf('>', attr_start);
active_layers = aux_buf.mid(attr_start, attr_end - attr_start);
active_layers.remove(QRegExp(attr_expr.arg(Attributes::ActiveLayers)));
active_layers.remove('"');
for(auto id : active_layers.trimmed().split(';', QtCompat::SkipEmptyParts))
act_layers_ids.push_back(id.toUInt());
model->setActiveLayers(act_layers_ids);
//Remove the header entry from buffer
buf.remove(start, regexp.matchedLength()+1);
//Checking if the header ends on a role declaration
QRegExp role_regexp = QRegExp(QString("(<%1)(.)*(<\\/%2>)").arg(Attributes::Role).arg(Attributes::Role));
end = buf.indexOf(role_regexp);
// If we found role declarations we clear the header until there
if(end >= 0)
buf.remove(0, end);
else
// Instead, we clear the header until the starting of database declaration
buf.remove(0, buf.indexOf(QString("<%1").arg(Attributes::Database)));
buf.remove(QString("<\\%1>").arg(Attributes::DbModel));
ts.setString(&buf);
//Extracts the objects xml line by line
while(!ts.atEnd())
{
lin=ts.readLine();
/* Special case for empty tags like , they will be converted to
in order to be correctly extracted further. Currently only language has this
behaviour, so additional object may be added in the future. */
if(lin.contains(QString("<%1").arg(BaseObject::getSchemaName(ObjectType::Language))))
{
lin=lin.simplified();
if(lin.contains(QString("/>")))
lin.replace(QString("/>"), QString(">").arg(BaseObject::getSchemaName(ObjectType::Language)));
}
/* Special case for function signatures. In previous releases, the function's signature was wrongly
including OUT parameters and according to docs they are not part of the signature, so it is needed
to remove them if the current line contains a valid signature with parameters. */
else if(lin.contains(func_signature))
lin.remove(out_param);
if(is_rel && (((short_tag && lin.contains(QString("/>"))) ||
(lin.contains(QString("[a-z]+")) && !containsRelAttributes(lin)))))
open_tag=close_tag=true;
else
{
//If the line contains an objects open tag
if(lin.contains(QRegExp("^(((\n)|(\t))*(<))")) && !open_tag)
{
//Check the flag indicating an open tag
open_tag=true;
start=lin.indexOf('<');
end=lin.indexOf(' ');
if(end < 0) end=lin.indexOf('>');
//Configures the end tag with the same word extracted from open tag
end_tag=lin.mid(start, end-start+1).trimmed();
end_tag.replace(QString("<"),QString("'))
end_tag+=QString(">");
/* Checking if the line start a relationship. Relationships are treated
a little different because they can be empty or
contain open and close tags */
is_rel=lin.contains(Attributes::Relationship);
if(is_rel)
{
end_extract_rel=short_tag=false;
while(!end_extract_rel && !ts.atEnd())
{
def_xml+=lin + QString("\n");
lin=lin.trimmed();
//Checking if the current line is the end of a short-tag relationship
if(!short_tag && !lin.startsWith('<') && lin.endsWith(QString("/>")))
short_tag=true;
end_extract_rel=((!short_tag && lin.contains(end_tag)) || short_tag);
if(!end_extract_rel)
lin=ts.readLine();
}
close_tag=true;
}
else
close_tag=lin.contains(end_tag);
}
else if(open_tag && lin.contains(end_tag))
close_tag=true;
}
if(!is_rel && !lin.isEmpty())
def_xml+=lin + QString("\n");
else if(lin.isEmpty())
def_xml+=QString("\n");
//If the iteration reached the end of the object's definition
if(open_tag && close_tag)
{
//Pushes the extracted definition to the list (only if not empty)
if(def_xml!=QString("\n"))
objs_xml.push_back(def_xml);
def_xml.clear();
open_tag=close_tag=is_rel=false;
}
}
}
}
void PgModelerCliApp::recreateObjects()
{
QStringList fail_objs, constr, list;
QString xml_def, aux_def, start_tag = "<%1", end_tag = "", aux_tag, type_tag = " types={ ObjectType::Index, ObjectType::Trigger, ObjectType::Rule };
attribs_map attribs, fmt_ext_names;
bool use_fail_obj=false;
unsigned tries=0, max_tries=parsed_opts[FixTries].toUInt();
int start_pos=-1, end_pos=-1, len=0, obj_id = 0, obj_cnt = objs_xml.count();
printMessage(tr("Recreating objects..."));
if(max_tries==0)
max_tries=1;
model->createSystemObjects(false);
while(!objs_xml.isEmpty())
{
//If there are failed objects and the flag is set
if(use_fail_obj && !fail_objs.isEmpty())
{
xml_def=fail_objs.front();
fail_objs.pop_front();
use_fail_obj=false;
}
else
{
xml_def=objs_xml.front();
objs_xml.pop_front();
fixObjectAttributes(xml_def);
}
/* Replacing the tags [restartParser();
xmlparser->loadXMLBuffer(xml_def);
obj_type=BaseObject::getObjectType(xmlparser->getElementName());
xmlparser->getElementAttributes(attribs);
if(obj_type==ObjectType::Database)
model->configureDatabase(attribs);
else
{
if(obj_type==ObjectType::Table)
{
//Before create a table extract it's foreign keys
list=extractForeignKeys(xml_def);
/* If fks were extracted insert them on the main constraints list
* and restarts the XMLParser with the modified buffer */
if(!list.isEmpty())
{
constr.append(list);
xmlparser->restartParser();
xmlparser->loadXMLBuffer(xml_def);
}
}
//Discarding fk relationships
if(obj_type!=ObjectType::Relationship ||
(obj_type==ObjectType::Relationship && !xml_def.contains(QString("\"%1\"").arg(Attributes::RelationshipFk))))
{
object=model->createObject(obj_type);
if(object)
{
if(!dynamic_cast(object) && obj_type!=ObjectType::Relationship && obj_type!=ObjectType::BaseRelationship)
model->addObject(object);
printMessage(QString("[%1%] %2")
.arg(static_cast((++obj_id/static_cast(obj_cnt)) * 100))
.arg(tr("Object recreated: `%1' (%2)").arg(object->getName(true), object->getTypeName())));
/* Special case for extensions:
* Before pgModeler 0.9.4-alpha1 the types handled by extension (for example hstore, ltree, etc) were
* registered in the PgSqlType as user-defined data type without their schemas names prepended. This
* was causing lot of troubles importing databases in which extension data types were being used. The
* solution was to adjust the extension type names in such a way to prepend schema names. So here we
* store the schema-qualified extension name in a special map where the key is the name of the extension
* without the schema name, this way search the tags [getObjectType() == ObjectType::Extension && dynamic_cast(object)->handlesType())
fmt_ext_names[object->getName()] = object->getName(true, true);
}
//For each sucessful created object the method will try to create a failed one
use_fail_obj=(!fail_objs.isEmpty());
}
/* Additional step to extract indexes/triggers/rules from within tables/views
* and putting their xml on the list of object to be created */
if(BaseTable::isBaseTable(obj_type) && xml_def.contains(QRegExp("(<)(index|trigger|rule)")))
{
for(ObjectType type : types)
{
do
{
//Checking where the object starts and ends
aux_tag=start_tag.arg(BaseObject::getSchemaName(type));
start_pos=xml_def.indexOf(aux_tag);
end_pos=(start_pos >=0 ? xml_def.indexOf(end_tag.arg(BaseObject::getSchemaName(type))) : -1);
if(start_pos >=0 && end_pos >= 0)
{
//Extracts the xml code
len=(end_pos - start_pos) + end_tag.arg(BaseObject::getSchemaName(type)).length() + 1;
aux_def=xml_def.mid(start_pos, len);
//Remove the code from original table's definition
xml_def.remove(start_pos, len);
//If the extract object doesn't contains the 'table=' attribute it'll be added.
if(!aux_def.contains("table="))
{
aux_def.replace(aux_tag, QString("%1 table=\"%2\"").arg(aux_tag).arg(object->getName(true)));
aux_def=XmlParser::convertCharsToXMLEntities(aux_def);
}
objs_xml.push_back(aux_def);
}
}
while(start_pos >= 0);
}
}
}
}
catch(Exception &e)
{
if(obj_type!=ObjectType::Database)
{
fail_objs.push_back(xml_def);
printText(tr("** WARNING: Failed to recreate an object!"));
}
else
throw Exception(e.getErrorMessage(), e.getErrorCode(),__PRETTY_FUNCTION__,__FILE__,__LINE__, &e);
}
if(objs_xml.isEmpty() && (!fail_objs.isEmpty() || !constr.isEmpty()))
{
tries++;
//If the maximum creation tries reaches the maximum value
if(tries > max_tries)
{
//Outputs the code of the objects that wasn't created
printText();
printText(tr("** Object(s) that couldn't fixed: "));
while(!fail_objs.isEmpty())
{
printText(fail_objs.front());
fail_objs.pop_front();
}
break;
}
else
{
printMessage(tr("** WARNING: There are objects that maybe can't be fixed. Trying again... (tries %1/%2)").arg(tries).arg(max_tries));
model->validateRelationships();
objs_xml=fail_objs;
objs_xml.append(constr);
fail_objs.clear();
constr.clear();
}
}
}
// Fixing the roles memberships.
Role *role = nullptr, *mem_role = nullptr;
bool member_fixed = false;
for(auto &rl : member_roles)
{
role = model->getRole(rl.first);
if(!role)
{
printMessage(tr("** WARNING: Could not find the role `%1'! Ignoring it...").arg(rl.first));
continue;
}
for(auto &name : rl.second)
{
mem_role = model->getRole(name);
if(!mem_role)
{
printMessage(tr("** WARNING: Could not find the role `%1' of `%2`! Igorning it...").arg(name, rl.first));
continue;
}
role->addRole(Role::MemberRole, mem_role);
member_fixed = true;
}
}
if(member_fixed)
{
printMessage(tr("** WARNING: Roles memberships were fixed but their creation order is not guaranteed!"));
printMessage(tr(" It may be necessary to run the fix tool again but now on the file `%1'.").arg(parsed_opts[Output]));
}
}
void PgModelerCliApp::fixObjectAttributes(QString &obj_xml)
{
//Placing objects , , outside of
if(!obj_xml.startsWith(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Tablespace))) &&
obj_xml.startsWith(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Table))))
{
int start_idx=-1, end_idx=-1, len=0;
ObjectType obj_types[3]={ ObjectType::Rule, ObjectType::Trigger, ObjectType::Index };
QString curr_tag, curr_end_tag, def, tab_name, sch_name,
name_attr=QString("name=\""),
sch_name_attr=TagExpr.arg(BaseObject::getSchemaName(ObjectType::Schema)) + QString(" ") + name_attr;
//Extracting the table's name
start_idx=obj_xml.indexOf(name_attr);
end_idx=obj_xml.indexOf("\"", start_idx + name_attr.size());
tab_name=obj_xml.mid(start_idx, end_idx - start_idx).remove(name_attr);
//Extracting the table's schema name
start_idx=obj_xml.indexOf(sch_name_attr);
end_idx=obj_xml.indexOf('"', start_idx + sch_name_attr.size());
sch_name=obj_xml.mid(start_idx, end_idx - start_idx).remove(sch_name_attr);
//Configuring the table=[name] attribute to be included on rule objects
tab_name=QString("table=\"%1.%2\"").arg(sch_name).arg(tab_name);
for(unsigned idx=0; idx < 3; idx++)
{
curr_tag=TagExpr.arg(BaseObject::getSchemaName(obj_types[idx]));
curr_end_tag=EndTagExpr.arg(BaseObject::getSchemaName(obj_types[idx])) + QString(">");
start_idx=obj_xml.indexOf(curr_tag);
while(start_idx >=0)
{
end_idx=obj_xml.indexOf(curr_end_tag);
len=(end_idx - start_idx) + curr_end_tag.size();
def=obj_xml.mid(start_idx, len) + QString("\n\n");
obj_xml.remove(start_idx, len);
//If the object is a rule include the table attribute
if(def.startsWith(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Rule))))
{
start_idx=def.indexOf('>');
def.replace(start_idx, 1, QString(" ") + tab_name + QString(">"));
}
start_idx=obj_xml.indexOf(curr_tag);
if(!def.isEmpty())
//Puts the object's defintion to the list in order to be evaluated in the main process
objs_xml.push_back(def);
}
}
}
//Remove recheck attribute from tags.
if(obj_xml.contains(TagExpr.arg(Attributes::Element)))
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("recheck"))));
//Remove values greater-op, less-op, sort-op or sort2-op from ref-type attribute from tags.
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Operator))))
{
obj_xml.remove(QString("greater-op"));
obj_xml.remove(QString("less-op"));
obj_xml.remove(QString("sort-op"));
obj_xml.remove(QString("sort2-op"));
}
//Replacing attribute owner by onwer-col for sequences
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Sequence))))
obj_xml.replace(QRegExp(QString("(%1)( )*(=)(\")").arg(Attributes::Owner)), QString("%1 = \"").arg(Attributes::OwnerColumn));
/* Remove sysid attribute from tags and storing the referenced roles (ref-roles)
* for later re-assignment. */
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Role))))
{
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("sysid"))));
QRegExp ref_roles_expr = QRegExp(QString("(\\<%1)(.)+(%2)( )*(=)(\")(%3)(\")(.)+(\\/\\>)").arg(Attributes::Roles, Attributes::RoleType, Attributes::Refer));
int pos = ref_roles_expr.indexIn(obj_xml);
if(pos >= 0)
{
QString buf = obj_xml.mid(pos, ref_roles_expr.matchedLength()),
name_attr = QString("name=\""), role_name;
int start_idx = 0, end_idx = 0;
// Extracting the role name
start_idx = obj_xml.indexOf(name_attr);
end_idx = obj_xml.indexOf("\"", start_idx + name_attr.size());
role_name = obj_xml.mid(start_idx, end_idx - start_idx).remove(name_attr);
// Removing the element
obj_xml.remove(pos, ref_roles_expr.matchedLength());
// Retrieve the name of the ref-roles
buf.remove(QRegExp("^(.)+(names=\")"));
buf.remove(buf.indexOf("\""), buf.size());
/* Storing the association between the current role and the ref-roles
* in a map for further processing */
for(auto &rl_name : buf.split(',', QtCompat::SkipEmptyParts))
member_roles[rl_name].append(role_name);
}
}
//Replace tag by on tags.
if(obj_xml.contains(TagExpr.arg(QString("usertype"))))
{
obj_xml.replace(TagExpr.arg(Attributes::Parameter), TagExpr.arg(Attributes::TypeAttribute));
obj_xml.replace(EndTagExpr.arg(Attributes::Parameter), EndTagExpr.arg(Attributes::TypeAttribute));
// Fixing the enumeration type labels
if(!model_version.isEmpty() && model_version <= "0.9.4-beta1")
{
/* Until pgModeler 0.9.3, enum labels separators where commas.
