profbval-1.0.22/0000755015075101507510000000000012012433132010413 500000000000000profbval-1.0.22/README0000644015075101507510000000002311777007103011222 00000000000000something somethingprofbval-1.0.22/configure.ac0000644015075101507510000000036112012433053012623 00000000000000AC_INIT([profbval], [1.0.22], [https://rostlab.org/cgi-bin/bugzilla3/enter_bug.cgi?product=profbval]) AC_CONFIG_SRCDIR([profbval]) AM_INIT_AUTOMAKE AC_CONFIG_FILES([Makefile] [scr/Makefile] [nn_files/Makefile] [examples/Makefile]) AC_OUTPUT profbval-1.0.22/aclocal.m40000644015075101507510000005326512012433127012212 00000000000000# generated automatically by aclocal 1.11.6 -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, # Inc. # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.69],, [m4_warning([this file was generated for autoconf 2.69. You have another version of autoconf. It may work, but is not guaranteed to. If you have problems, you may need to regenerate the build system entirely. To do so, use the procedure documented by the package, typically `autoreconf'.])]) # Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008, 2011 Free Software # Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. # (This private macro should not be called outside this file.) AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version='1.11' dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to dnl require some minimum version. Point them to the right macro. m4_if([$1], [1.11.6], [], [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl ]) # _AM_AUTOCONF_VERSION(VERSION) # ----------------------------- # aclocal traces this macro to find the Autoconf version. # This is a private macro too. Using m4_define simplifies # the logic in aclocal, which can simply ignore this definition. m4_define([_AM_AUTOCONF_VERSION], []) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. # This function is AC_REQUIREd by AM_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.11.6])dnl m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl _AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))]) # AM_AUX_DIR_EXPAND -*- Autoconf -*- # Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # Do all the work for Automake. -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2008, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 16 # This macro actually does too much. Some checks are only needed if # your package does certain things. But this isn't really a big deal. # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.62])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl # test to see if srcdir already configured if test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT. m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,, [m4_fatal([AC_INIT should be called with package and version arguments])])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AC_REQUIRE([AM_PROG_INSTALL_SH])dnl AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl AC_PROVIDE_IFELSE([AC_PROG_OBJC], [_AM_DEPENDENCIES(OBJC)], [define([AC_PROG_OBJC], defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl ]) _AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl dnl The `parallel-tests' driver may need to know about EXEEXT, so add the dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen. This macro dnl is hooked onto _AC_COMPILER_EXEEXT early, see below. AC_CONFIG_COMMANDS_PRE(dnl [m4_provide_if([_AM_COMPILER_EXEEXT], [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl ]) dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion. Do not dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further dnl mangled by Autoconf and run in a shell conditional statement. m4_define([_AC_COMPILER_EXEEXT], m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_arg=$1 _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count]) # Copyright (C) 2001, 2003, 2005, 2008, 2011 Free Software Foundation, # Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi AC_SUBST(install_sh)]) # Copyright (C) 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Fake the existence of programs that GNU maintainers use. -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 6 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl AC_REQUIRE_AUX_FILE([missing])dnl if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # Copyright (C) 2003, 2004, 2005, 2006, 2011 Free Software Foundation, # Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_MKDIR_P # --------------- # Check for `mkdir -p'. AC_DEFUN([AM_PROG_MKDIR_P], [AC_PREREQ([2.60])dnl AC_REQUIRE([AC_PROG_MKDIR_P])dnl dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P, dnl while keeping a definition of mkdir_p for backward compatibility. dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile. dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of dnl Makefile.ins that do not define MKDIR_P, so we do our own dnl adjustment using top_builddir (which is defined more often than dnl MKDIR_P). AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl case $mkdir_p in [[\\/$]]* | ?:[[\\/]]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac ]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2008, 2010 Free Software # Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # -------------------- # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ------------------------ # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # Check to make sure that the build environment is sane. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[[\\\"\#\$\&\'\`$am_lf]]*) AC_MSG_ERROR([unsafe absolute working directory name]);; esac case $srcdir in *[[\\\"\#\$\&\'\`$am_lf\ \ ]]*) AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_INSTALL_STRIP # --------------------- # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Copyright (C) 2006, 2008, 2010 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 3 # _AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in. # This macro is traced by Automake. AC_DEFUN([_AM_SUBST_NOTMAKE]) # AM_SUBST_NOTMAKE(VARIABLE) # -------------------------- # Public sister of _AM_SUBST_NOTMAKE. AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004, 2005, 2012 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. Yes, it's still used # in the wild :-( We should find a proper way to deprecate it ... AC_SUBST([AMTAR], ['$${TAR-tar}']) m4_if([$1], [v7], [am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR profbval-1.0.22/profbval0000755015075101507510000001566412010453476012123 00000000000000#!/usr/bin/perl -w use File::Temp; use Carp qw |croak cluck|; # popularity contest if( system('pp_popcon_cnt', '-p', 'profbval') == -1 ){ warn("The Rost Lab recommends you install the pp-popularity-contest package that provides pp_popcon_cnt:\n\nsudo apt-get install pp-popularity-contest\n"); } $mode=1; if (@ARGV<6) { die "\nUsage: $0 [fasta] [prof] [hssp] [output_file] [window] [mode] [debug]\n"; ### target_name will be a random variable Nov 29 2009 } $seq_file=$ARGV[0]; $rdbProf_file=$ARGV[1]; $hssp_file=$ARGV[2]; $output_file=$ARGV[3]; $wind_size=$ARGV[4]; $mode=$ARGV[5]; $dbg=$ARGV[6] || 0; if( ! -e $seq_file ) { die("ERROR: input fasta file '$seq_file' does not exist!\n"); } $dir = $ENV{PROFBVAL_ROOT} || "__pkgdatadir__/"; $resultsdir = File::Temp::tempdir( CLEANUP => !