* In pgModeler 0.9.4, enum labels separators where UtilsNs::DataSeparator */
QString sep = (model_version == "0.9.4-beta1" ? UtilsNs::DataSeparator : ","),
values, labels;
QRegExp enum_start_expr("(" + TagExpr.arg(Attributes::EnumType) + ")( )*(values)( )*(=)( )*(\\\")"),
enum_end_expr("(\\\")( )*(\\/>)"),
enum_tag_expr("(" + TagExpr.arg(Attributes::EnumType) + ")(.)+(/>)");
int start = -1, end = -1;
// Extracting the values of the tag
start = enum_start_expr.indexIn(obj_xml) + enum_start_expr.matchedLength();
end = enum_end_expr.indexIn(obj_xml, start);
values = obj_xml.mid(start, end - start);
if(!values.isEmpty())
{
// Converting each value extract into a separated tag
for(auto &label : values.split(sep, QtCompat::SkipEmptyParts))
labels.append(QString("\t<%1 label=\"%2\"/>\n").arg(Attributes::EnumType, label));
obj_xml.replace(enum_tag_expr, labels);
}
}
}
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Relationship))))
{
//Remove auto-sufix, src-sufix, dst-sufix, col-indexes, constr-indexes, attrib-indexes from tags.
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("auto-sufix"))));
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("src-sufix"))));
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("dst-sufix"))));
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("col-indexes"))));
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("constr-indexes"))));
obj_xml.remove(QRegExp(AttributeExpr.arg(QString("attrib-indexes"))));
obj_xml.replace(QString("line-color"), Attributes::CustomColor);
}
//Renaming the tag to on indexes
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Index))))
{
obj_xml.replace(TagExpr.arg(Attributes::Condition), TagExpr.arg(Attributes::Predicate));
obj_xml.replace(EndTagExpr.arg(Attributes::Condition), EndTagExpr.arg(Attributes::Predicate));
}
//Renaming the attribute default to default-value on domain
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Domain))))
obj_xml.replace(Attributes::Default, Attributes::DefaultValue);
//Renaming the tag to
if(obj_xml.contains(TagExpr.arg(QString("grant"))))
{
obj_xml.replace(TagExpr.arg(QString("grant")), TagExpr.arg(BaseObject::getSchemaName(ObjectType::Permission)));
obj_xml.replace(EndTagExpr.arg(QString("grant")), EndTagExpr.arg(BaseObject::getSchemaName(ObjectType::Permission)));
}
//Replace the constraint attribute and tag expression by constraint tag in .
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Domain))) &&
obj_xml.contains(TagExpr.arg(Attributes::Expression)))
{
int start_idx=-1, end_idx=-1;
QRegExp regexp = QRegExp(AttributeExpr.arg(Attributes::Constraint));
QString constr_name;
regexp.indexIn(obj_xml);
constr_name = regexp.capturedTexts().at(0);
constr_name.remove(QString("%1=\"").arg(Attributes::Constraint));
constr_name.remove(constr_name.length() - 1, 1);
obj_xml.remove(QRegExp(AttributeExpr.arg(Attributes::Constraint)));
start_idx = obj_xml.indexOf(TagExpr.arg(Attributes::Expression));
obj_xml.insert(start_idx, QString("\n\t\n\t\t").arg(constr_name));
end_idx = obj_xml.indexOf(EndTagExpr.arg(Attributes::Expression));
obj_xml.insert(end_idx + EndTagExpr.arg(Attributes::Expression).length() + 1, QString("\n\t\n"));
}
//Remove the deprecated attribute hide-ext-attribs from and
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Table))) ||
obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::View))))
{
obj_xml.replace(QRegExp(AttributeExpr.arg(Attributes::HideExtAttribs)), "");
}
//Remove the usage of IN keyword in functions' signatures since it is the default if absent
QRegExp regexp = QRegExp(AttributeExpr.arg(Attributes::Signature));
int sig_idx = regexp.indexIn(obj_xml), len = 0;
QString signature, in_keyw = QString("IN ");
while(sig_idx >= 0)
{
signature = obj_xml.mid(sig_idx, regexp.matchedLength());
len = signature.length();
if(!signature.contains(in_keyw))
{
sig_idx = regexp.indexIn(obj_xml, sig_idx + len);
continue;
}
signature.remove(in_keyw);
obj_xml.remove(sig_idx, len);
obj_xml.insert(sig_idx, signature);
sig_idx = regexp.indexIn(obj_xml, sig_idx + len);
}
//Rename the attribute layer to layers
if(obj_xml.contains(QRegExp("(layer)( )*(=)")))
obj_xml.replace("layer", Attributes::Layers);
//Fix the references to op. classes and families if needed
fixOpClassesFamiliesReferences(obj_xml);
}
void PgModelerCliApp::fixOpClassesFamiliesReferences(QString &obj_xml)
{
ObjectType ref_obj_type;
if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Index))) ||
obj_xml.contains(QRegExp(QString("(%1)(.)+(type=)(\")(%2)(\")")
.arg(TagExpr.arg(BaseObject::getSchemaName(ObjectType::Constraint)))
.arg(Attributes::ExConstr))))
ref_obj_type=ObjectType::OpClass;
else if(obj_xml.contains(TagExpr.arg(BaseObject::getSchemaName(ObjectType::OpClass))))
ref_obj_type=ObjectType::OpFamily;
else
return;
QString ref_obj_name=BaseObject::getSchemaName(ref_obj_type);
if(!obj_xml.contains(TagExpr.arg(ref_obj_name)))
return;
QString obj_name, aux_obj_name, signature=QString("%1 USING %2");
QRegExp sign_regexp=QRegExp(AttributeExpr.arg(QString("signature")));
QStringList index_types;
int pos=0;
obj_xml.replace(TagExpr.arg(ref_obj_name) + QString(" name="),
TagExpr.arg(ref_obj_name) + QString(" signature="));
index_types = IndexingType::getTypes();
do
{
pos=sign_regexp.indexIn(obj_xml, pos);
if(pos >= 0)
{
//Extracting the signature attribute
obj_name=obj_xml.mid(pos, sign_regexp.matchedLength());
//Removing useless portions signature=" in order to retrive only the object's name
obj_name.remove(QRegExp("(signature)( )*(=)"));
obj_name.remove('"');
//Transforming xml entity for quote into the char
obj_name.replace(XmlParser::CharQuot, QString("\""));
for(auto &idx_type : index_types)
{
//Building a name by appe
aux_obj_name=signature.arg(obj_name).arg(idx_type);
if(model->getObjectIndex(aux_obj_name, ref_obj_type) >= 0)
{
//Replacing the old signature with the corrected form
aux_obj_name.replace(QString("\""), XmlParser::CharQuot);
obj_xml.replace(pos, sign_regexp.matchedLength(), QString("signature=\"%1\"").arg(aux_obj_name));
break;
}
}
pos+=sign_regexp.matchedLength();
}
}
while(pos >= 0);
}
void PgModelerCliApp::fixModel()
{
printMessage(tr("Starting model fixing..."));
printMessage(tr("Loading input file: %1").arg(parsed_opts[Input]));
printMessage(tr("Fixed model file: %1").arg(parsed_opts[Output]));
extractObjectXML();
recreateObjects();
printMessage(tr("Updating relationships..."));
model->updateTablesFKRelationships();
printMessage(tr("Saving fixed output model..."));
model->saveModel(parsed_opts[Output], SchemaParser::XmlDefinition);
printMessage(tr("Model successfully fixed!"));
}
void PgModelerCliApp::loadModel()
{
//Create the systems objects on model before loading it
model->createSystemObjects(false);
//Load the model file
model->loadModel(parsed_opts[Input]);
/* The scene object is created only when some options are used
* so we need to check it if is not null to avoid segfaults */
if(scene)
{
scene->blockSignals(true);
scene->addLayers(model->getLayers(), false);
scene->setActiveLayers(model->getActiveLayers());
scene->setLayerColors(ObjectsScene::LayerNameColor, model->getLayerNameColors());
scene->setLayerColors(ObjectsScene::LayerRectColor, model->getLayerRectColors());
scene->setLayerNamesVisible(model->isLayerNamesVisible());
scene->setLayerRectsVisible(model->isLayerRectsVisible());
if(model->isLayerRectsVisible())
model->setObjectsModified({ ObjectType::Schema });
scene->blockSignals(false);
}
}
void PgModelerCliApp::exportModel()
{
printMessage(tr("Starting model export..."));
printMessage(tr("Loading input file: %1").arg(parsed_opts[Input]));
loadModel();
//Export to PNG
if(parsed_opts.count(ExportToPng))
{
printMessage(tr("Export to PNG image: %1").arg(parsed_opts[Output]));
export_hlp->exportToPNG(scene, parsed_opts[Output], zoom,
parsed_opts.count(ShowGrid) > 0,
parsed_opts.count(ShowDelimiters) > 0,
parsed_opts.count(PageByPage) > 0);
}
//Export to SVG
else if(parsed_opts.count(ExportToSvg))
{
printMessage(tr("Export to SVG file: %1").arg(parsed_opts[Output]));
export_hlp->exportToSVG(scene, parsed_opts[Output],
parsed_opts.count(ShowGrid) > 0,
parsed_opts.count(ShowDelimiters) > 0);
}
//Export to SQL file
else if(parsed_opts.count(ExportToFile))
{
printMessage(tr("Export to SQL script file: %1").arg(parsed_opts[Output]));
export_hlp->exportToSQL(model, parsed_opts[Output], parsed_opts[PgSqlVer], parsed_opts.count(Split) > 0);
}
//Export data dictionary
else if(parsed_opts.count(ExportToDict))
{
printMessage(tr("Export to data dictionary: %1").arg(parsed_opts[Output]));
export_hlp->exportToDataDict(model, parsed_opts[Output],
parsed_opts.count(NoIndex) == 0,
parsed_opts.count(Split) > 0);
}
//Export to DBMS
else
{
printMessage(tr("Export to DBMS: %1").arg(connection.getConnectionString().replace(PasswordRegExp, PasswordPlaceholder)));
if(parsed_opts.count(IgnoreErrorCodes))
export_hlp->setIgnoredErrors(parsed_opts[IgnoreErrorCodes].split(','));
export_hlp->exportToDBMS(model, connection, parsed_opts[PgSqlVer],
parsed_opts.count(IgnoreDuplicates) > 0,
parsed_opts.count(DropDatabase) > 0,
parsed_opts.count(DropObjects) > 0,
parsed_opts.count(Simulate) > 0,
parsed_opts.count(UseTmpNames) > 0);
}
printMessage(tr("Export successfully ended!\n"));
}
void PgModelerCliApp::importDatabase()
{
printMessage(tr("Starting database import..."));
printMessage(tr("Input database: %1").arg(connection.getConnectionId(true, true)));
ModelWidget *model_wgt = new ModelWidget;
importDatabase(model_wgt->getDatabaseModel(), connection);
model_wgt->rearrangeSchemasInGrid();
printMessage(tr("Saving the imported database to file..."));
model_wgt->getDatabaseModel()->saveModel(parsed_opts[Output], SchemaParser::XmlDefinition);
printMessage(tr("Import successfully ended!\n"));
delete model_wgt;
}
void PgModelerCliApp::importDatabase(DatabaseModel *model, Connection conn)
{
try
{
map> obj_oids;
map> col_oids;
Catalog catalog;
QString db_oid;
QStringList force_tab_objs;
bool imp_sys_objs = (parsed_opts.count(ImportSystemObjs) > 0),
imp_ext_objs = (parsed_opts.count(ImportExtensionObjs) > 0);
if(parsed_opts[ForceChildren] == AllChildren)
{
for(auto &type : BaseObject::getChildObjectTypes(ObjectType::Table))
{
if(type == ObjectType::Column)
continue;
force_tab_objs.append(BaseObject::getSchemaName(type));
}
}
else
force_tab_objs = parsed_opts[ForceChildren].split(',', QtCompat::SkipEmptyParts);
catalog.setConnection(conn);
catalog.setQueryFilter(Catalog::ListAllObjects | Catalog::ExclBuiltinArrayTypes |
(!imp_ext_objs ? Catalog::ExclExtensionObjs : 0) |
(!imp_sys_objs ? Catalog::ExclSystemObjs : 0));
catalog.setObjectFilters(obj_filters, parsed_opts.count(OnlyMatching) > 0,
parsed_opts.count(MatchByName) == 0, force_tab_objs);
catalog.getObjectsOIDs(obj_oids, col_oids, {{Attributes::FilterTableTypes, Attributes::True}});
db_oid = catalog.getObjectOID(conn.getConnectionParam(Connection::ParamDbName), ObjectType::Database);
obj_oids[ObjectType::Database].push_back(db_oid.toUInt());
catalog.closeConnection();
import_hlp->setConnection(conn);
import_hlp->setImportOptions(imp_sys_objs,
imp_ext_objs,
true,
parsed_opts.count(IgnoreImportErrors) > 0,
parsed_opts.count(DebugMode) > 0,
!parsed_opts.count(Diff), !parsed_opts.count(Diff));
model->createSystemObjects(true);
import_hlp->setSelectedOIDs(model, obj_oids, col_oids);
import_hlp->importDatabase();
import_hlp->closeConnection();
}
catch(Exception &e)
{
throw Exception(e.getErrorMessage(), e.getErrorCode(),__PRETTY_FUNCTION__,__FILE__,__LINE__, &e);
}
}
void PgModelerCliApp::diffModelDatabase()
{
DatabaseModel *model_aux = new DatabaseModel();
QString dbname;
vector filtered_objs;
printMessage(tr("Starting diff process..."));
if(!parsed_opts[Input].isEmpty())
printMessage(tr("Input model: %1").arg(parsed_opts[Input]));
else
printMessage(tr("Input database: %1").arg(connection.getConnectionId(true, true)));
dbname = extra_connection.getConnectionId(true, true);
printMessage(tr("Compare to: %1").arg(dbname));
if(!parsed_opts[Input].isEmpty())
{
printMessage(tr("Loading input model..."));
loadModel();
if(parsed_opts.count(PartialDiff))
{
QString search_attr = parsed_opts.count(MatchByName) ? Attributes::Name : Attributes::Signature;
// Filtering by modification date always forces the signature matching
if(start_date.isValid() || end_date.isValid())
obj_filters.append(model->getFiltersFromChangelog(start_date, end_date));
filtered_objs = model->findObjects(obj_filters, search_attr);
/* We need to finish the diff if no object was found based on the filters
* this will avoid the diff between an empty database model and a full database model
* which may produce unexpected results like try to recreate all objects from the database
* model that contains objects */
if(filtered_objs.empty())
{
printMessage(tr("No object was retrieved using the provided filter(s)."));
if(!parsed_opts.count(Force))
{
printMessage(tr("Use the option `%1' to force a full diff in this case.").arg(Force));
printMessage(tr("The diff process will not continue!\n"));
return;
}
else
printMessage(tr("Switching to full diff..."));
}
else
{
/* Special case: when performing a partial diff between a model and a database
* and in the set of filtered model objects we have one or more many-to-many, inheritance or partitioning
* relationships we need to inject filters to force the retrieval of the all involved tables in those relationships
* from the destination database,this way we avoid the diff try to create everytime all tables
* in the those relationships. */
obj_filters.append(ModelsDiffHelper::getRelationshipFilters(filtered_objs, search_attr == Attributes::Signature));
}
}
}
else
{
printMessage(tr("Importing the database `%1'...").arg(connection.getConnectionId(true, true)));
importDatabase(model, connection);
}
printMessage(tr("Importing the database `%1'...").arg(dbname));
importDatabase(model_aux, extra_connection);
diff_hlp->setModels(model, model_aux);
diff_hlp->setFilteredObjects(filtered_objs);
diff_hlp->setDiffOption(ModelsDiffHelper::OptKeepClusterObjs, !parsed_opts.count(DropClusterObjs));
diff_hlp->setDiffOption(ModelsDiffHelper::OptCascadeMode, !parsed_opts.count(NoCascadeDrop));
diff_hlp->setDiffOption(ModelsDiffHelper::OptForceRecreation, parsed_opts.count(ForceRecreateObjs));
diff_hlp->setDiffOption(ModelsDiffHelper::OptRecreateUnmodifiable, parsed_opts.count(OnlyUnmodifiable));
diff_hlp->setDiffOption(ModelsDiffHelper::OptKeepObjectPerms, !parsed_opts.count(RevokePermissions));
diff_hlp->setDiffOption(ModelsDiffHelper::OptReuseSequences, !parsed_opts.count(NoSequenceReuse));
diff_hlp->setDiffOption(ModelsDiffHelper::OptPreserveDbName, !parsed_opts.count(RenameDb));
diff_hlp->setDiffOption(ModelsDiffHelper::OptDontDropMissingObjs, !parsed_opts.count(DropMissingObjs));
diff_hlp->setDiffOption(ModelsDiffHelper::OptDropMissingColsConstr, !parsed_opts.count(ForceDropColsConstrs));
if(!parsed_opts[PgSqlVer].isEmpty())
diff_hlp->setPgSQLVersion(parsed_opts[PgSqlVer]);
else
{
extra_connection.connect();
diff_hlp->setPgSQLVersion(extra_connection.getPgSQLVersion(true));
extra_connection.close();
}
printMessage(tr("Comparing the generated models..."));
diff_hlp->diffModels();
if(diff_hlp->getDiffDefinition().isEmpty())
printMessage(tr("No differences were detected."));
else
{
if(parsed_opts.count(SaveDiff))
{
printMessage(tr("Saving diff to file `%1'").arg(parsed_opts[Output]));
UtilsNs::saveFile(parsed_opts[Output], diff_hlp->getDiffDefinition().toUtf8());
}
else
{
bool apply_diff = true;
if(!parsed_opts.count(NoDiffPreview))
{
QString res, buff, line;
QTextStream in(stdin), preview;
buff += "\n** Press ENTER to scroll the preview **\n";
buff += "\n### DIFF PREVIEW ###\n\n";
buff += diff_hlp->getDiffDefinition();
buff += "\n### END OF PREVIEW ###\n\n";
preview.setString(&buff, QIODevice::ReadOnly);
while(!preview.atEnd())
{
line = preview.readLine();
res.append(line + '\n');
if(res.count(QChar('\n')) >= 30 || preview.atEnd())
{
out << res;
out.flush();
res.clear();
if(!preview.atEnd())
in.readLine();
}
}
out << QtCompat::endl;
out << tr("** WARNING: You are about to apply the generated diff code to the server. Data can be lost in the process!") << QtCompat::endl;
do
{
out << tr("** Proceed with the diff applying? (yes/no) > ");
out.flush();
in.skipWhiteSpace();
res = in.readLine();
}
while(res.toLower() != tr("yes") && res.toLower() != tr("no"));
if(res.toLower() == tr("no"))
{
apply_diff = false;
printMessage(tr("Diff code not applied to the server."));
}
}
if(apply_diff)
{
printMessage(tr("Applying diff to the database `%1'...").arg(dbname));
export_hlp->setExportToDBMSParams(diff_hlp->getDiffDefinition(),
&extra_connection,
parsed_opts[CompareTo], parsed_opts.count(IgnoreDuplicates));
if(parsed_opts.count(IgnoreErrorCodes))
export_hlp->setIgnoredErrors(parsed_opts[IgnoreErrorCodes].split(','));
export_hlp->exportToDBMS();
}
}
}
printMessage(tr("Diff successfully ended!\n"));
}
void PgModelerCliApp::updateMimeType()
{
#ifndef Q_OS_MAC
try
{
printMessage(tr("Starting mime update..."));
handleMimeDatabase(parsed_opts[DbmMimeType]==Uninstall, parsed_opts.count(SystemWide) != 0, parsed_opts.count(Force) != 0);
printMessage(tr("Mime database successfully updated!\n"));
}
catch (Exception &e)
{
throw Exception(e.getErrorMessage(),e.getErrorCode(),__PRETTY_FUNCTION__,__FILE__,__LINE__,&e);
}
#endif
}
QStringList PgModelerCliApp::extractForeignKeys(QString &obj_xml)
{
QStringList constr_lst;
int start=0, end=0, pos=0, count=0;
QString start_tag=QString("<%1").arg(Attributes::Constraint),
end_tag=QString(" 0 && end > 0)
{
count=(end - start) + end_tag.size() + 1;
constr=obj_xml.mid(start, count);
if(constr.contains(Attributes::FkConstr))
{
obj_xml.remove(start, count);
constr_lst.push_back(constr);
pos=0;
}
else
pos=end;
}
else
break;
}
while(pos >= 0 && pos < obj_xml.size());
return constr_lst;
}
bool PgModelerCliApp::containsRelAttributes(const QString &str)
{
bool found=false;
static vector attribs={ Attributes::Relationship,
Attributes::Type, Attributes::SrcRequired, Attributes::DstRequired,
Attributes::SrcTable, Attributes::DstTable, Attributes::Points,
Attributes::Columns, Attributes::Column, Attributes::Constraint,
Attributes::Label, Attributes::Line, Attributes::Position,
Attributes::Identifier, Attributes::Deferrable, Attributes::DeferType,
Attributes::TableName, Attributes::SpecialPkCols, Attributes::Table,
Attributes::AncestorTable, Attributes::CopyOptions, Attributes::CopyMode,
Attributes::SrcColPattern, Attributes::DstColPattern, Attributes::PkPattern,
Attributes::UqPattern, Attributes::SrcFkPattern, Attributes::DstFkPattern };
for(unsigned i=0; i < attribs.size() && !found; i++)
found=str.contains(attribs[i]);
return found;
}
void PgModelerCliApp::handleMimeDatabase(bool uninstall, bool system_wide, bool force)
{
printMessage(tr("Mime database operation: %1").arg(uninstall ? QString("uninstall") : QString("install")));
#ifdef Q_OS_LINUX
handleLinuxMimeDatabase(uninstall, system_wide, force);
#else
#ifdef Q_OS_WIN
handleWindowsMimeDatabase(uninstall, system_wide, force);
#endif
#endif
}
void PgModelerCliApp::handleLinuxMimeDatabase(bool uninstall, bool system_wide, bool force)
{
SchemaParser schparser;
attribs_map attribs;
QString str_aux,
share_path = !system_wide ? QDir::homePath() + QString("/.local/share") : QString("/usr/share"),
//Configures the path to the application logo
exec_icon=GlobalAttributes::getTmplConfigurationFilePath("", "pgmodeler_logo.png"),
//Configures the path to the document logo
dbm_icon=GlobalAttributes::getTmplConfigurationFilePath("", "pgmodeler_dbm.png"),
sch_icon=GlobalAttributes::getTmplConfigurationFilePath("", "pgmodeler_sch.png"),
//Path to directory that register mime types
mime_db_dir=QString("%1/mime").arg(share_path),
//Path to the file that associates apps to mimetypes
mimeapps=QString("%1/applications/mimeapps.list").arg(share_path);
//Files generated after update file association (application-dbm.xml and pgModeler.desktop)
QStringList files = { QString("%1/applications/pgModeler.desktop").arg(share_path),
QString("%1/applications/pgModelerSchEditor.desktop").arg(share_path),
mime_db_dir + QString("/packages/application-dbm.xml"),
mime_db_dir + QString("/packages/application-sch.xml")},
schemas = { GlobalAttributes::getTmplConfigurationFilePath(GlobalAttributes::SchemasDir, QString("desktop") + GlobalAttributes::SchemaExt),
GlobalAttributes::getTmplConfigurationFilePath(GlobalAttributes::SchemasDir, QString("desktop-sch") + GlobalAttributes::SchemaExt),
GlobalAttributes::getTmplConfigurationFilePath(GlobalAttributes::SchemasDir, QString("application-dbm") + GlobalAttributes::SchemaExt),
GlobalAttributes::getTmplConfigurationFilePath(GlobalAttributes::SchemasDir, QString("application-sch") + GlobalAttributes::SchemaExt) },
icons = { exec_icon, sch_icon, dbm_icon, sch_icon };
QByteArray buf, buf_aux;
QFile out;
for(unsigned i=0; i < 4; i++)
{
//When installing, check if the necessary file exists. If exists, raises an error and abort.
if(!uninstall && QFileInfo(files[i]).exists() && !force)
throw Exception(MsgFileAssociated, ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(uninstall && !QFileInfo(files[i]).exists() && !force)
throw Exception(MsgNoFileAssociation, ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
}
if(!uninstall && !system_wide)
attribs[Attributes::WorkingDir]=QStandardPaths::writableLocation(QStandardPaths::HomeLocation);