$dbg ); $rand=int(rand(10000)); $target_name="PROFbvalTMP$rand"; $createDataFile_exe = "$dir/scr/createDataFile.pl"; $profBval_exe = "$dir/scr/PROFbval.pl"; # check input sequence early: my $inseq = ''; open( INSEQ, '<', $seq_file ) || die( "failed to open < $seq_file: $!" ); { while( my $line = ) { if( $line =~ /^>/o ) { next; } else { $inseq .= $line; } } } close( INSEQ ); $inseq = uc($inseq); $inseq =~ s/\s//go; my @raw_all = split (//o, $inseq); my @seqerrors = (); for( my $i = 0; $i < @raw_all; ++$i ) { if( $raw_all[$i] =~ /[^ABCDEFGHIJKLMNOPQRSTUVWXYZ]/o ) { push @seqerrors, "invalid amino acid code '$raw_all[$i]' at position ".( $i+1 ); } } if( @seqerrors ) { die( "Invalid input sequence: ".join( ', ', @seqerrors ) ); } { my @cmd = ( $createDataFile_exe, $seq_file, $rdbProf_file, $hssp_file, $dir, $target_name, $resultsdir, $dbg ); if( $dbg ){ warn("@cmd"); } system( @cmd ) && die( "'@cmd' failed: ".( $? >> 8 ) ); } { my @cmd = ( $profBval_exe, $seq_file, $output_file, $wind_size, $mode, $target_name, $dir, $resultsdir, $dbg ); if( $dbg ){ warn("@cmd"); } system( @cmd ) && die("'@cmd' failed: ".( $? >> 8 )); } exit(0); __END__ =pod =head1 NAME profbval - predicts flexibile/rigid residues from sequence =head1 SYNOPSIS profbval =head1 DESCRIPTION PROFbval is a neural-network based trained on backbone B-value data from X-ray structure. PROFbval was trained on a sequence unique set of high-resolution protein structures from the PDB. The mobility of a given residue on the protein surface is related to its functional role. A common measure of atom mobility in proteins is B-value data from x-ray crystallography structures. PROFbval is a method predicting backbone B-values from amino-acid sequence. PROFbval can be useful for both protein structure and function predictions. For instance, a biologist can locate potentially antigenic determinants by identifying the most flexible residues on the protein surface. Additionally, a crystallographer can locate residues that potentially have high experimental B-values. =head2 Conversion of PSI-BLAST alignment to HSSP format The most up-to-date procedure can be found at L. =over =item 1. Convert BLAST output to a Single Alignment Format (SAF): __datadir__/librg-utils-perl/blast2saf.pl fasta= maxAli=3000 eSaf=1 \ saf= =item 2. Convert SAF format to HSSP: __datadir__/librg-utils-perl/copf.pl formatIn=saf formatOut=hssp \ fileOut= exeConvertSeq=convert_seq =item 3. Filter results to 80% redundancy: __datadir__/librg-utils-perl/hssp_filter.pl red=80 fileOut= =back =head2 Output format This description applies to the default output format. =over =item number residue number =item residue residue type =item raw raw value of the different between the two output nodes =item Bnorm predicted normalized B-value the values are normalized so in a given sequence the average value is 0 and the standard deviation is 1. The higher the value the more flexible a residue is predicted to be. =item Non-strict mode (NS) indicates on a flexible residue. According to the NS mode most of the residues are flexible; hence, a residue on the surface that is predicted to be rigid is likely to have a functional role. =item Strict mode (S) indicates on a flexible residue. According to the S mode about a third of the residues are flexible, therefore, a stretch of residues that is predicted to be flexible might be important for the protein function. =back =head1 REFERENCES =over =item Schlessinger A, Yachdav G, & Rost B. PROFbval: predict flexible and rigid residues in proteins. Bioinformatics. 2006 Apr 1;22(7):891-3. =item Schlessinger A, Rost B. Protein flexibility and rigidity predicted from sequence. Proteins. 2005 Oct 1;61(1):115-26. =back =head1 OPTIONS =over =item FASTA_FILE File containing protein amino-acid sequence in fasta format. =item RDBPROF_FILE Secondary structure and solvent accessibility prediction by PROF in rdb format. =item HSSP_FILE PSI-BLAST alignment profile file converted to HSSP format. =item OUTPUT_FILE The name of the final PROFbavl output file. You may give multiple output files. You then probably want to give a list of output modes as well, one for each output file. Separate entries with ',' (comma is not allowed in the file name). =item WINDOW This is the desired smoothing window for the output. The method was trained on window of 9. =item OUTPUT_MODE PROFbval can create output files in different formats for different purposes. The default output mode for the package is 6. You may give multiple output modes. You then probably want to give a list of output files as well, one for each output mode. Separate entries with ','. Modes: '-1', '0', '1', '2', '3', '4', '5', '6', 'snap', 'snapfun' =over =item 5 For metadisorder(1) =item snap =item snapfun For snapfun(1) =back =item DEBUG Default: 0. Enable with 1. =back =head1 EXAMPLE profbval __docdir__/examples/cad23.f __docdir__/examples/cad23-fil.rdbProf __docdir__/examples/cad23-fil.hssp cad23.profbval 9 6 =head1 ENVIRONMENT =over =item PROFBVAL_ROOT The directory used to look up F<./scr/createDataFile.pl>, F<./scr/PROFbval.pl> and F<./nn_files/jct.in>. If unset F<__pkgdatadir__> is used. =back =head1 FILES =over =item F<*.profbval> default output file extension =item F<__docdir__/examples> default precomputed input files directory =back =head1 NOTES =over =item 1. It is recommended to create the profiles using 3 iteration of PSI-BLAST against big database =item 2. It is also recommended to filter the hssp files using hssp_filter.pl from the Prof package using the following command: perl hssp_filter.pl hssp_file red=80 =back =head1 AUTHOR =over =item A. Schlessinger =back =head1 SEE ALSO =over =item Main website L =back =cut # vim:ai: profbval-1.0.22/profbval.spec0000644015075101507510000000353111777007104013041 00000000000000Summary: predicts flexibile/rigid residues from sequence Name: profbval Version: 1.0.16 Release: 3 License: NON COMMERCIAL SOFTWARE LICENSE AGREEMENT Group: Applications/Science Source: ftp://rostlab.org/%{name}/%{name}-%{version}.tar.gz URL: http://rostlab.org/ BuildArch: noarch BuildRoot: %{_tmppath}/%{name}-%{version}-root BuildRequires: perl Requires: librg-utils-perl, pp-popularity-contest, profnet-bval %description PROFbval is a neural-network based trained on backbone B-value data from X-ray structure. PROFbval was trained on a sequence unique set of high-resolution protein structures from the PDB. . The mobility of a given residue on the protein surface is related to its functional role. A common measure of atom mobility in proteins is B-value data from x-ray crystallography structures. PROFbval is a method predicting backbone B-values from amino-acid sequence. PROFbval can be useful for both protein structure and function predictions. For instance, a biologist can locate potentially antigenic determinants by identifying the most flexible residues on the protein surface. Additionally, a crystallographer can locate residues that potentially have high experimental B-values. %prep %setup -q %build %configure make %install rm -rf $RPM_BUILD_ROOT make DESTDIR=${RPM_BUILD_ROOT} install %clean rm -rf $RPM_BUILD_ROOT %files %defattr(-,root,root) %doc %{_defaultdocdir}/%{name}/README /usr/bin/* %{_mandir}/*/* %{_datadir}/%{name}/* %changelog * Tue Jul 5 2011 Laszlo Kajan - 1.0.16-3 - requires pp-popularity-contest * Tue Jun 21 2011 Laszlo Kajan - 1.0.16-2 - Fixed directory problem * Wed Jun 15 2011 Guy Yachdav - 1.0.16-1 - Initial build. profbval-1.0.22/Makefile.am0000644015075101507510000000230712010453417012377 