else
attribs[Attributes::WorkingDir]="";
try
{
for(unsigned i=0; i < 4; i++)
{
if(uninstall)
{
if(!QFile(files[i]).remove() && !force)
{
throw Exception(tr("Can't erase the file %1! Check if the current user has permissions to delete it and if the file exists.").arg(files[i]),
ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
}
}
else
{
attribs[Attributes::Application]=(i == 0 ? GlobalAttributes::getPgModelerAppPath() : GlobalAttributes::getPgModelerSchemaEditorPath());
attribs[Attributes::Icon] = icons[i];
schparser.loadFile(schemas[i]);
schparser.ignoreEmptyAttributes(true);
buf.append(schparser.getCodeDefinition(attribs).toUtf8());
QDir(QString(".")).mkpath(QFileInfo(files[i]).absolutePath());
UtilsNs::saveFile(files[i], buf);
buf.clear();
}
}
out.setFileName(mimeapps);
//If the file mimeapps.list doesn't exists (generally in Ubuntu) creates a new one
if(!uninstall && !QFileInfo(mimeapps).exists())
{
out.open(QFile::WriteOnly);
out.write(QByteArray("[Added Associations]\napplication/dbm=pgModeler.desktop;\n"));
out.write(QByteArray("\n[Default Applications]\napplication/dbm=pgModeler.desktop;\n"));
out.write(QByteArray("\n[Added Associations]\napplication/sch=pgModelerStxEditor.desktop;\n"));
out.write(QByteArray("\n[Default Applications]\napplication/sch=pgModelerStxEditor.desktop;\n"));
out.close();
}
else
{
out.open(QFile::ReadOnly);
if(!out.isOpen())
throw Exception(Exception::getErrorMessage(ErrorCode::FileDirectoryNotWritten).arg(mimeapps),
ErrorCode::FileDirectoryNotWritten,__PRETTY_FUNCTION__,__FILE__,__LINE__);
//Opens the mimeapps.list to add a entry linking pgModeler to .dbm files
buf=out.readAll();
out.close();
QTextStream ts(&buf);
while(!ts.atEnd())
{
//Remove any reference to application/dbm mime from file
str_aux=ts.readLine();
str_aux.replace(QRegExp(QString("application/dbm*"),Qt::CaseSensitive,QRegExp::Wildcard),"");
if(!str_aux.isEmpty())
{
//Updates the application/dbm mime association
if(!uninstall && (str_aux.contains(QString("[Added Associations]")) ||
str_aux.contains(QString("[Default Applications]"))))
str_aux.append(QString("\napplication/dbm=pgModeler.desktop;\n"));
else
str_aux+=QString("\n");
if(str_aux.startsWith("[") && !str_aux.contains("Added Associations"))
str_aux=QString("\n") + str_aux;
buf_aux.append(str_aux.toUtf8());
}
}
//Write a new copy of the mimeapps.list file
out.open(QFile::Truncate | QFile::WriteOnly);
out.write(buf_aux.data(), buf_aux.size());
out.close();
}
//Update the mime database
printMessage(tr("Running update-mime-database command..."));
QProcess::execute(QString("update-mime-database"), QStringList { mime_db_dir });
}
catch(Exception &e)
{
throw Exception(e.getErrorMessage(),e.getErrorCode(),__PRETTY_FUNCTION__,__FILE__,__LINE__,&e);
}
}
void PgModelerCliApp::handleWindowsMimeDatabase(bool uninstall, bool system_wide, bool force)
{
SchemaParser schparser;
QString base_reg_key = system_wide ? QString("HKEY_LOCAL_MACHINE\\SOFTWARE") : QString("HKEY_CURRENT_USER\\Software");
//Checking if the .dbm registry key exists
QSettings dbm_ext(QString("%1\\Classes\\.dbm").arg(base_reg_key), QSettings::NativeFormat),
sch_ext(QString("%1\\Classes\\.sch").arg(base_reg_key), QSettings::NativeFormat);
QString exe_path=QDir::toNativeSeparators(GlobalAttributes::getPgModelerAppPath()),
sc_exe_path=QDir::toNativeSeparators(GlobalAttributes::getPgModelerSchemaEditorPath());
//If there is no value assigned to (.dbm | .sch)/Default key and the user wants to uninstall file association, raises an error
if(uninstall && !force &&
(dbm_ext.value(QString("Default")).toString().isEmpty() ||
sch_ext.value(QString("Default")).toString().isEmpty()))
throw Exception(MsgNoFileAssociation, ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!uninstall && !force &&
(!dbm_ext.value(QString("Default")).toString().isEmpty() ||
!sch_ext.value(QString("Default")).toString().isEmpty()))
throw Exception(MsgFileAssociated, ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
if(!uninstall)
{
//Write the default value for .dbm registry key
dbm_ext.setValue(QString("Default"), QString("dbm_auto_file"));
sch_ext.setValue(QString("Default"), QString("sch_auto_file"));
}
else
{
dbm_ext.remove("");
sch_ext.remove("");
}
dbm_ext.sync();
sch_ext.sync();
//Other registry keys values
map confs = {
{ QString("\\%1\\Classes\\dbm_auto_file").arg(base_reg_key), { QString("FriendlyTypeName") , QString("pgModeler Database Model") } },
{ QString("\\%1\\Classes\\dbm_auto_file\\DefaultIcon").arg(base_reg_key), { QString("Default") , QString("%1,1").arg(exe_path) } },
{ QString("\\%1\\Classes\\dbm_auto_file\\shell\\open\\command").arg(base_reg_key), { QString("Default") , QString("\"%1\" \"%2\"").arg(exe_path).arg("%1") } },
{ QString("\\%1\\Microsoft\\Windows\\CurrentVersion\\Explorer\\FileExts\\.dbm").arg(base_reg_key), { QString("OpenWithList/a"), QString("pgmodeler.exe"), QString("OpenWithList/MRUList"), QString("a")} },
{ QString("\\%1\\Classes\\sch_auto_file").arg(base_reg_key), { QString("FriendlyTypeName") , QString("pgModeler Schema File") } },
{ QString("\\%1\\Classes\\sch_auto_file\\DefaultIcon").arg(base_reg_key), { QString("Default") , QString("%1,1").arg(sc_exe_path) } },
{ QString("\\%1\\Classes\\sch_auto_file\\shell\\open\\command").arg(base_reg_key), { QString("Default") , QString("\"%1\" \"%2\"").arg(sc_exe_path).arg("%1") } },
{ QString("\\%1\\Microsoft\\Windows\\CurrentVersion\\Explorer\\FileExts\\.sch").arg(base_reg_key), { QString("OpenWithList/a"), QString("pgmodeler-sc.exe"), QString("OpenWithList/MRUList"), QString("a")} }
};
map::iterator itr;
itr=confs.begin();
//Iterates over the configuration map writing the other keys on registry
while(itr!=confs.end())
{
QSettings s(itr->first, QSettings::NativeFormat);
if(uninstall)
s.remove("");
else
{
for(int i=0; i < itr->second.size(); i+=2)
s.setValue(itr->second[i], itr->second[i+1]);
}
s.sync();
itr++;
}
}
void PgModelerCliApp::createConfigurations()
{
QString conf_dir = GlobalAttributes::getConfigurationsDir();
printMessage(tr("Creating configuration files..."));
printMessage(tr("Destination path: %1").arg(conf_dir));
bool missing_only = parsed_opts.count(MissingOnly) > 0,
force = parsed_opts.count(Force) > 0;
if(!missing_only && !force && QDir(GlobalAttributes::getConfigurationsDir()).exists())
throw Exception(tr("Configuration files already exist!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
try
{
if(force)
{
QDir dir;
QString bkp_conf_dir = conf_dir + QDateTime::currentDateTime().toString("_yyyyMMd_hhmmss");
printMessage(tr("Configuration files already exist! Creating a backup..."));
if(!dir.rename(conf_dir, bkp_conf_dir))
throw Exception(tr("Failed to create a backup of the configuration files!"), ErrorCode::Custom,__PRETTY_FUNCTION__,__FILE__,__LINE__);
}
createUserConfiguration(missing_only);
printMessage(tr("Configuration files successfully created!\n"));
}
catch (Exception &e)
{
throw Exception(e.getErrorMessage(),e.getErrorCode(),__PRETTY_FUNCTION__,__FILE__,__LINE__,&e);
}
}
pgmodeler-0.9.4/apps/pgmodeler-cli/src/pgmodelercliapp.h 0000664 0000000 0000000 00000017237 14160100006 0023275 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
/**
\ingroup pgmodeler-cli
\class PgModelerCliApp
\brief Implements the operations export models whitout use the graphical interface
*/
#ifndef PGMODELER_CLI_APP_H
#define PGMODELER_CLI_APP_H
#include "application.h"
#include
#include
#include
#include "exception.h"
#include "globalattributes.h"
#include "widgets/modelwidget.h"
#include "tools/modelexporthelper.h"
#include "settings/generalconfigwidget.h"
#include "settings/connectionsconfigwidget.h"
#include "settings/relationshipconfigwidget.h"
#include "settings/generalconfigwidget.h"
#include "tools/databaseimporthelper.h"
#include "tools/modelsdiffhelper.h"
class PgModelerCliApp: public Application {
private:
Q_OBJECT
XmlParser *xmlparser;
//! \brief Holds the pgModeler version in which the model was construted (used by the fix operation)
QString model_version;
//! \brief Export helper object
ModelExportHelper *export_hlp;
//! \brief Import helper object
DatabaseImportHelper *import_hlp;
//! \brief Diff helper object
ModelsDiffHelper *diff_hlp;
//! \brief Reference database model
DatabaseModel *model;
//! \brief Graphical scene used to export the model to png
ObjectsScene *scene;
//! \brief Stores the configured connection
Connection connection,
//! \brief Stores the extra configured connection (only for diff)
extra_connection;
//! \brief Loaded connections
map connections;
//! \brief Connection configuration widget used to load available connections from file
ConnectionsConfigWidget *conn_conf;
//! \brief Relationship configuration widget used to load custom relationship settings
RelationshipConfigWidget *rel_conf;
GeneralConfigWidget *general_conf;
//! \brief Creates an standard out to handles QStrings
static QTextStream out;
//! \brief Stores the long option names. The boolean indicates if the option accepts a value
static map long_opts;
//! \brief Stores the short option names.
static attribs_map short_opts;
//! \brief Stores the accepted options by the different operations
static map accepted_opts;
//! \brief Stores the parsed options names and values.
attribs_map parsed_opts;
//! \brief Indicates if the cli must run in silent mode
bool silent_mode;
//! \brief Stores the xml code for the objects being fixed
QStringList objs_xml,
//! \brief Stores the object filters for reverse engineering
obj_filters;
//! \brief Zoom to be applied onto the png export
double zoom;
//! \brief Start date used for filter changelog of the input database model (partial diff)
QDateTime start_date,
//! \brief End date used for filter changelog of the input database model (partial diff)
end_date;
/*! \brief Stores the member of role names that appear in deprecated tags
* This map is used to reconfigure the role memberships after all objects are created */
map member_roles;
static const QRegExp PasswordRegExp;
static const QString PasswordPlaceholder;
//! \brief Option names constants
static const QString Input,
Output,
InputDb,
ExportToFile,
ExportToPng,
ExportToSvg,
ExportToDbms,
ExportToDict,
ImportDb,
Diff,
DropDatabase,
DropObjects,
PgSqlVer,
Help,
ShowGrid,
ShowDelimiters,
PageByPage,
IgnoreDuplicates,
IgnoreErrorCodes,
ConnAlias,
Host,
Port,
User,
Passwd,
InitialDb,
Silent,
ListConns,
Simulate,
FixModel,
FixTries,
ZoomFactor,
UseTmpNames,
DbmMimeType,
Install,
Uninstall,
SystemWide,
NoIndex,
Split,
IgnoreImportErrors,
ImportSystemObjs,
ImportExtensionObjs,
DebugMode,
FilterObjects,
OnlyMatching,
MatchByName,
ForceChildren,
AllChildren,
PartialDiff,
Force,
StartDate,
EndDate,
CompareTo,
SaveDiff,
ApplyDiff,
NoDiffPreview,
DropClusterObjs,
RevokePermissions,
DropMissingObjs,
ForceDropColsConstrs,
RenameDb,
NoSequenceReuse,
NoCascadeDrop,
ForceRecreateObjs,
OnlyUnmodifiable,
CreateConfigs,
MissingOnly,
TagExpr,
EndTagExpr,
AttributeExpr,
MsgFileAssociated,
MsgNoFileAssociation;
//! \brief Parsers the options and executes the action specified by them
void parseOptions(attribs_map &parsed_opts);
//! \brief Shows the options menu
void showMenu();
//! \brief Shows the version info
void showVersionInfo();
//! \brief Returns if the specified options exists on short options map
bool isOptionRecognized(QString &op, bool &accepts_val);
//! \brief Loads the input model and perform all tasks needed to configure the graphical objects
void loadModel();
/*! \brief Extracts the xml defintions from the input model and store them on obj_xml list
in order to be parsed by the recreateObjects() method */
void extractObjectXML();
//! \brief Recreates the objects from the obj_xml list fixing the creation order for them
void recreateObjects();
//! \brief Fix some xml attributes and remove unused tags
void fixObjectAttributes(QString &obj_xml);
/*! \brief Extracts the foreign key code for the specified table xml. The foreign keys
are recreated after all the other objects */
QStringList extractForeignKeys(QString &obj_xml);
//! \brief Returns if the specified string contains some of relationship attributes
bool containsRelAttributes(const QString &str);
/*! \brief Install the .dbm file association in the mime database (default behaviour).
The paramenter 'uninstall' is used to clean up any file association done previously. */
void handleMimeDatabase(bool uninstall, bool system_wide, bool force);
/*! \brief Fixes the references to opertor classes and families by replacing tags like
by . This method operates
only over operator classes, indexes and constraints */
void fixOpClassesFamiliesReferences(QString &obj_xml);
void fixModel();
void exportModel();
void importDatabase();
void diffModelDatabase();
void updateMimeType();
void configureConnection(bool extra_conn);
void importDatabase(DatabaseModel *model, Connection conn);
/*! \brief Prints to the stdout the provided text appending a \n on the string
* even if the silent mode is active. */
void printText(const QString &txt = "");
//! \brief Prints to the stdout only if the silent mode is not active
void printMessage(const QString &txt = "");
void handleLinuxMimeDatabase(bool uninstall, bool system_wide, bool force);
void handleWindowsMimeDatabase(bool uninstall, bool system_wide, bool force);
void createConfigurations();
void listConnections();
public:
PgModelerCliApp(int argc, char **argv);
virtual ~PgModelerCliApp();
int exec();
private slots:
void handleObjectAddition(BaseObject *);
void updateProgress(int progress, QString msg, ObjectType = ObjectType::BaseObject);
void printIgnoredError(QString err_cod, QString err_msg, QString cmd);
void handleObjectRemoval(BaseObject *object);
};
#endif
pgmodeler-0.9.4/apps/pgmodeler-se/ 0000775 0000000 0000000 00000000000 14160100006 0017014 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-se/pgmodeler-se.pro 0000664 0000000 0000000 00000002171 14160100006 0022122 0 ustar 00root root 0000000 0000000 include(../../pgmodeler.pri)
TEMPLATE = app
TARGET = pgmodeler-se
windows:RC_FILE=res/windows_ico.qrc
windows:RCC_DIR=src/
SOURCES += src/main.cpp \
src/aboutwidget.cpp \
src/schemaeditorform.cpp \
src/sourceeditorwidget.cpp \
../pgmodeler/src/pgmodelerapp.cpp \
FORMS += \
ui/aboutwidget.ui \
ui/schemaeditorform.ui \
ui/sourceeditorwidget.ui
HEADERS += \
src/aboutwidget.h \
src/schemaeditorform.h \
src/sourceeditorwidget.h
unix|windows: LIBS += $$LIBGUI_LIB \
$$LIBCANVAS_LIB \
$$LIBCONNECTOR_LIB \
$$LIBCORE_LIB \
$$LIBPARSERS_LIB \
$$LIBUTILS_LIB
INCLUDEPATH += $$LIBGUI_INC \
$$LIBCANVAS_INC \
$$LIBCONNECTOR_INC \
$$LIBCORE_INC \
$$LIBPARSERS_INC \
$$LIBUTILS_INC \
../pgmodeler/src
DEPENDPATH += $$LIBGUI_ROOT \
$$LIBCANVAS_ROOT \
$$LIBCONNECTOR_ROOT \
$$LIBCORE_ROOT \
$$LIBPARSERS_ROOT \
$$LIBUTILS_ROOT \
../pgmodeler
# Deployment settings
target.path = $$PRIVATEBINDIR
INSTALLS = target
# Print the current build settins (see pgmodeler.pri)
printBuildDetails()
pgmodeler-0.9.4/apps/pgmodeler-se/res/ 0000775 0000000 0000000 00000000000 14160100006 0017605 5 ustar 00root root 0000000 0000000 pgmodeler-0.9.4/apps/pgmodeler-se/res/windows_ico.ico 0000664 0000000 0000000 00000343750 14160100006 0022641 0 ustar 00root root 0000000 0000000 F @@ (B ( S l >[ ( @ Lh Lh LLL SSSyvvvzzzuuuwwuvvu{{{~~~rrrPPPaTTT LLL LLL dddđ\}UaYYY LLL OOO hhhƶbkY[G)G= [[[ LLL RRR kkkIpY8tOOC*[[[ LLL UUU mmmn˜bx~?~fFvUC: ~AM~\ZY LLL WWW ###ppp~ØhGhX*_oRG<rlzj\ZX LLL ZZZ '''ssstr_]NK?{l!gWBjn\H>4Z[ZY LLL ]]] +++uuujiʳCĭ>.fZ=qwjwqk[L8m` 36~YZ\ LLL ``` ...xxxt7|o<^T;ëqlcZM #(zYY] LLL ccc 222zzz;uOuj;yóȳpXL"&,zYY] LLL fff 666}}}wAy˹Ƕ|zs]Q)9=ZZ] LLL iii 999xwm@úͻŲоɵƯ~g^ZDƝqn[\] LLL kkk ===ymeA˹îͺDZbdQi~^ۥ|Λu[\] LLL nnn @@@Цj^Cȴ|H_Pܻ[\] LLL qqq DDD{_ngaɼxnie\\\ MMM ttt HHH۩{^odO|v`za}sQ}q@G^^^ OOO www KKK¸øǜȢ___ PPP yyy OOOaaa QQQ ||| RRRbbb SSS VVVccc TTT ZZZddd UUU ]]]eee VVV aaafff WWW dddggg XXX ggghhh YYY jjjiii ZZZ mmmiii ZZZ ooojjj [[[ qqqjjj [[[ sssjjj [[[ sssiii \\\ z```afff \\\ ( @ @ Lh Lh LLL LLL LLLIIIHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHIIIIIIIIIIIIIIIIIIIIIHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHJJJLLLZMMM LLL LLL LLLHMMM|||mmmKKKLLL!LLL LLL JJJzXXX¼LLLLLLELLL MMM KKK[[[Η1.)ma YOte 7LLLLLLILLL NNN LLL]]]͔& A7
*!!UL LLLLLLILLL PPP MMM^^^̔(TI3' {k MMMLLLILLL ]]] [[[kkktszyxvdb\Z`DZCưBůAŮ?Ů=4D<0)!}elVWURNMM`O;+$H?.21/0pMMNLLLILLL ^^^ \\\lllec^[cȲFDZEưCŮA;NE:3+zi[JZOBg^N<'" #! lMMMLLLILLL ___ ]]]mmmsr_^a_gưF?2v+VL4/&ůlLGBQI?jtsX |l%$""lMMMLLLILLL aaa ___ooozxyuRwj*C< NF2aXE/*#ui\˶ưĭªuu|wg% j\''$$mMMMLLLILLL bbb ```pppą˷Q̸R̸QFOG <7.|ƶоcYOʵƱĮªzo.' _R()'&mMMMLLLILLL ddd bbbqqqȌ˷UWðQSK!D?:ɵű®í{ͺɵDZĮ~s.' ]Q++((mMMMLLLILLL eee cccsssǼ̸XϻZ{9.+$Ͻ˹ɷǴűͽͺ̸ɵPG;xiWt,% i[,,))nMMMLLLILLL ggg eeetttÆZǴXG@ zslϿͼ˹ȶŲνϾλ˸űmo! |o-BA?>ø}MMMLLLILLL hhh fffuuuɍκ\O+'Ͽ̻ɶƲоͺ˷ʴůt_ }atqpnMMMLLLILLL iii hhhwwwȼѽ_C+(#Ƽ̻ɶűϽ̹ɵƱìª^QC-!l՟xϚsȔnjMMMLLLILLL kkk iiixxxѾay>2/,п̺ȵİѿλ˷dzů1.&&Z@tݦ~סyϛsƔnMMMLLLILLL lll jjjyyyːҾbz@$" ξʸƳϽ̹ɴȲuc,!>fw嬃ߨעy̙sMMMLLLILLL nnn lll{{{͖оiI¾̻ȵïѿͺ˷62+-dHIxz㫃ިأ{ΛuƴMMMLLLILLL ooo mmm|||ͳiνɷűϼʶg[O+1.dwkȷʹɸȸMMMLLLILLL ppp ooo}}}˾̙tI6(..-Ͽ˺ȴįȷshZ0.-NNNMMMIMMM rrr pppɶڥ}e+ HHGynHB:;:9OOOMMMIMMM sss rrrϼߩ㬂gI6((%#\ZYzsmXRK=804/ G@ ul;OOONNNINNN uuu sss˽ީ᫂ܦ}˘ssTYQ*@: ;5 ?9 NG$aW){n3>IDzP^PPPOOOIOOO vvv tttǽƭƮƭƭŴȺsŷnlõlƷmɺnʻnɻmȹkǸiuQQQPPPIPPP xxx vvvRRRPPPIQQQ yyy wwwSSSQQQIQQQ zzz yyySSSRRRIRRR ||| zzzTTTSSSISSS }}} {{{UUUSSSISSS ~~~ }}}UUUTTTITTT ~~~VVVUUUIUUU WWWUUUIUUU WWWVVVIVVV XXXVVVIVVV XXXWWWIWWW YYYWWWIWWW YYYXXXIXXX ZZZXXXIXXX ZZZYYYIYYY [[[YYYIYYY [[[YYYIYYY \\\ZZZIZZZ \\\ZZZIZZZ \\\ZZZIZZZ \\\[[[I[[[ ]]][[[I[[[ ]]][[[I[[[ ]]][[[I[[[ ]]][[[I[[[ ]]][[[I[[[ ]]][[[I\\\ ^^^\\\I\\\ z]]]\\\E\\\ I\\\\\\!\\\ 홙~~~|||{{{yyyxxxvvvtttsssqqqooonnnlllkkkiiihhhfffeeecccaaa```^^^\\\]]]ZQQQ \\\ ( Lh Lh LLL LLL
LLL[LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMMM+WWW NNN LLL LLL LLL}LLLLLLKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLLLLLLLLLLLL3MMM KKK NNN LLL LLLQLLLLLLKKKQQQSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNNNKKKLLLLLLLLLLLL LLL KKK LLLLLLKKK{{{YYYKKKLLLLLLELLL LLL LLLLLLKKKQQQGGGLLLLLLsLLL LLL LLL LLLKKKSSSȖzpoooonkiijmnqEEELLLLLLLLL LLL LLL LLLKKKTTTɸ[665432-(u%r$y&)+O{EEELLLLLLLLL MMM MMM MMMLLLTTTǶV$#"! }]P7/.(;2OD eVl@yEEELLLLLLLLL NNN NNN NNNMMMUUUǶW&%$"r/( 1*UI t2pEEELLLLLLLLL OOO OOO OOONNNVVVǶW'&%z# 0& RA,A3#'!`W'yueEEELLLLLLLLL OOO OOO OOONNNWWWǶW('!7/ 7, qK}OyLiCN<)
C> kh[EEELLLLLLLLL PPP PPP PPPOOOWWWȶW)(fX!lIR|P{O{NwKN<)+)fcWEEELLLLLLLLL QQQ PPP QQQPPPXXXʹƵW*# iT>VT~R}Q|P}O~bA '&ifYEEELLLLLLLLL QQQ QQQ QQQQQQYYYijT+pb 5+ }VXVUTTzQUC/85 {weEEELLLLLLLLL RRR RRR RRRQQQZZZ3m=p=o=o=o=o=o=o:mypŲT*A9kV?][ZXWmKB5& si2tEEELLLLLLLLL SSS SSS SSSRRR[[[BtSSSSSSQ?rxoƳT((#qQ`^]\{U/&
RGCyEEELLLLLLLLL TTT TTT SSSSSS[[[K|dʖcȕcɕcȕcȕbȔYÍ@txoǴU%+#[ca__uS 3,
m^@nEEELLLLLLLLL TTT TTT TTTTTT\\\Rrϟq͞q͞q͞o͝gʗYÍ@txoǴU&*"^fdba]:/# QEth)EPUUVUUUUXt{vvvvvvvEEELLLLLLLLL UUU UUU UUUTTT]]]Zԩҧҧ~ҦuϡgʘYÍ@txoƳU++&
qTjgedcpQ" G=gYv #&&&%$"2s_ZZZZZZYvFFFLLLLLLLLL VVV UUU VVVUUU^^^bٲױװԪuϡgʘYÍ@txoŲU0RG OA1ijhgee~gN
91
^Q}l -sebbbbbaYtFFFLLLLLLLLL VVV VVV VVVVVV___iܹٴԪuϡgʘYÌ@txpŲUê3' q^HmkjhffmQ)" -( VJue /smmmnmleZtFFFLLLLLLLLL WWW WWW WWWVVV```r߾ڵիvϢh˘Yč@ttkıT42dW qWomkiggxX=1&" NDqa .suxxxwpeZtFFFLLLLLLLLL XXX XXX XXXWWW```ohַѭ~̥sɞhĖ]Q=rtkűT4ê4.81 '!{_pnljhh`RD4
MBo` /s}zpeZtFFFLLLLLLLLL YYY YYY YYYXXXaaah{Cm?kAiBiCiCiCiBhBiyjıT5ª5ë4),& 6.&gqomkihenZCMCrb 0szpeZtFFFLLLLLLLLL YYY YYY YYYYYYbbbondcbbcbcbcbcbdbhgsjcaaabbbbbųR6ª6ª5ë4' I>2orpnljig~gL! TH{j 0szpeZuFFFLLLLLLLLL ZZZ ZZZ ZZZYYYbbbqpKINLNLNLNLNLNLNLcauǴNűIűIŰIŰIİHįHįGįFįF@«8«7«6©53j] q`LvrqomkjhwbJ ,& ^Qw.ryoe[xEEELLLLLLLLL ZZZ ZZZ ZZZZZZccconTRYVXVYWYWXVXUPNa_uűHƯBƯAŮ@Ů?ĭ>ĭ=ĭ<Ĭ;Ĭ:ì9ì9«8ª64,TI SF8xusroh_{]`eS? =5 n_+n~}||{zEEELLLLLLLLL \\\ \\\ \\\[[[dddml`^gefefegefc^\QO_]qƱIưCƯCůBůAŮ@Ů?ĭ>ĭ=ĭ<ì;ì:«96,I@0)"~ezxv|`XI84+!
*#bPĭ=:-/) qbQr)# :;; J=/hXI7 ^R ""! GEEELLLLLLLLL ]]] ]]] ]]]]]]ffflkzylk_]QO][nƲJDZGDZFưDưDưBƯBůAŮ@Į>«=281 taj ---/' anuW
LBr"$#"" HEEELLLLLLLLL ^^^ ^^^ ^^^^^^gggrqzymk_]QOa_tƲKȲHDZGDZFǰEưCůBĮAì@¬?8ND |g«v% abb,,-,% ~aqni;1'7/ vf"%%$#"! HEEELLLLLLLLL ___ ___ ___^^^hhhrqyxlj^\OMcaxDzKȲIDZGưFD@=:86bW tcĮí«]PCuuv<<= {aurpodS@ $ j\!%%$#"! HEEELLLLLLLLL ___ ___ ```___hhhtswwzysrmkfe`_ZXTShfzDzKƱIE@9}1|n+ob%k^#XM
qeWŰưĮí«zLB7 lWzwtrptX
^Q &&%%$#"!HEEELLLLLLLLL aaa aaa aaa```iiiurokokolplpmpmsoh®JC8oc(IA-'
! #
OF=ȴƱưůí¬ª~hl|{yvtrdSH~ &'&%$#""HEEELLLLLLLLL aaa aaa aaa```jjjýȹdó[±Z±Z±ZZZYXU@rf*0+
>93i_UrxcYO>73˵ȳDzƱůĭ¬ª}zxvsk3+#KAz '(('&%$$IEEELLLLLLLLL aaa aaa bbbaaakkkġǵWɴRʵSʵRɵQɴPȴOȳNKƵμs mbWʷʵɴdzƱůĮì«}zxuoB7+A8w ()(''%%$IEEELLLLLLLLL ccc bbb cccbbbkkkضȶZ˷V̸V̷V˷U˶T˶RƲP?;5 wl˻Ű®ппϽ|pc+'"ʶɴȳDZŰĮìª|ywsF;. ;4t (**)('%%IEEELLLLLLLLL ccc ccc cccbbblllڹȶZ˶W̸W̷W˷V˷UʵSE=6)&#dzƲıïïǵRJBym`λ˸ʶɵȳDZŰĮ¬«ª~{yuH=1 2-v )+*))('&JEEELLLLLLLLL ddd ddd dddcccmmmԲȶZ˷X̸Y̸X̸W̷VOWN# # ˹ɶǵǴƳűİï¬]TJIJͺ˸ʶɵȳƱůĮ}{vGпͼ˺ʷȴŲïѿϽͻ̸ʶɴDzŰíì1*$$U<5`xq̛yߩިڤ|סyӞvϛs̘pŔn{EEELLLLLLLLL lll lll lllkkktttٸʸ_ϼcоe˹aRJ& .+)Ͼͼ˹ɶdzİ®оμͺ˷ʵȳƱĮŮta 9\;jyr̜z⬃⫂ިۥ|סyӞvЛsȖp{EEELLLLLLLLL mmm mmm lllllluuuٷʸ_ϽdѾf̹bSK' ν̺ʸȵŲïпϼͺ̸ʶɳDZư?7. 'P;Iu>pyrΝz毅殅⫂ިۤ|סyԞwʘr{EEELLLLLLLLL mmm mmm mmmmmmvvvطɷ^λcϽdϼc\T, Ͽͼ˹ɶdzİϾλ̹ʶɴDzȲ~o` FhS@r{tϟ|곉겉毅㬃ߨۥ|آz͚t}EEELLLLLLLLL nnn nnn nnnmmmwwwٸ̼f˺d˻d̼dwn; ν̺ɷǴűîоμ˷ʵɴ(# +XANxL>q~Ξ{߫ંݨڥ}ע{ԠyҞwʘráEEELLLLLLLLL ooo nnn ooonnnwwwؾäz\
jheϾͼʸȵŲïпϼͺ˸˶îWMB.#;zYEkFnFoȢϨϨϨϨϨΧΧΧԺFFFLLLLLLLLL ooo ooo ooooooxxxԴȚxi( *)(пͼ˺ȶƳİѿϽλ̹ʶqb eggFFFMMMLLLLLL ppp ppp pppoooyyyҰ͚sϛtS>. zwvν̺ɷǴıоϼ}m XWYGGGMMMLLLLLL qqq qqq qqqpppzzzҰѝvۤ|vX
Ͼ̻ɷȴű®ȶzna XWXGGGMMMMMMMMM qqq qqq qqqqqqzzzɧԠxݧ~֡yrU? .--Ͼͼ˹ʷȴ®óNG?