00000000000000dist_bin_SCRIPTS = profbval man_MANS = profbval.1 dist_noinst_DATA = $(DEBIANDATA) $(PACKAGE).spec dist_noinst_SCRIPTS = $(DEBIANSCRIPTS) # lkajan: CentOS 5 autoconf does not define docdir docdir = $(datadir)/doc/$(PACKAGE) dist_doc_DATA = README SUBDIRS = examples nn_files scr %.1: % sed -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@" distclean-local: rm -f $(man_MANS) dist-hook: rm -rf `find '$(distdir)' -name .svn` install-data-hook: find '$(DESTDIR)$(pkgdatadir)/scr' -type f -exec sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' '{}' \; install-exec-hook: sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' "$(DESTDIR)$(bindir)/profbval" uninstall-local: rm -rf "$(DESTDIR)$(pkgdatadir)" profbval-1.0.22/Makefile.in0000644015075101507510000007261412012433130012410 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = . DIST_COMMON = README $(am__configure_deps) $(dist_bin_SCRIPTS) \ $(dist_doc_DATA) $(dist_noinst_DATA) $(dist_noinst_SCRIPTS) \ $(srcdir)/Makefile.am $(srcdir)/Makefile.in \ $(top_srcdir)/configure AUTHORS COPYING ChangeLog INSTALL NEWS \ install-sh missing ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \ configure.lineno config.status.lineno mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)" \ "$(DESTDIR)$(docdir)" SCRIPTS = $(dist_bin_SCRIPTS) $(dist_noinst_SCRIPTS) SOURCES = DIST_SOURCES = RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-dvi-recursive install-exec-recursive \ install-html-recursive install-info-recursive \ install-pdf-recursive install-ps-recursive install-recursive \ installcheck-recursive installdirs-recursive pdf-recursive \ ps-recursive uninstall-recursive am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac man1dir = $(mandir)/man1 NROFF = nroff MANS = $(man_MANS) DATA = $(dist_doc_DATA) $(dist_noinst_DATA) RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive \ distclean-recursive maintainer-clean-recursive AM_RECURSIVE_TARGETS = $(RECURSIVE_TARGETS:-recursive=) \ $(RECURSIVE_CLEAN_TARGETS:-recursive=) tags TAGS ctags CTAGS \ distdir dist dist-all distcheck ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) am__remove_distdir = \ if test -d "$(distdir)"; then \ find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \ && rm -rf "$(distdir)" \ || { sleep 5 && rm -rf "$(distdir)"; }; \ else :; fi am__relativize = \ dir0=`pwd`; \ sed_first='s,^\([^/]*\)/.*$$,\1,'; \ sed_rest='s,^[^/]*/*,,'; \ sed_last='s,^.*/\([^/]*\)$$,\1,'; \ sed_butlast='s,/*[^/]*$$,,'; \ while test -n "$$dir1"; do \ first=`echo "$$dir1" | sed -e "$$sed_first"`; \ if test "$$first" != "."; then \ if test "$$first" = ".."; then \ dir2=`echo "$$dir0" | sed -e "$$sed_last"`/"$$dir2"; \ dir0=`echo "$$dir0" | sed -e "$$sed_butlast"`; \ else \ first2=`echo "$$dir2" | sed -e "$$sed_first"`; \ if test "$$first2" = "$$first"; then \ dir2=`echo "$$dir2" | sed -e "$$sed_rest"`; \ else \ dir2="../$$dir2"; \ fi; \ dir0="$$dir0"/"$$first"; \ fi; \ fi; \ dir1=`echo "$$dir1" | sed -e "$$sed_rest"`; \ done; \ reldir="$$dir2" DIST_ARCHIVES = $(distdir).tar.gz GZIP_ENV = --best distuninstallcheck_listfiles = find . -type f -print am__distuninstallcheck_listfiles = $(distuninstallcheck_listfiles) \ | sed 's|^\./|$(prefix)/|' | grep -v '$(infodir)/dir$$' distcleancheck_listfiles = find . -type f -print ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ # lkajan: CentOS 5 autoconf does not define docdir docdir = $(datadir)/doc/$(PACKAGE) dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ dist_bin_SCRIPTS = profbval man_MANS = profbval.1 dist_noinst_DATA = $(DEBIANDATA) $(PACKAGE).spec dist_noinst_SCRIPTS = $(DEBIANSCRIPTS) dist_doc_DATA = README SUBDIRS = examples nn_files scr all: all-recursive .SUFFIXES: am--refresh: Makefile @: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ echo ' cd $(srcdir) && $(AUTOMAKE) --gnu'; \ $(am__cd) $(srcdir) && $(AUTOMAKE) --gnu \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ echo ' $(SHELL) ./config.status'; \ $(SHELL) ./config.status;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(top_srcdir)/configure: $(am__configure_deps) $(am__cd) $(srcdir) && $(AUTOCONF) $(ACLOCAL_M4): $(am__aclocal_m4_deps) $(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS) $(am__aclocal_m4_deps): install-dist_binSCRIPTS: $(dist_bin_SCRIPTS) @$(NORMAL_INSTALL) @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(bindir)'"; \ $(MKDIR_P) "$(DESTDIR)$(bindir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; echo "$$p"; else :; fi; \ done | \ sed -e 'p;s,.*/,,;n' \ -e 'h;s|.*|.|' \ -e 'p;x;s,.*/,,;$(transform)' | sed 'N;N;N;s,\n, ,g' | \ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1; } \ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \ if ($$2 == $$4) { files[d] = files[d] " " $$1; \ if (++n[d] == $(am__install_max)) { \ print "f", d, files[d]; n[d] = 0; files[d] = "" } } \ else { print "f", d "/" $$4, $$1 } } \ END { for (d in files) print "f", d, files[d] }' | \ while read type dir files; do \ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \ test -z "$$files" || { \ echo " $(INSTALL_SCRIPT) $$files '$(DESTDIR)$(bindir)$$dir'"; \ $(INSTALL_SCRIPT) $$files "$(DESTDIR)$(bindir)$$dir" || exit $$?; \ } \ ; done uninstall-dist_binSCRIPTS: @$(NORMAL_UNINSTALL) @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || exit 0; \ files=`for p in $$list; do echo "$$p"; done | \ sed -e 's,.*/,,;$(transform)'`; \ dir='$(DESTDIR)$(bindir)'; $(am__uninstall_files_from_dir) install-man1: $(man_MANS) @$(NORMAL_INSTALL) @list1=''; \ list2='$(man_MANS)'; \ test -n "$(man1dir)" \ && test -n "`echo $$list1$$list2`" \ || exit 0; \ echo " $(MKDIR_P) '$(DESTDIR)$(man1dir)'"; \ $(MKDIR_P) "$(DESTDIR)$(man1dir)" || exit 1; \ { for i in $$list1; do echo "$$i"; done; \ if test -n "$$list2"; then \ for i in $$list2; do echo "$$i"; done \ | sed -n '/\.1[a-z]*$$/p'; \ fi; \ } | while read p; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; echo "$$p"; \ done | \ sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \ sed 'N;N;s,\n, ,g' | { \ list=; while read file base inst; do \ if test "$$base" = "$$inst"; then list="$$list $$file"; else \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst" || exit $$?; \ fi; \ done; \ for i in $$list; do echo "$$i"; done | $(am__base_list) | \ while read files; do \ test -z "$$files" || { \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man1dir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(man1dir)" || exit $$?; }; \ done; } uninstall-man1: @$(NORMAL_UNINSTALL) @list=''; test -n "$(man1dir)" || exit 0; \ files=`{ for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.1[a-z]*$$/p'; \ } | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \ dir='$(DESTDIR)$(man1dir)'; $(am__uninstall_files_from_dir) install-dist_docDATA: $(dist_doc_DATA) @$(NORMAL_INSTALL) @list='$(dist_doc_DATA)'; test -n "$(docdir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(docdir)'"; \ $(MKDIR_P) "$(DESTDIR)$(docdir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; \ done | $(am__base_list) | \ while read files; do \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(docdir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(docdir)" || exit $$?; \ done uninstall-dist_docDATA: @$(NORMAL_UNINSTALL) @list='$(dist_doc_DATA)'; test -n "$(docdir)" || list=; \ files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \ dir='$(DESTDIR)$(docdir)'; $(am__uninstall_files_from_dir) # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" $(RECURSIVE_CLEAN_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) set x; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ set "$$@" "$$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ shift; \ if test -z "$(ETAGS_ARGS)$$*$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ if test $$# -gt 0; then \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ "$$@" $$unique; \ else \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$unique; \ fi; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && $(am__cd) $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) "$$here" distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @list='$(MANS)'; if test -n "$$list"; then \ list=`for p in $$list; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \ if test -n "$$list" && \ grep 'ab help2man is required to generate this page' $$list >/dev/null; then \ echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \ grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/ /' >&2; \ echo " to fix them, install help2man, remove and regenerate the man pages;" >&2; \ echo " typically \`make maintainer-clean' will remove them" >&2; \ exit 1; \ else :; fi; \ else :; fi $(am__remove_distdir) test -d "$(distdir)" || mkdir "$(distdir)" @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ $(am__make_dryrun) \ || test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ dir1=$$subdir; dir2="$(distdir)/$$subdir"; \ $(am__relativize); \ new_distdir=$$reldir; \ dir1=$$subdir; dir2="$(top_distdir)"; \ $(am__relativize); \ new_top_distdir=$$reldir; \ echo " (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir="$$new_top_distdir" distdir="$$new_distdir" \\"; \ echo " am__remove_distdir=: am__skip_length_check=: am__skip_mode_fix=: distdir)"; \ ($(am__cd) $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$new_top_distdir" \ distdir="$$new_distdir" \ am__remove_distdir=: \ am__skip_length_check=: \ am__skip_mode_fix=: \ distdir) \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook -test -n "$(am__skip_mode_fix)" \ || find "$(distdir)" -type d ! -perm -755 \ -exec chmod u+rwx,go+rx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r "$(distdir)" dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | BZIP2=$${BZIP2--9} bzip2 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-lzip: distdir tardir=$(distdir) && $(am__tar) | lzip -c $${LZIP_OPT--9} >$(distdir).tar.lz $(am__remove_distdir) dist-lzma: distdir tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma $(am__remove_distdir) dist-xz: distdir tardir=$(distdir) && $(am__tar) | XZ_OPT=$${XZ_OPT--e} xz -c >$(distdir).tar.xz $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.lzma*) \ lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\ *.tar.lz*) \ lzip -dc $(distdir).tar.lz | $(am__untar) ;;\ *.tar.xz*) \ xz -dc $(distdir).tar.xz | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod u+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) test -d $(distdir)/_build || exit 0; \ dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && am__cwd=`pwd` \ && $(am__cd) $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(AM_DISTCHECK_CONFIGURE_FLAGS) \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \ && cd "$$am__cwd" \ || exit 1 $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x' distuninstallcheck: @test -n '$(distuninstallcheck_dir)' || { \ echo 'ERROR: trying to run $@ with an empty' \ '$$(distuninstallcheck_dir)' >&2; \ exit 1; \ }; \ $(am__cd) '$(distuninstallcheck_dir)' || { \ echo 'ERROR: cannot chdir into $(distuninstallcheck_dir)' >&2; \ exit 1; \ }; \ test `$(am__distuninstallcheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: check-recursive all-am: Makefile $(SCRIPTS) $(MANS) $(DATA) installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)" "$(DESTDIR)$(docdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-recursive clean-am: clean-generic mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -f Makefile distclean-am: clean-am distclean-generic distclean-local \ distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive html-am: info: info-recursive info-am: install-data-am: install-dist_docDATA install-man @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-data-hook install-dvi: install-dvi-recursive install-dvi-am: install-exec-am: install-dist_binSCRIPTS @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-exec-hook install-html: install-html-recursive install-html-am: install-info: install-info-recursive install-info-am: install-man: install-man1 install-pdf: install-pdf-recursive install-pdf-am: install-ps: install-ps-recursive install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-dist_binSCRIPTS uninstall-dist_docDATA \ uninstall-local uninstall-man uninstall-man: uninstall-man1 .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) ctags-recursive \ install-am install-data-am install-exec-am install-strip \ tags-recursive .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am am--refresh check check-am clean clean-generic \ ctags ctags-recursive dist dist-all dist-bzip2 dist-gzip \ dist-hook dist-lzip dist-lzma dist-shar dist-tarZ dist-xz \ dist-zip distcheck distclean distclean-generic distclean-local \ distclean-tags distcleancheck distdir distuninstallcheck dvi \ dvi-am html html-am info info-am install install-am \ install-data install-data-am install-data-hook \ install-dist_binSCRIPTS install-dist_docDATA install-dvi \ install-dvi-am install-exec install-exec-am install-exec-hook \ install-html install-html-am install-info install-info-am \ install-man install-man1 install-pdf install-pdf-am install-ps \ install-ps-am install-strip installcheck installcheck-am \ installdirs installdirs-am maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am tags tags-recursive uninstall uninstall-am \ uninstall-dist_binSCRIPTS uninstall-dist_docDATA \ uninstall-local uninstall-man uninstall-man1 %.1: % sed -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@" distclean-local: rm -f $(man_MANS) dist-hook: rm -rf `find '$(distdir)' -name .svn` install-data-hook: find '$(DESTDIR)$(pkgdatadir)/scr' -type f -exec sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' '{}' \; install-exec-hook: sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' "$(DESTDIR)$(bindir)/profbval" uninstall-local: rm -rf "$(DESTDIR)$(pkgdatadir)" # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: profbval-1.0.22/configure0000755015075101507510000030373012012433130012246 00000000000000#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.69 for profbval 1.0.22. # # Report bugs to . # # # Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc. # # # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # Use a proper internal environment variable to ensure we don't fall # into an infinite loop, continuously re-executing ourselves. if test x"${_as_can_reexec}" != xno && test "x$CONFIG_SHELL" != x; then _as_can_reexec=no; export _as_can_reexec; # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also # works around shells that cannot unset nonexistent variables. # Preserve -v and -x to the replacement shell. BASH_ENV=/dev/null ENV=/dev/null (unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV case $- in # (((( *v*x* | *x*v* ) as_opts=-vx ;; *v* ) as_opts=-v ;; *x* ) as_opts=-x ;; * ) as_opts= ;; esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. $as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 as_fn_exit 255 fi # We don't want this to propagate to other subprocesses. { _as_can_reexec=; unset _as_can_reexec;} if test "x$CONFIG_SHELL" = x; then as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which # is contrary to our usage. Disable this feature. alias -g '\${1+\"\$@\"}'='\"\$@\"' setopt NO_GLOB_SUBST else case \`(set -o) 2>/dev/null\` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi " as_required="as_fn_return () { (exit \$1); } as_fn_success () { as_fn_return 0; } as_fn_failure () { as_fn_return 1; } as_fn_ret_success () { return 0; } as_fn_ret_failure () { return 1; } exitcode=0 as_fn_success || { exitcode=1; echo as_fn_success failed.; } as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; } as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; } as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; } if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then : else exitcode=1; echo positional parameters were not saved. fi test x\$exitcode = x0 || exit 1 test -x / || exit 1" as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" && test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1" if (eval "$as_required") 2>/dev/null; then : as_have_required=yes else as_have_required=no fi if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then : else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR as_found=false for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. as_found=: case $as_dir in #( /*) for as_base in sh bash ksh sh5; do # Try only shells that exist, to save several forks. as_shell=$as_dir/$as_base if { test -f "$as_shell" || test -f "$as_shell.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then : CONFIG_SHELL=$as_shell as_have_required=yes if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then : break 2 fi fi done;; esac as_found=false done $as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then : CONFIG_SHELL=$SHELL as_have_required=yes fi; } IFS=$as_save_IFS if test "x$CONFIG_SHELL" != x; then : export CONFIG_SHELL # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also # works around shells that cannot unset nonexistent variables. # Preserve -v and -x to the replacement shell. BASH_ENV=/dev/null ENV=/dev/null (unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV case $- in # (((( *v*x* | *x*v* ) as_opts=-vx ;; *v* ) as_opts=-v ;; *x* ) as_opts=-x ;; * ) as_opts= ;; esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. $as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 exit 255 fi if test x$as_have_required = xno; then : $as_echo "$0: This script requires a shell more modern than all" $as_echo "$0: the shells that I found on your system." if test x${ZSH_VERSION+set} = xset ; then $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should" $as_echo "$0: be upgraded to zsh 4.3.4 or later." else $as_echo "$0: Please tell bug-autoconf@gnu.org and $0: https://rostlab.org/cgi-bin/bugzilla3/enter_bug.cgi?product=profbval $0: about your system, including any error possibly output $0: before this message. Then install a modern shell, or $0: manually run the script under such a shell if you do $0: have one." fi exit 1 fi fi fi SHELL=${CONFIG_SHELL-/bin/sh} export SHELL # Unset more variables known to interfere with behavior of common tools. CLICOLOR_FORCE= GREP_OPTIONS= unset CLICOLOR_FORCE GREP_OPTIONS ## --------------------- ## ## M4sh Shell Functions. ## ## --------------------- ## # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p # as_fn_executable_p FILE # ----------------------- # Test if FILE is an executable regular file. as_fn_executable_p () { test -f "$1" && test -x "$1" } # as_fn_executable_p # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits as_lineno_1=$LINENO as_lineno_1a=$LINENO as_lineno_2=$LINENO as_lineno_2a=$LINENO eval 'test "x$as_lineno_1'$as_run'" != "x$as_lineno_2'$as_run'" && test "x`expr $as_lineno_1'$as_run' + 1`" = "x$as_lineno_2'$as_run'"' || { # Blame Lee E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; } # If we had to re-execute with $CONFIG_SHELL, we're ensured to have # already done that, so ensure we don't try to do so again and fall # in an infinite loop. This has already happened in practice. _as_can_reexec=no; export _as_can_reexec # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -pR'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -pR' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -pR' fi else as_ln_s='cp -pR' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi as_test_x='test -x' as_executable_p=as_fn_executable_p # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" test -n "$DJDIR" || exec 7<&0 &1 # Name of the host. # hostname on some systems (SVR3.2, old GNU/Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` # # Initializations. # ac_default_prefix=/usr/local ac_clean_files= ac_config_libobj_dir=. LIBOBJS= cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= # Identity of this package. PACKAGE_NAME='profbval' PACKAGE_TARNAME='profbval' PACKAGE_VERSION='1.0.22' PACKAGE_STRING='profbval 1.0.22' PACKAGE_BUGREPORT='https://rostlab.org/cgi-bin/bugzilla3/enter_bug.cgi?product=profbval' PACKAGE_URL='' ac_unique_file="profbval" ac_subst_vars='LTLIBOBJS LIBOBJS am__untar am__tar AMTAR am__leading_dot SET_MAKE AWK mkdir_p MKDIR_P INSTALL_STRIP_PROGRAM STRIP install_sh MAKEINFO AUTOHEADER AUTOMAKE AUTOCONF ACLOCAL VERSION PACKAGE CYGPATH_W am__isrc INSTALL_DATA INSTALL_SCRIPT INSTALL_PROGRAM target_alias host_alias build_alias LIBS ECHO_T ECHO_N ECHO_C DEFS mandir localedir libdir psdir pdfdir dvidir htmldir infodir docdir oldincludedir includedir localstatedir sharedstatedir sysconfdir datadir datarootdir libexecdir sbindir bindir program_transform_name prefix exec_prefix PACKAGE_URL PACKAGE_BUGREPORT PACKAGE_STRING PACKAGE_VERSION PACKAGE_TARNAME PACKAGE_NAME PATH_SEPARATOR SHELL' ac_subst_files='' ac_user_opts=' enable_option_checking ' ac_precious_vars='build_alias host_alias target_alias' # Initialize some variables set by options. ac_init_help= ac_init_version=false ac_unrecognized_opts= ac_unrecognized_sep= # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. # (The list follows the same order as the GNU Coding Standards.) bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datarootdir='${prefix}/share' datadir='${datarootdir}' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' includedir='${prefix}/include' oldincludedir='/usr/include' docdir='${datarootdir}/doc/${PACKAGE_TARNAME}' infodir='${datarootdir}/info' htmldir='${docdir}' dvidir='${docdir}' pdfdir='${docdir}' psdir='${docdir}' libdir='${exec_prefix}/lib' localedir='${datarootdir}/locale' mandir='${datarootdir}/man' ac_prev= ac_dashdash= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval $ac_prev=\$ac_option ac_prev= continue fi case $ac_option in *=?