`_aHHHNNNMMMMMM rrr rrr rrrrrr{{{ƣ֢{ݧ~ϛtkP< %$$μzd\S94/$$$zy{HHHNNNNNNNNN sss sss sssrrr|||Ǥ٤}䭃ੀݧ~Ҟw~^F
A@?ƻ|rb[T>:5! )%e_;HHHNNNNNNNNN ttt ttt ssssss|||Ϭۧ~豇䭃ݧ~آzz[K7) 511]ZWlieqmiqmhokehc^ZVR?;9
60^T&~8IcIIIOOONNNNNN ttt ttt tttttt}}}ӱީ쵊豆䭄ઁݧ~ܥ|ȖpkRD<-
82OH"g],~;ENȴSU˶RcIIIOOOOOOOOO uuu uuu uuuttt~~~Ұפ|⭄ߪܧ٥}֢zӠxМuɛy{QJvk9g]2[S,\T,f]0g^0wl7BJPTɵXYκYκYW˷V˷UʶSeJJJPPPOOOOOO uuu uuu vvvuuu~~~ʬ̡̢̢̢̢̢ˡˡɢĵ˹\κ^н_м_̹\̸[ϻ\ϻ\κ[Y̹Y̸X˷WʷVʶUɶTɵSɵSȵRȴQȴPiJJJPPPPPPPPP www www wwwvvvǼ{ƻxƻyƻyǻyǻyƻyƻxƻxƻxƻxƻxƺxƻxƺxƺxƺxƺxƺxƺxǻx¹KKKPPPPPPPPP www www wwwvvvKKKQQQPPPPPP www www xxxwwwLLLQQQQQQQQQ xxx xxx xxxxxxLLLRRRQQQQQQ yyy yyy yyyyyyLLLRRRQQQQQQ zzz zzz zzzyyyMMMRRRRRRRRR zzz zzz zzzzzzMMMSSSRRRRRR {{{ {{{ {{{{{{NNNSSSRRRRRR ||| ||| |||{{{NNNSSSSSSSSS }}} }}} ||||||NNNSSSSSSSSS }}} }}} }}}}}}OOOTTTSSSSSS ~~~ ~~~ ~~~~~~OOOTTTTTTTTT ~~~ ~~~OOOTTTTTTTTT PPPUUUTTTTTT PPPUUUUUUUUU PPPUUUUUUUUU ぁQQQVVVUUUUUU もQQQVVVVVVVVV もQQQVVVVVVVVV ッRRRWWWVVVVVV RRRWWWVVVVVV RRRWWWWWWWWW ㅅRRRWWWWWWWWW ㆆSSSXXXWWWWWW ㆆSSSXXXWWWWWW ㇇SSSXXXXXXXXX ㇇SSSXXXXXXXXX ㈈TTTYYYXXXXXX ㉉TTTYYYXXXXXX ㊊TTTYYYYYYYYY ㊊TTTYYYYYYYYY ㋋UUUYYYYYYYYY ㋋UUUZZZYYYYYY ㌌UUUZZZYYYYYY ㍍UUUZZZYYYYYY ㍍VVVZZZZZZZZZ ㎎VVVZZZZZZZZZ ㎎VVV[[[ZZZZZZ ㏏VVV[[[ZZZZZZ 㐐VVV[[[ZZZZZZ 㐐WWW[[[ZZZZZZ 㐐WWW[[[ZZZZZZ 㑑WWW[[[[[[[[[ 㒒WWW[[[[[[[[[ 㒒WWW[[[[[[[[[ 㓓WWW\\\[[[[[[ 㓓WWW\\\[[[[[[ 㓓WWW\\\[[[[[[ 㔔WWW\\\[[[[[[ 㔔XXX\\\[[[[[[ 㔔XXX\\\[[[[[[ 㕕XXX\\\[[[[[[ 㕕XXX\\\[[[[[[ 㕕XXX\\\[[[[[[ 㕕XXX\\\\\\\\\ 㖖XXX\\\\\\\\\ 㖖XXX\\\\\\\\\ 㖖XXX\\\\\\\\\ זYYY\\\\\\s\\\ mmm\\\\\\\\\E\\\ S𗗗zzzddd]]]]]]\\\\\\\\\ }~~~}}}||||||{{{zzzyyyxxxxxxwwwvvvuuuuuutttsssrrrqqqppppppooonnnmmmmmmlllkkkjjjiiiiiihhhgggfffeeeeeedddcccbbbbbbaaa```___^^^^^^^^^^^^^^^]]]\\\3^^^ ZZZ
[~~~}}}||||||{{{zzzyyyxxxwwwwwwvvvuuuttttttsssrrrqqqppppppooonnnmmmmmmlllkkkjjjjjjiiihhhgggffffffeeedddccccccbbbaaa``````^^^^^^^^^+]]] ^^^ PNG
IHDR \rf lqIDATxyeYY]kg5tUT=M725 @H@hL}5 A"AniykkuNݪϭ{9{:y3 A HWJHF!čv!8 Xj_Szſ';fsN}ΰΫhG)u )mRC PEZ=Rʗh <{%F> X߫0>0Osu^=:^7<> Հ_> Q_ !NY-Gcڢ~RJ_s5w~ߍ}
}R7k^-Sod?|4 N7Ω9g4\3h^}շ{ｪۃw k?' SJ/@kmXkW ת9u~yyotK<8JsnK/9ٽru>ٱBxw1}k>[)V&MS&''nd݈` t];S]ezl%;ݘnszt9'|{R.6|! t 5 xڕ> e/{[n=taXS1癲 \f K)ٿ?{صkJ_'| OݺFa,4,k0,=g-ǽ~lٲLOO )_%uS ^\}LLL<- ЉuNC3\.7Fұ7eQ 4MٱcG7{Oir饗jV 5 0_vzܟ9 {aG3wS i4%PL$_ 3U Gt$s4Bi7I2G Yuo5c6Z$ozff n^00
aөWBR09990!8`h^tsWJXBg#ԭqVs4,}^j,d$
_wk~; 5UgZ3ǟ*Ӭ[E7s94ja& l yr\~:
p x01Y
\X
+
1A ^\g& m u1Y`۰h kEawvkg2ïGE E4j 1Ow?
c%t4NapvsS}&]6La(} `:8lI>~RDT:#Q^g.--qU!bݸϳlٲgNanF4%MӞ$;{M)MӾ_s%Gz8j_t0ҙVl߫aw^ӰkXhp#Z!0̿Z!wTBRHA 5 h"(3f4LsEBPV wdh`y d~sl_8juX84| 6dnDZn 4`CØ W/O:08#ۃ`s }ͳ !IRIC0?0]ѥh ~;Ls]F:NR"[-ᷖ+sRDQԓ9j~9qY!@H#
S_7 >|'g~; 59MOO377b~ @ڈ?LTZj@V&n/J r˩Q/`|_͜V;^4AֹbeO z|X A(u4*P v2α-]OH r&_І6J:~F=O6. V0`7iJ3
z{Ԙ~? Á>
[ 3uæ5l$7b 7k~\{(| adpU: vTus'k%#U
؋Jaf~s{9(\Ws 4&Y k3H0hMѠyI@+F FJy
Yp#4L沼̱cdž6n drrrCYbXiH =9Zk+64S gTA8^Wn!нB ^9+AEI9g)^/ {Z_ ԝtT T gڽ
Z 4LcK)ݼnYgn?411!_V7%u+ξJMVj_gF6v``JGj Ss4L+LT @
h4)ĽkX2h<^MvrڟNtj үH*zi-Z0f(P%b=s Ћy 0hNFއU(T*| ZQZ`~5ǎ c߾}6x!͛ٱc Dgn bn$~ _Zk[0`ڡf))1a#08Kgh@̢I)9~8wjsssl۶MȬ%gν?ڴ^aR-M&zHJɃ>?NA@ղW^y%RIU1ЩԿNQt7ҰNFCU frr)%ǎ C)EED}q6o dcNG aϞ= ?3_-mٲ۷+ uHMaHZ% C{"QL=_ͱVe幯t+:aÝbrLTBAEqL٤jinFFm~
F" Ҥ7KӔ%}Fу=J4Js UZkP{^?:'u#rKHp`dmo~VBQcIJI
4 F%D%`ffٮL
jAЩp(z]/1R@*^
RP`9L ze2{N7 ة`$ 0ḡ{q2ma0Q_
;Ơ0HdEdń̯ТsdQw1W9 @e^oFhL*< `O7BelլtnrU4MQJb^3 CiId;Q w /usU9j9L0gֹ[} (@Oe_> thtv.~ ,]r=QA}_572< Zxa֨2!)%LOOF?+phLa}XNl6Y^^^wcLVI~BPTNV0+MzP1~~&|zKHq{k >0U$l蝀gr ps
%{bx
!_(
2T!: <6=uC "zo ǬQ%!LiE[x
L- !1-qE;^ø뾿|q- BGAg FZ^\ЁV-\{u4SۈyЩAd7
c DZk4$<~HqXm[E\s1J^VPjO@1 ded뛝`ѹ2$fR&N <Ė) 92Rm; |g&BP. `U!cI`jg#vc=|O~'l5Qh0g}
Ύ3űBHZgl|٢=JU ٱ* Y
n+A+A`i1tu)t6WB{0)$J+^W JT6sJi}O)RٍKVcjj
)ĮOU(;nIaU׃ hӍ{薠}IH4Iӛ@e**-hk*!# 63&AJ'A@qч,
m;r5BJL[3v^wӊvdlv{K j5js[*UJT¯TK'}±g\5 TH 7:MIB+:?N냴$p
V77Rd;R,g?ZY՟ z.vw;ig"MSJV0 IF@mBƞX 6_L]r[یWc|vJȰJSR/q^iίTZJZOwj^+ 8oLi$ <^hRJ9>*~cfFB5ԅ3οƷ /muIt9Ph ѦU~$ Q 0jYXX8 9/.!9T+ ?v{J ~|xMߕ{\M߾GOHG} Ď23y>~C?~~kMd"I3hN3PG319^ #ڽ{Z2m;d
H 8"x/"̮M4Ip%_ U&ٷӜ?2NhTLa \߸nɷ͟&~+| Ck 嵯{5;/FI'qߍݭtj-i:iQI5c\yՕ=կy 5> {Yv^x!r9O`$n~.Bi'> m4/zY'(V)ay}|&/cݯ
/ljMyFd . f{誼(H9d~8&S.W
hHTA(a/s(ۏPS~o~R"QC؋5~G'
)@ ZRV$VSa
y z3g x;x/1JR$cnxK=tn<מFSWhj+i *A#hm 193Oҫ]kH))J4
r3Zr ߝҪ[MaO]p1!~
)eW bF7AŸAp{n { ݅ͦMGr(aĜ--}So2^\aJ;<+X%*{#NRs +SPw{{8~8QL$̟8Y'1w#5`vt^F_8l;ȷ?|:0~M[7g, sfVo E G:N-CiA۸|Gh24I +w˟\AH cǎH$jEQ t^
^:{#a%6!ыԤjEh&b~³}=g:Kz _S
݅- Daww{сIB;o1ӛso{;W>hIf{#>SO,,γHLդ5iE-,0NTwKإk ~CukN OMh- e>}.ug͑F ̾\ӈ[v^+v7uQInt(V[)Ȏpmv/Vv^z)ˤim_ǎ1')KTj3>1,Zi<)Wy ` $ _`^ڧ<O<'n5>8E:Ͼg*;Y{`w]e~;+5y;D©! F ۜbrr!u%i>r}w { rV!Rx+ЧZ Cʥzۋy{qrBi ~Ѱ KJW \u4sy ;8zxVW<۷l 9`~F{[_Arܑ$OkfZXrq{x^c}/|
|YGo%nŭ8f!jp 4QfO s_@+IjauXvS~5* 䇒 mӺYٳ`s
ZVw]!D1@?﹋]1'bܭԪUS!AI"L2U±sI&|2T9E0 O 6h_hX")zDifljޝyy,AZ P9jPf6{FWhڝ''@X5(FX
9G;,41T'&_x&__gnv 3cS2Ch^0DMΞ3
Zug2] fql~}RԘPZo@'?l7i5%;=O1Q`BLThe?aVgi9ΰ l2eKo<,_
fYPrp`لVZ'PؔݕƳB no|3!Qq
199!Lh"hЊ
D f[%uU KV
- 9)6o\.S.O^ mlak::`Ve 61EM#}} l!7<DI|36c}: ÝMYgl}ڹ [9pZ#kEjwM>\E/yOā =|TO 3稇47D4M4keSwa*
B(,7Z 9Ҥ66A$誮z/%!t ߿vVZYi$I8gWvfK."jEɗg5n o`dz*Q5 Ѩ!LZp\3c.Hh* U6w^[zKL5]OUЮhA3\4$Iݔ3~SJIuL:SZ8LNU;:vvb+0a_-Խ#y
!
9qF!L4/^C^_{I+Osáb`+>aF8Ŭ\MOR4$#w,ھ6I_)JxGZͪ'gHSe#ن80_߱&lD^g__$"o0
Mb\3fv[p
5L AV/-mE]jy[QL/bPhZ=u_PvLO4 iQsv= UuȰ4^3;ɢ9zE[ii<~8 >x*u
2. ȩI^FYq;^'(-R@zm?UV
_8$W0UNOdK1:.34s,6ֶBC,=㊫ii? t y
߀G?p kLq(OLMs5ϵKVT88,XN Eܞr`4j6E DQ@ZK8I7~[= .6u|6Wp0q}첝6Uۣm:)& ;w6uv&a#~vu
Rzs\x;4 ;ʦj4c`\o Bv]*4ɬ
-&vjCe ,8d[Uݯ#pWZ@h{.AfPEaLpzyO?FdnFpm ުծ9P.Cw:
_\;
˵`nW@e->ʾvl=\7ur6meAZQ#eP!D
3T8i3h
N2={pR*ljJV^#P,q&F
M8,efe 6 oߋ^#)Ǔ]$eIn;jvxLa cA:Eǡ,aw\v#TMrپ9z`u$6N>#^ch M7"mF M@A Q=!,RxNs^Glt L\IsPpkB<㡇G(
Uڱ`Ec dY7+' cU( ng j]Y!֧@.
>Wi̶sy Ix8PJПcTߢ
lp$ Ar0 cwTVuEFͶoV Hy{)@$4u >LVm/1c*=1X;9pm
P# &vl"r`|&p|X((/u4T啯9>ӇQJ!X8$j R%mL#Ϭюk=уv4Ty &M}+& ^TL:{#bbZl4z
O{O@ ="j ^tQ~&
pxmuÆLY$
֟P 3*lW H2f=O-.:ØR & 8 묕+ g53Bϼ<3 Y<+& }JRʬo3===rHJy@7>/ RdG
w5&(MS{\ti:2f`>0u S+|n.c|AraQnŠ1O:M|N]cQj#[u*b&1R6m'}9=\d| /]vuf
Zf^-W߁ Q"RR_Uoxcmۦ1'Q#[' MTScv'A+II:АZ2{9%K6D"ccc6^6Ѓ: 7z xهJk^ jcLn; R*طg7 ~ PN sQa
Cw;} ">"6at33<م` (kAXp;|[B묬zbv Lￏ_NR%flr/F:A{pf}iߣy RFiL CZkgHVEɵW˔Zk8^Q0Hûvwf=˯f{i4<}\}s Hv&
\B
pw|cw[pw{jel^Bo|I±ݜ379E9Z@th
VjS9DHU JJ_UpMUʅ۷UkFZF~f7B=X+'I 8Y~֚y :tk#! zgd嘷{*M~ ;a'K24N>]a;Ej1p5JiXZ-±i;o\-#:8eCQ-2.3& v=rNmlBf0-ͣp@AG#K!$o{~P*҅EVdgN@kn"PILhH0cBUBR5w*2
!ɵv\D%`0z^n}u !Pq/a{' ͺ\;rvgw78aKkMa(q7}M[E:;etP^~/-;Ȟc80 "cc B' s5]ngDz8zj Î۫eh~<;O9k=s6VWg{ ¬
?z ؏ܩS0»yo^K ev9@ .iqYa᧴flb_O _z ?ʛ/yF YUG9ĬQ av,2+R):M !Y$e9.I=tk>ZƚhuKG gM5 $%W?iLƔaatSwi]ݶ]y ݼTZ3czYNʳ6} ~ż_zr98Fd9Ec2g|Z^bm_MCuZ ՅO=X(0P'cbS qy1%#^jZf 0Nn 2;]q qx$cc[=q8.
kn ']vαBw\s {v?ƫ~g(Wqy[ UEjrS`ҙjmI4!;}X|Y֣Uu
y9 ؛ Ud|rE&f (B搞h oejt[N3: 7Җƴf_K=$]vOAz -ձ1$g\06tz)^{~C.ۿ+#jEE 3jzNrNH2Y8<'L)gŨoR̝K3'lDs"hc{zL A}Tv
#߉/,1}\1~E ɏ9 ~8z0B
e;@pAUN2kHZ&75ٺ\$5N!L9 ES*: @n(Dt#* *?8rCFrQe,bJ*|jbL[6o/rs vsK]6
dPj~NwMY֛lunmcQ?*UyK[J
x{=OmCz*c4:tB}%
K 6@GZzx2Z)|^X"4ƀ^ \vZS< Y=| 5aX"cggi]˘>t[@e
x7p2)'2g:B;m$ZHI"dVgRG0>$?&WӼ 44hXkKS 45 :tȢJF SaFɎ31)&pTRL]t^sx?dm|yϽg\} _s j5OB/&K}Q;o2 ?]I+("Y#a!TN.۸sBy7&I~ڄNfh
(Ef_*Z-*9Pėv]ր E#u Y`M} =k b{֝$?` lJ ts0=( KIW8pzMϺ vDy¶s/d;q5׳uy*qNAz$> `,??#bWN3h`1fiyI#(2^ QpV3j 4 )QBB I5q嬵0tz
*hLox[&(VQ+N <(;__]gg$giB" ,J8~}D8=Cey/BIclIS
/a_36o;gmmGуЪ8@ο>Юǹ7qW te$q"q8
cH!R B _
t`0
EX 4 *w?4-]=B\Sy u7շEEV 'V4Pq~gE1*jQo,l` c
MqM^$h6I[
flG-T A4ќ-<I$JeJ/x)Q#w4yY {AYXl <|O>ڿq5& z#t* 1D3x?W& +M5~ dbu[ɵYfl%}*Fh$ΞU=`L-
F҆sfvRhacI!$Rxa4,*~_W5i&/qd>1 {^>ǐ̱((D l6Fߛw {˿ TU/4m
YL/Ϯst ۇ:6V(%DXB!l_^$Yo@ހ Ѯ!̿~B
!`N*|kٔZr=(k
@!8y> Y XA. JfDK<5| ᇄs}K u [M %5 >hnGeyi!]w _B ~~zN̟]}+v
P6cy_ ԅ=Ixa -=RgONrO_9'kW, " '*~+%bU!
Q +'N({ t^Oo1/#2a._] +*%7~:AP@<&eQ) g_n5EhZl۶Of$&7"x;_C R.aHX"Je#: Κ3 ߬ M6|B"K_ 流 qx7} b ?j7mBf8 ._={/Λb<|C/dkyܾ˚oy۲F{~?ѣG =v#033ïW89.@e ]{!y:`z4,#\Ae3p
7ר(~5Tfݵx9Ӫ1KћO+O?YP r~LC26jwoĈ@ +b|Eދ !vrɿ&C?4糞 T)HҘ-QoyΕW^ۿÇ@ 59~) Ǩ ;އ!j,YpvccAW!*5#2/"ɴnȴ?? 0Pk0{iB;ZY^8)t i^Z &`2Ӎ@BSЅǿ<($rM4w79Y[x<mmF )Q[pejoo s v@Bc v}f6k42;%ΌS(|Xc ,eP N倫T*LOOK!^G~wuN]GC_0,6+h+]@ ]kM 9U KE|w7O?Oos+WШ*0$ab6o5;<:Wb:ki#w}}-TkP 璋/D FiZFXtp411Ԇ|)$B0|z G X D3*lXbVR:lR cJi''$$^y;9 Bc ^ڟ9 i#f228\Wp^"Ow7 } aebj9lJ WyoeJ!įe~mr¾;t c^{Y='*X@KIT"N_4&i5N(rWi5i*ax{`!&\h D 5d+Ij+2^V$ttL^*(!)#~+f"KFRD ×o(^|wD:eYCÒla|n [.T\t˳dT ȠL6Ʈ{- E$Z() kI" ϟ9ƕW^kyh)VC Ec1B5h@x+~ nklWq â$6Kh<(,%χ1}O
(N
u @T"I>w{6 yUGTjI+g?!$jZ| & ߊR dr3R)8b&Khs'ScT, OQdYgz]gvR oQ䢪w}; G4puc8FCv]\=u*4ÊM1'3+4(%idrM?Ic?k$*ieBZeJ
!oTDBF 43>#}T jJLZ45&(W^;{L+m ʪA)/,ח/8 $IHMCz "j vl*+ծ}:2CYm~
Fw _ kHr 9qē $U8ÏR htn[9>[%_! <4E)b빔݉Br
or=9_ #C&6~ Z%15"0Au[ӐB[fMfքsOAj@5G e߾}=bpf9 9B^.(N1{SRn c_=4ъ2&<(85xU60jE.//福RZy;%? CIn*R:~?1z 7 v^FPl矞D+9y)(\ :>" *M3 |8ӵWe͡ff F"ظ~!OH<fn#(IR2F:@v
iO }qq a"S_ oX~ʘ O䌍|vn9Aߑc~#|+oߊ1Nf_pUx24 Tj(|W_g6}[#@jY'+Zi]
8d '68
)$G7{K 9-,#\ )\ d?9e 3%C5j@F q2wLJ!H*Te 'p +s^"8iب@vL]~=O>D\jRT_{ TFLL#7QC$6k
(9r(Gh%5uD^cs_j g /Z ! Cf{@zG# tlj&jDE$:"IcUJ$}2x#{i!~' 9ʆ^9\C*G/D$I%;*E y x~f`[ߟ2or
O@X
yp7y6rS zK
QXAl͘_dخ?1+ Oj`2 M^ !azzm=C1z4@$N[/Q4ZڴN_T bdxG:ǿtS{@
$o९y0= +YBY8GC|Ȅu$Yy3R(WUƟL099(WўswVt%8
s-P;KHUR&Gdeow' lce NP*
'gy~UdyMGI@t wnk #~]Y♈;5tL09ٌ? 91,W~ft+iy qsonF1șN[&i J~ɬbAG* G 0C(⟽7n}mL Y`Sj,̷&G)t~~?Z%h;ݹHh+
NQ NW:f8V N[Z0j-'${9Ou/3$yuf:>[:W>ak@Kh5j
7ʈ & &TBM>yY"PMLLm9~WY`ԅ03iq:4 fS,7wAV ǿ#]ώԚ ] BJ Fk!H 䖛?)?̳ ՝AXB+ȉI9MxӈZ
& %ȹ2!QI)tL76O`5ٚ avD3Z_p9dΒ]Fq H!H珱wje .T'3nwlT1Wey;QX^^FJAX#r-;HjJ26MifjzprUH^DTb2 *jϺ&Q=WW =,,D2E8Vvv
F;S F--Ul;-; ַ=c VO!dyyO
VMdzbpfojp|Q } % 4J>o`њ5h Pђɢ ;B#
@k㟎2--5g[_h ku< Orh?AޡxfEԦfIg [>gy1P:<.' $ssLm;&i±qd UٮB Cj:AytRb97km ^ U
} {$8 Nw>^X iЍ:ͼ0~^@j Ѵ.Zi )\M!I.xeI~)̛ek)8x >d>4'dw E φLnа3o$rH"G1)B[(Z9F0 ZkkIRo4-n6S 2f+E! 9; A>=̐|=HٮT" GHI^D GuF˵{LC MDa퇕ß|
c Dz WJYL"<)اȞm$ W
.fSSg cSl?g]aA$1 "Rm}kJ!< `jjjJ5Dkw;tIAn[ 53gVdef
4\ M9~0 LMY߭3@&ׯM 1鑃~?FX!U0DIR#9bϟ7woڴ /111AVCJi|VF|߷՜ccP C0n߃ Q G pAOWK'6R^ dj6o O _K.⤀3]?7}4i)Z (xt£-JU[)RBOz<Q{|g||Jưk < P S70h
cs ^F,CGhW]@ ˝m,njUk`SA{+`Af m>܊l^|-/_[n=O$$aӬi^z.^Բ JLNNj6-*LHB4Qx&Ddyi)|ߧRX}-̟~ cgMOl&Ӆ!dLT 8zI0mx^
)]uvt2?RHTI,5+n>~s(Md ' @Pig3~swuvm!KGO_b˩-7,#K%H$Uf̞B!@)8@V:}% Q '0g(;y[ =~O,I gu*Aiy Ԁ#j^EdU{|\ܗ:F:ـN*T7yS9＝|DIh==z /y-$
}Tiӧ)i¨j!0g?֚jMS'0^I
0@!=Yr5?=KKt_c܋A47-mN;_Exw?VU($M
?c4,ffV)Iѹ0Pi!0fMC g= sX-Ri&*5jlTsxK1v q_>eݷY?Ď~4!A'ns@T+. vnej/l60 YҙF`w~W+P'[K~7ħ pjj4
tժrw K!X:4Oi)}%^z5C <̫.0`
Ry4e9RVtǒ8IP*%IsE
O :U$Ji1GwiAFiw%
:9XA>qK
Ae)BY/uFSĮzkV_)౯`:h?Gh)d^TǮPJgߖ @LPT#ɍ1Xnt~|z 2 {ock} ?0t[0 ng?=<_8G 7E)En
V4!V2 [YCY0a ?Xrfwt ̄# |_ʊҔZfj^KT&' 5K: iww~?Q r :
x&AuS 0;ikJJtkL!U>q4XА}G (j@6AsV
KLTjToSUwrAVQ }"аЙ"dzA] *O/ C$/|Am{";mhesmN:9}j [ ;߈2$ M[}^ X(n=FFQ>jGQN?w~ݴOuҐ:=q:۴4j *jiQ_&ZYFhϐ~+5Zq8Qe Iٙ+@ARy 9WFB= ,IT&RTV=JUVzbb[N
sF ^d \&8[
sA{'A ]9j6PIN
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "aboutwidget.h"
#include "guiutilsns.h"
#include "baseobjectview.h"
AboutWidget::AboutWidget(QWidget *parent) : QWidget(parent)
{
setupUi(this);
GuiUtilsNs::configureWidgetFont(title_lbl, GuiUtilsNs::HugeFontFactor);
GuiUtilsNs::configureWidgetFont(pgmodeler_ver_lbl, GuiUtilsNs::HugeFontFactor);
GuiUtilsNs::configureWidgetFont(build_num_lbl, GuiUtilsNs::BigFontFactor);
pgmodeler_ver_lbl->setText(QString("v%1 ").arg(GlobalAttributes::PgModelerVersion));
build_num_lbl->setText(QString("%1 Qt %2").arg(GlobalAttributes::PgModelerBuildNumber).arg(QT_VERSION_STR));
}
pgmodeler-0.9.4/apps/pgmodeler-se/src/aboutwidget.h 0000664 0000000 0000000 00000002143 14160100006 0022272 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
/**
\ingroup pgmodeler-sc
\class AboutForm
\brief Form that contains information about software authoring and licensing.
*/
#ifndef ABOUT_WIDGET_H
#define ABOUT_WIDGET_H
#include
#include "ui_aboutwidget.h"
#include "globalattributes.h"
class AboutWidget: public QWidget, public Ui::AboutWidget {
private:
Q_OBJECT
public:
AboutWidget(QWidget *parent = nullptr);
};
#endif
pgmodeler-0.9.4/apps/pgmodeler-se/src/main.cpp 0000664 0000000 0000000 00000002503 14160100006 0021233 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "application.h"
#include
#include "guiutilsns.h"
#include "schemaeditorform.h"
#include "pgmodelerapp.h"
int main(int argc, char **argv)
{
try
{
PgModelerApp::setAttribute(Qt::AA_UseHighDpiPixmaps);
PgModelerApp::setAttribute(Qt::AA_EnableHighDpiScaling);
PgModelerApp app(argc,argv);
QStringList args = app.arguments();
SchemaEditorForm syntaxchk;
args.pop_front();
syntaxchk.loadFiles(args);
syntaxchk.showMaximized();
app.exec();
return 0;
}
catch(Exception &e)
{
QTextStream out(stdout);
out << e.getExceptionsText();
return enum_cast(e.getErrorCode());
}
}
pgmodeler-0.9.4/apps/pgmodeler-se/src/schemaeditorform.cpp 0000664 0000000 0000000 00000036002 14160100006 0023643 0 ustar 00root root 0000000 0000000 /*
# PostgreSQL Database Modeler (pgModeler)
#
# Copyright 2006-2021 - Raphael Araújo e Silva
#
# This program is free software: you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation version 3.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# The complete text of GPLv3 is at LICENSE file on source code root directory.