*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; *=) ac_optarg= ;; *) ac_optarg=yes ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=*) datadir=$ac_optarg ;; -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ | --dataroo | --dataro | --datar) ac_prev=datarootdir ;; -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) datarootdir=$ac_optarg ;; -disable-* | --disable-*) ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=no ;; -docdir | --docdir | --docdi | --doc | --do) ac_prev=docdir ;; -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) docdir=$ac_optarg ;; -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) ac_prev=dvidir ;; -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) dvidir=$ac_optarg ;; -enable-* | --enable-*) ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=\$ac_optarg ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) ac_prev=htmldir ;; -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ | --ht=*) htmldir=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localedir | --localedir | --localedi | --localed | --locale) ac_prev=localedir ;; -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) localedir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst | --locals) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) ac_prev=pdfdir ;; -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) pdfdir=$ac_optarg ;; -psdir | --psdir | --psdi | --psd | --ps) ac_prev=psdir ;; -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) psdir=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=\$ac_optarg ;; -without-* | --without-*) ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=no ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) as_fn_error $? "unrecognized option: \`$ac_option' Try \`$0 --help' for more information" ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. case $ac_envvar in #( '' | [0-9]* | *[!_$as_cr_alnum]* ) as_fn_error $? "invalid variable name: \`$ac_envvar'" ;; esac eval $ac_envvar=\$ac_optarg export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}" ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` as_fn_error $? "missing argument to $ac_option" fi if test -n "$ac_unrecognized_opts"; then case $enable_option_checking in no) ;; fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;; *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; esac fi # Check all directory arguments for consistency. for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ datadir sysconfdir sharedstatedir localstatedir includedir \ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ libdir localedir mandir do eval ac_val=\$$ac_var # Remove trailing slashes. case $ac_val in */ ) ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'` eval $ac_var=\$ac_val;; esac # Be sure to have absolute directory names. case $ac_val in [\\/$]* | ?:[\\/]* ) continue;; NONE | '' ) case $ac_var in *prefix ) continue;; esac;; esac as_fn_error $? "expected an absolute directory name for --$ac_var: $ac_val" done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null ac_pwd=`pwd` && test -n "$ac_pwd" && ac_ls_di=`ls -di .` && ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || as_fn_error $? "working directory cannot be determined" test "X$ac_ls_di" = "X$ac_pwd_ls_di" || as_fn_error $? "pwd does not report name of working directory" # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then the parent directory. ac_confdir=`$as_dirname -- "$as_myself" || $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_myself" : 'X\(//\)[^/]' \| \ X"$as_myself" : 'X\(//\)$' \| \ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_myself" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` srcdir=$ac_confdir if test ! -r "$srcdir/$ac_unique_file"; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r "$srcdir/$ac_unique_file"; then test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." as_fn_error $? "cannot find sources ($ac_unique_file) in $srcdir" fi ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" ac_abs_confdir=`( cd "$srcdir" && test -r "./$ac_unique_file" || as_fn_error $? "$ac_msg" pwd)` # When building in place, set srcdir=. if test "$ac_abs_confdir" = "$ac_pwd"; then srcdir=. fi # Remove unnecessary trailing slashes from srcdir. # Double slashes in file names in object file debugging info # mess up M-x gdb in Emacs. case $srcdir in */) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; esac for ac_var in $ac_precious_vars; do eval ac_env_${ac_var}_set=\${${ac_var}+set} eval ac_env_${ac_var}_value=\$${ac_var} eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} eval ac_cv_env_${ac_var}_value=\$${ac_var} done # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures profbval 1.0.22 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking ...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] --datadir=DIR read-only architecture-independent data [DATAROOTDIR] --infodir=DIR info documentation [DATAROOTDIR/info] --localedir=DIR locale-dependent data [DATAROOTDIR/locale] --mandir=DIR man documentation [DATAROOTDIR/man] --docdir=DIR documentation root [DATAROOTDIR/doc/profbval] --htmldir=DIR html documentation [DOCDIR] --dvidir=DIR dvi documentation [DOCDIR] --pdfdir=DIR pdf documentation [DOCDIR] --psdir=DIR ps documentation [DOCDIR] _ACEOF cat <<\_ACEOF Program names: --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in short | recursive ) echo "Configuration of profbval 1.0.22:";; esac cat <<\_ACEOF Report bugs to . _ACEOF ac_status=$? fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d "$ac_dir" || { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } || continue ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } # Check for guested configure. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive elif test -f "$ac_srcdir/configure"; then echo && $SHELL "$ac_srcdir/configure" --help=recursive else $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF profbval configure 1.0.22 generated by GNU Autoconf 2.69 Copyright (C) 2012 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit fi ## ------------------------ ## ## Autoconf initialization. ## ## ------------------------ ## cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by profbval $as_me 1.0.22, which was generated by GNU Autoconf 2.69. Invocation command line was $ $0 $@ _ACEOF exec 5>>config.log { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` /usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. $as_echo "PATH: $as_dir" done IFS=$as_save_IFS } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) as_fn_append ac_configure_args0 " '$ac_arg'" ;; 2) as_fn_append ac_configure_args1 " '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi as_fn_append ac_configure_args " '$ac_arg'" ;; esac done done { ac_configure_args0=; unset ac_configure_args0;} { ac_configure_args1=; unset ac_configure_args1;} # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo $as_echo "## ---------------- ## ## Cache variables. ## ## ---------------- ##" echo # The following way of writing the cache mishandles newlines in values, ( for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( *${as_nl}ac_space=\ *) sed -n \ "s/'\''/'\''\\\\'\'''\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" ;; #( *) sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) echo $as_echo "## ----------------- ## ## Output variables. ## ## ----------------- ##" echo for ac_var in $ac_subst_vars do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then $as_echo "## ------------------- ## ## File substitutions. ## ## ------------------- ##" echo for ac_var in $ac_subst_files do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then $as_echo "## ----------- ## ## confdefs.h. ## ## ----------- ##" echo cat confdefs.h echo fi test "$ac_signal" != 0 && $as_echo "$as_me: caught signal $ac_signal" $as_echo "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; as_fn_exit 1' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h $as_echo "/* confdefs.h */" > confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_URL "$PACKAGE_URL" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer an explicitly selected file to automatically selected ones. ac_site_file1=NONE ac_site_file2=NONE if test -n "$CONFIG_SITE"; then # We do not want a PATH search for config.site. case $CONFIG_SITE in #(( -*) ac_site_file1=./$CONFIG_SITE;; */*) ac_site_file1=$CONFIG_SITE;; *) ac_site_file1=./$CONFIG_SITE;; esac elif test "x$prefix" != xNONE; then ac_site_file1=$prefix/share/config.site ac_site_file2=$prefix/etc/config.site else ac_site_file1=$ac_default_prefix/share/config.site ac_site_file2=$ac_default_prefix/etc/config.site fi for ac_site_file in "$ac_site_file1" "$ac_site_file2" do test "x$ac_site_file" = xNONE && continue if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5 $as_echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" \ || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "failed to load site script $ac_site_file See \`config.log' for more details" "$LINENO" 5; } fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special files # actually), so we avoid doing that. DJGPP emulates it as a regular file. if test /dev/null != "$cache_file" && test -f "$cache_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5 $as_echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5 $as_echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in $ac_precious_vars; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val=\$ac_cv_env_${ac_var}_value eval ac_new_val=\$ac_env_${ac_var}_value case $ac_old_set,$ac_new_set in set,) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then # differences in whitespace do not lead to failure. ac_old_val_w=`echo x $ac_old_val` ac_new_val_w=`echo x $ac_new_val` if test "$ac_old_val_w" != "$ac_new_val_w"; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5 $as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} ac_cache_corrupted=: else { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 $as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} eval $ac_var=\$ac_old_val fi { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5 $as_echo "$as_me: former value: \`$ac_old_val'" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5 $as_echo "$as_me: current value: \`$ac_new_val'" >&2;} fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) as_fn_append ac_configure_args " '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5 $as_echo "$as_me: error: changes in the environment can compromise the build" >&2;} as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5 fi ## -------------------- ## ## Main body of script. ## ## -------------------- ## ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu am__api_version='1.11' ac_aux_dir= for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do if test -f "$ac_dir/install-sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f "$ac_dir/install.sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f "$ac_dir/shtool"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5 fi # These three variables are undocumented and unsupported, # and are intended to be withdrawn in a future Autoconf release. # They can cause serious problems if a builder's source tree is in a directory # whose full name contains unusual characters. ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. # Reject install programs that cannot install multiple files. { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5 $as_echo_n "checking for a BSD-compatible install... " >&6; } if test -z "$INSTALL"; then if ${ac_cv_path_install+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in #(( ./ | .// | /[cC]/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else rm -rf conftest.one conftest.two conftest.dir echo one > conftest.one echo two > conftest.two mkdir conftest.dir if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" && test -s conftest.one && test -s conftest.two && test -s conftest.dir/conftest.one && test -s conftest.dir/conftest.two then ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi fi done done ;; esac done IFS=$as_save_IFS rm -rf conftest.one conftest.two conftest.dir fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5 $as_echo "$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether build environment is sane" >&5 $as_echo_n "checking whether build environment is sane... " >&6; } # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[\\\"\#\$\&\'\`$am_lf]*) as_fn_error $? "unsafe absolute working directory name" "$LINENO" 5;; esac case $srcdir in *[\\\"\#\$\&\'\`$am_lf\ \ ]*) as_fn_error $? "unsafe srcdir value: \`$srcdir'" "$LINENO" 5;; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$*" != "X $srcdir/configure conftest.file" \ && test "$*" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". as_fn_error $? "ls -t appears to fail. Make sure there is not a broken alias in your environment" "$LINENO" 5 fi test "$2" = conftest.file ) then # Ok. : else as_fn_error $? "newly created file is older than distributed files! Check your system clock" "$LINENO" 5 fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } test "$program_prefix" != NONE && program_transform_name="s&^&$program_prefix&;$program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s&\$&$program_suffix&;$program_transform_name" # Double any \ or $. # By default was `s,x,x', remove it if useless. ac_script='s/[\\$]/&&/g;s/;s,x,x,$//' program_transform_name=`$as_echo "$program_transform_name" | sed "$ac_script"` # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: \`missing' script is too old or missing" >&5 $as_echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;} fi if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. if test "$cross_compiling" != no; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $STRIP" >&5 $as_echo "$STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_ac_ct_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_STRIP="strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_STRIP" >&5 $as_echo "$ac_ct_STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_ct_STRIP" = x; then STRIP=":" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac STRIP=$ac_ct_STRIP fi else STRIP="$ac_cv_prog_STRIP" fi fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a thread-safe mkdir -p" >&5 $as_echo_n "checking for a thread-safe mkdir -p... " >&6; } if test -z "$MKDIR_P"; then if ${ac_cv_path_mkdir+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in mkdir gmkdir; do for ac_exec_ext in '' $ac_executable_extensions; do as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext" || continue case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #( 'mkdir (GNU coreutils) '* | \ 'mkdir (coreutils) '* | \ 'mkdir (fileutils) '4.1*) ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext break 3;; esac done done done IFS=$as_save_IFS fi test -d ./--version && rmdir ./--version if test "${ac_cv_path_mkdir+set}" = set; then MKDIR_P="$ac_cv_path_mkdir -p" else # As a last resort, use the slow shell script. Don't cache a # value for MKDIR_P within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. MKDIR_P="$ac_install_sh -d" fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $MKDIR_P" >&5 $as_echo "$MKDIR_P" >&6; } mkdir_p="$MKDIR_P" case $mkdir_p in [\\/$]* | ?:[\\/]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac for ac_prog in gawk mawk nawk awk do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_AWK+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$AWK"; then ac_cv_prog_AWK="$AWK" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_AWK="$ac_prog" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi AWK=$ac_cv_prog_AWK if test -n "$AWK"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $AWK" >&5 $as_echo "$AWK" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi test -n "$AWK" && break done { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5 $as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } set x ${MAKE-make} ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then : $as_echo_n "(cached) " >&6 else cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @echo '@@@%%%=$(MAKE)=@@@%%%' _ACEOF # GNU make sometimes prints "make[1]: Entering ...", which would confuse us. case `${MAKE-make} -f conftest.make 2>/dev/null` in *@@@%%%=?