# Also, you can get the complete GNU General Public License at
*/
#include "schemaeditorform.h"
#include "guiutilsns.h"
#include "globalattributes.h"
#include "settings/generalconfigwidget.h"
#include "guiutilsns.h"
#include "sourceeditorwidget.h"
#include "aboutwidget.h"
#include "baseform.h"
#include "utilsns.h"
const QString SchemaEditorForm::UntitledFile = QT_TR_NOOP("(untitled)");
SchemaEditorForm::SchemaEditorForm(QWidget *parent) : QWidget(parent)
{
QToolButton *btn = nullptr;
QFont fnt;
setupUi(this);
setWindowTitle(windowTitle() + " " + GlobalAttributes::PgModelerVersion);
for(auto &obj : bnts_parent_wgt->children())
{
btn = dynamic_cast(obj);
if(!btn) continue;
fnt = btn->font();
fnt.setBold(true);
btn->setFont(fnt);
GuiUtilsNs::createDropShadow(btn);
GuiUtilsNs::configureWidgetFont(btn, GuiUtilsNs::SmallFontFactor);
if(!btn->toolTip().isEmpty() && !btn->shortcut().toString().isEmpty())
btn->setToolTip(btn->toolTip() + QString(" (%1)").arg(btn->shortcut().toString()));
}
GeneralConfigWidget general_conf_wgt;
general_conf_wgt.loadConfiguration();
alert_frm->setVisible(false);
syntax_txt = GuiUtilsNs::createNumberedTextEditor(syntax_wgt);
syntax_hl = new SyntaxHighlighter(syntax_txt);
syntax_hl->loadConfiguration(GlobalAttributes::getXMLHighlightConfPath());
dtd_txt = GuiUtilsNs::createNumberedTextEditor(dtd_wgt);
dtd_txt->setReadOnly(true);
dtd_hl = new SyntaxHighlighter(dtd_txt);
dtd_hl->loadConfiguration(GlobalAttributes::getXMLHighlightConfPath());
SourceEditorWidget::setDefaultEditorPalette(syntax_txt->palette());
syntax_conf_sel = new FileSelectorWidget(syntax_conf_wgt);
syntax_conf_sel->setReadOnly(true);
QVBoxLayout *vbox = new QVBoxLayout(syntax_conf_wgt);
vbox->addWidget(syntax_conf_sel);
vbox->setContentsMargins(0, 0, 0, 0);
syntax_conf_sel->setNameFilters({ tr("Syntax highlight config file (*.conf)") });
QAction *act = nullptr;
stx_action_grp = new QActionGroup(&syntax_cfg_menu);
act = syntax_cfg_menu.addAction("Schema file", this, SLOT(loadSyntaxConfig()));
stx_action_grp->addAction(act);
act->setCheckable(true);
act->setChecked(true);
act->setData(GlobalAttributes::SchHighlightConf);
act = syntax_cfg_menu.addAction("XML script", this, SLOT(loadSyntaxConfig()));
stx_action_grp->addAction(act);
act->setCheckable(true);
act->setChecked(false);
act->setData(GlobalAttributes::XMLHighlightConf);
act = syntax_cfg_menu.addAction("SQL script", this, SLOT(loadSyntaxConfig()));
stx_action_grp->addAction(act);
act->setData(GlobalAttributes::SQLHighlightConf);
act->setCheckable(true);
act->setChecked(false);
syntax_tb->setMenu(&syntax_cfg_menu);
syntax_tb->setStyleSheet("QToolButton::menu-indicator { \
image: url(':/styles/styles/h_menu_indicator.png'); \
subcontrol-position: right center; }");
syntax_cfg_menu.installEventFilter(this);
connect(apply_conf_tb, SIGNAL(clicked(bool)), this, SLOT(applySyntaxConfig()));
connect(save_conf_tb, SIGNAL(clicked(bool)), this, SLOT(saveSyntaxConfig()));
connect(reload_conf_tb, SIGNAL(clicked(bool)), this, SLOT(loadSyntaxConfig()));
connect(new_tb, SIGNAL(clicked(bool)), this, SLOT(addEditorTab()));
connect(load_tb, SIGNAL(clicked(bool)), this, SLOT(loadFile()));
connect(exit_tb, SIGNAL(clicked(bool)), this, SLOT(close()));
connect(save_tb, SIGNAL(clicked(bool)), this, SLOT(saveFile()));
connect(editors_tbw, SIGNAL(tabCloseRequested(int)), this, SLOT(closeEditorTab(int)));
connect(editors_tbw, SIGNAL(currentChanged(int)), this, SLOT(loadSyntaxFromCurrentTab()));
connect(use_tmpl_file_chk, SIGNAL(toggled(bool)), this, SLOT(loadSyntaxConfig()));
connect(indent_all_tb, SIGNAL(clicked(bool)), this, SLOT(indentAll()));
connect(save_all_tb, SIGNAL(clicked(bool)), this, SLOT(saveAll()));
connect(close_all_tb, SIGNAL(clicked(bool)), this, SLOT(closeAll()));
connect(syntax_txt, &NumberedTextEditor::textChanged, [&](){
alert_frm->setVisible(true);
});
connect(save_as_tb, &QToolButton::clicked, [&](){
saveFile(true);
});
connect(about_tb, &QToolButton::clicked, [&](){
AboutWidget *info_wgt = new AboutWidget;
BaseForm base_frm;
base_frm.setMainWidget(info_wgt);
base_frm.exec();
});
}
void SchemaEditorForm::showEvent(QShowEvent *)
{
h_splitter->setSizes({ width(), width()/2});
}
bool SchemaEditorForm::hasModifiedEditors()
{
bool editors_modified = false;
SourceEditorWidget *editor = nullptr;
for(int tab = 0; tab < editors_tbw->count(); tab++)
{
editor = dynamic_cast(editors_tbw->widget(tab));
if(editor->isModified())
{
editors_modified = true;
break;
}
}
return editors_modified;
}
void SchemaEditorForm::closeEvent(QCloseEvent *event)
{
if(alert_frm->isVisible() || hasModifiedEditors())
{
Messagebox msgbox;
msgbox.show(tr("There are modified files! Do you want to exit without saving them?"), Messagebox::ConfirmIcon, Messagebox::YesNoButtons);
if(msgbox.result() == QDialog::Rejected)
event->ignore();
}
}
bool SchemaEditorForm::eventFilter(QObject *object, QEvent *event)
{
if(object == &syntax_cfg_menu && event->type() == QEvent::Show)
{
syntax_cfg_menu.move(mapToGlobal(syntax_tb->pos() + QPoint(syntax_tb->width(), 0)));
syntax_cfg_menu.show();
return true;
}
return QWidget::eventFilter(object, event);
}
void SchemaEditorForm::loadSyntaxFromCurrentTab()
{
SourceEditorWidget *editor = dynamic_cast(editors_tbw->currentWidget());
if(!editor)
return;
stx_action_grp->blockSignals(true);
for(auto &act : stx_action_grp->actions())
{
if(act->data().toString() == editor->getCurrentSyntaxConfig())
{
act->setChecked(true);
loadSyntaxConfig();
break;
}
}
stx_action_grp->blockSignals(true);
}
void SchemaEditorForm::loadSyntaxConfig()
{
QAction *act = stx_action_grp->checkedAction();
QFile input;
QString filename;
if(!act)
filename = GlobalAttributes::getSchHighlightConfPath();
else
{
if(!use_tmpl_file_chk->isChecked())
filename = GlobalAttributes::getConfigurationFilePath(act->data().toString());
else
filename = GlobalAttributes::getTmplConfigurationFilePath("", act->data().toString() + GlobalAttributes::ConfigurationExt);
}
try
{
syntax_txt->setPlainText(UtilsNs::loadFile(filename));
syntax_conf_sel->setSelectedFile(filename);
if(dtd_txt->toPlainText().isEmpty())
{
filename = GlobalAttributes::getTmplConfigurationFilePath(GlobalAttributes::ObjectDTDDir,
GlobalAttributes::CodeHighlightConf +
GlobalAttributes::ObjectDTDExt);
dtd_txt->setPlainText(UtilsNs::loadFile(filename));
}
save_conf_tb->setEnabled(true);
apply_conf_tb->setEnabled(true);
reload_conf_tb->setEnabled(true);
alert_frm->setVisible(false);
applySyntaxConfig(false);
}
catch(Exception &e)
{
throw Exception(e.getErrorMessage(), e.getErrorCode(), __PRETTY_FUNCTION__, __FILE__, __LINE__, &e);
}
}
void SchemaEditorForm::applySyntaxConfig(bool from_temp_file)
{
QTemporaryFile tmp_file;
QString filename;
/* When applying the syntax on-the-fly we save the syntax conf code to a temporary file
* and use it as configuration for in the open editors */
if(from_temp_file)
{
tmp_file.setAutoRemove(false);
tmp_file.setFileTemplate(GlobalAttributes::getTemporaryFilePath("temp_XXXXXX.conf"));
tmp_file.open();
filename = tmp_file.fileName();
if(!tmp_file.isOpen())
{
throw Exception(Exception::getErrorMessage(ErrorCode::FileDirectoryNotAccessed).arg(filename),
ErrorCode::FileDirectoryNotAccessed, __PRETTY_FUNCTION__, __FILE__, __LINE__);
}
tmp_file.write(syntax_txt->toPlainText().toUtf8());
tmp_file.close();
}
else if(stx_action_grp->checkedAction())
{
if(!use_tmpl_file_chk->isChecked())
filename = GlobalAttributes::getConfigurationFilePath(stx_action_grp->checkedAction()->data().toString());
else
filename = GlobalAttributes::getTmplConfigurationFilePath("", stx_action_grp->checkedAction()->data().toString() + GlobalAttributes::ConfigurationExt);
}
try
{
/* Testing the temp file contents against a dummy syntax highlighter before
* applying to the open editors */
QPlainTextEdit dummy_txt;
SyntaxHighlighter stx_hl(&dummy_txt);
stx_hl.loadConfiguration(filename);
SourceEditorWidget *editor = dynamic_cast(editors_tbw->currentWidget());
if(editor)
editor->loadSyntaxConfig(filename);
}
catch(Exception &e)
{
throw Exception(e.getErrorMessage(), e.getErrorCode(), __PRETTY_FUNCTION__, __FILE__, __LINE__, &e);
}
if(from_temp_file)
tmp_file.remove();
}
void SchemaEditorForm::saveSyntaxConfig()
{
UtilsNs::saveFile(syntax_conf_sel->getSelectedFile(), syntax_txt->toPlainText().toUtf8());
alert_frm->setVisible(false);
applySyntaxConfig(true);
}
void SchemaEditorForm::saveFile(bool save_as)
{
SourceEditorWidget *editor = dynamic_cast(editors_tbw->widget(editors_tbw->currentIndex()));
QString filename = editor->getFilename();
if(save_as || filename.isEmpty())
{
QStringList files = showFileDialog(true);
if(files.isEmpty())
return;
filename = files.at(0);
}
editor->saveFile(filename);
editor->setModified(false);
QFileInfo fi(filename);
editors_tbw->setTabText(editors_tbw->currentIndex(), fi.fileName());
editors_tbw->setTabToolTip(editors_tbw->currentIndex(), fi.absoluteFilePath());
}
void SchemaEditorForm::setTabModified(bool modified)
{
SourceEditorWidget *editor = dynamic_cast(sender());
int idx = editors_tbw->indexOf(editor);
QString tab_text = editors_tbw->tabText(idx);
if(modified && !tab_text.endsWith('*'))
tab_text += '*';
else if(!modified)
tab_text.remove('*');
editors_tbw->setTabText(idx, tab_text);
}
void SchemaEditorForm::indentAll()
{
SourceEditorWidget *editor = nullptr;
QApplication::setOverrideCursor(Qt::WaitCursor);
for(int tab = 0; tab < editors_tbw->count(); tab++)
{
editor = dynamic_cast(editors_tbw->widget(tab));
editor->indent_tb->click();
}
QApplication::restoreOverrideCursor();
}
void SchemaEditorForm::saveAll()
{
QApplication::setOverrideCursor(Qt::WaitCursor);
for(int tab = 0; tab < editors_tbw->count(); tab++)
{
editors_tbw->setCurrentIndex(tab);
try
{
saveFile();
}
catch(Exception &e)
{
Messagebox msgbox;
msgbox.show(e);
break;
}
}
QApplication::restoreOverrideCursor();
}
void SchemaEditorForm::closeAll()
{
Messagebox msgbox;
if(hasModifiedEditors())
{
msgbox.show(tr("There are modified files! Do you want to close them without save?"), Messagebox::ConfirmIcon, Messagebox::YesNoButtons);
if(msgbox.result() == QDialog::Rejected)
return;
}
QApplication::setOverrideCursor(Qt::WaitCursor);
while(editors_tbw->count() > 0)
closeEditorTab(0, false);
QApplication::restoreOverrideCursor();
}
QStringList SchemaEditorForm::showFileDialog(bool save_mode)
{
QFileDialog file_dlg;
QStringList files, filters= {
tr("Schema file (*.sch)"),
tr("Database model file (*.dbm)"),
tr("pgModeler config file (*.conf)"),
tr("Objects metadata file (*.omf)"),
tr("SQL script file (*.sql)"),
tr("XML file (*.xml)"),
tr("DTD file (*.dtd)"),
tr("All files (*.*)")
};
if(!save_mode)
filters.prepend(tr("All supported files (*.sch *.dbm *.conf *.omf *.sql *.xml *.dtd)"));
file_dlg.setNameFilters(filters);
file_dlg.setWindowTitle(save_mode ? tr("Save file") : tr("Load file"));
file_dlg.setFileMode(save_mode ? QFileDialog::AnyFile : QFileDialog::ExistingFiles);
file_dlg.setAcceptMode(save_mode ? QFileDialog::AcceptSave : QFileDialog::AcceptOpen);
if(save_mode)
{
file_dlg.setDefaultSuffix(".sch");
connect(&file_dlg, &QFileDialog::filterSelected, [&](QString filter){
filter.remove(QRegExp("(.)+(\\*)"));
filter.remove(")");
file_dlg.setDefaultSuffix(filter);
});
}
if(file_dlg.exec() == QFileDialog::Accepted)
files = file_dlg.selectedFiles();
return files;
}
void SchemaEditorForm::loadFile()
{
try
{
QStringList files = showFileDialog(false);
if(!files.isEmpty())
loadFiles(files);
}
catch(Exception &e)
{
throw Exception(e.getErrorMessage(), e.getErrorCode(), __PRETTY_FUNCTION__, __FILE__, __LINE__, &e);
}
}
void SchemaEditorForm::loadFiles(const QStringList &filenames)
{
try
{
QApplication::setOverrideCursor(Qt::WaitCursor);
for(auto &file : filenames)
addEditorTab(file);
QApplication::restoreOverrideCursor();
}
catch(Exception &e)
{
QApplication::restoreOverrideCursor();
throw Exception(e.getErrorMessage(), e.getErrorCode(), __PRETTY_FUNCTION__, __FILE__, __LINE__, &e);
}
}
void SchemaEditorForm::addEditorTab(const QString &filename)
{
SourceEditorWidget *editor_wgt = nullptr;
QFileInfo fi(filename);
try
{
editor_wgt = new SourceEditorWidget;
if(!filename.isEmpty())
editor_wgt->loadFile(filename);
connect(editor_wgt, SIGNAL(s_editorModified(bool)), this, SLOT(setTabModified(bool)));
}
catch(Exception &e)
{
delete editor_wgt;
throw Exception(e.getErrorMessage(), e.getErrorCode(), __PRETTY_FUNCTION__, __FILE__, __LINE__, &e);
}
editors_tbw->addTab(editor_wgt, filename.isEmpty() ? UntitledFile : fi.fileName());
editors_tbw->setTabToolTip(editors_tbw->count() - 1, filename.isEmpty() ? "" : fi.absoluteFilePath());
editors_tbw->setCurrentIndex(editors_tbw->count() - 1);
save_as_tb->setEnabled(true);
save_tb->setEnabled(true);
indent_all_tb->setEnabled(true);
save_all_tb->setEnabled(true);
close_all_tb->setEnabled(true);
syntax_cfg_edit_frm->setEnabled(true);
syntax_tb->setEnabled(true);
}
void SchemaEditorForm::closeEditorTab(int idx, bool confirm_close)
{
SourceEditorWidget *editor_wgt = dynamic_cast