*=@@@%%%*) eval ac_cv_prog_make_${ac_make}_set=yes;; *) eval ac_cv_prog_make_${ac_make}_set=no;; esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } SET_MAKE= else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." am__isrc=' -I$(srcdir)' # test to see if srcdir already configured if test -f $srcdir/config.status; then as_fn_error $? "source directory already configured; run \"make distclean\" there first" "$LINENO" 5 fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi # Define the identity of the package. PACKAGE='profbval' VERSION='1.0.22' cat >>confdefs.h <<_ACEOF #define PACKAGE "$PACKAGE" _ACEOF cat >>confdefs.h <<_ACEOF #define VERSION "$VERSION" _ACEOF # Some tools Automake needs. ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"} AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"} AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"} AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"} MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"} # We need awk for the "check" target. The system "awk" is bad on # some platforms. # Always define AMTAR for backward compatibility. Yes, it's still used # in the wild :-( We should find a proper way to deprecate it ... AMTAR='$${TAR-tar}' am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -' ac_config_files="$ac_config_files Makefile scr/Makefile nn_files/Makefile examples/Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, we kill variables containing newlines. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. ( for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space=' '; set) 2>&1` in #( *${as_nl}ac_space=\ *) # `set' does not quote correctly, so add quotes: double-quote # substitution turns \\\\ into \\, and sed turns \\ into \. sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; #( *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) | sed ' /^ac_cv_env_/b end t clear :clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then if test "x$cache_file" != "x/dev/null"; then { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5 $as_echo "$as_me: updating cache $cache_file" >&6;} if test ! -f "$cache_file" || test -h "$cache_file"; then cat confcache >"$cache_file" else case $cache_file in #( */* | ?:*) mv -f confcache "$cache_file"$$ && mv -f "$cache_file"$$ "$cache_file" ;; #( *) mv -f confcache "$cache_file" ;; esac fi fi else { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5 $as_echo "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' # Transform confdefs.h into DEFS. # Protect against shell expansion while executing Makefile rules. # Protect against Makefile macro expansion. # # If the first sed substitution is executed (which looks for macros that # take arguments), then branch to the quote section. Otherwise, # look for a macro that doesn't take arguments. ac_script=' :mline /\\$/{ N s,\\\n,, b mline } t clear :clear s/^[ ]*#[ ]*define[ ][ ]*\([^ (][^ (]*([^)]*)\)[ ]*\(.*\)/-D\1=\2/g t quote s/^[ ]*#[ ]*define[ ][ ]*\([^ ][^ ]*\)[ ]*\(.*\)/-D\1=\2/g t quote b any :quote s/[ `~#$^&*(){}\\|;'\''"<>?]/\\&/g s/\[/\\&/g s/\]/\\&/g s/\$/$$/g H :any ${ g s/^\n// s/\n/ /g p } ' DEFS=`sed -n "$ac_script" confdefs.h` ac_libobjs= ac_ltlibobjs= U= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' ac_i=`$as_echo "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext" as_fn_append ac_ltlibobjs " \${LIBOBJDIR}$ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs : "${CONFIG_STATUS=./config.status}" ac_write_fail=0 ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5 $as_echo "$as_me: creating $CONFIG_STATUS" >&6;} as_write_fail=0 cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1 #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} export SHELL _ASEOF cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1 ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -pR'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -pR' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -pR' fi else as_ln_s='cp -pR' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi # as_fn_executable_p FILE # ----------------------- # Test if FILE is an executable regular file. as_fn_executable_p () { test -f "$1" && test -x "$1" } # as_fn_executable_p as_test_x='test -x' as_executable_p=as_fn_executable_p # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 ## ----------------------------------- ## ## Main body of $CONFIG_STATUS script. ## ## ----------------------------------- ## _ASEOF test $as_write_fail = 0 && chmod +x $CONFIG_STATUS || ac_write_fail=1 cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Save the log message, to keep $0 and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by profbval $as_me 1.0.22, which was generated by GNU Autoconf 2.69. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " _ACEOF case $ac_config_files in *" "*) set x $ac_config_files; shift; ac_config_files=$*;; esac cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 # Files that config.status was made for. config_files="$ac_config_files" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 ac_cs_usage="\ \`$as_me' instantiates files and other configuration actions from templates according to the current configuration. Unless the files and actions are specified as TAGs, all are instantiated by default. Usage: $0 [OPTION]... [TAG]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit --config print configuration, then exit -q, --quiet, --silent do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE Configuration files: $config_files Report bugs to ." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`" ac_cs_version="\\ profbval config.status 1.0.22 configured by $0, generated by GNU Autoconf 2.69, with options \\"\$ac_cs_config\\" Copyright (C) 2012 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='$ac_pwd' srcdir='$srcdir' INSTALL='$INSTALL' MKDIR_P='$MKDIR_P' AWK='$AWK' test -n "\$AWK" || AWK=awk _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # The default lists apply if the user does not specify any file. ac_need_defaults=: while test $# != 0 do case $1 in --*=?*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; --*=) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg= ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) $as_echo "$ac_cs_version"; exit ;; --config | --confi | --conf | --con | --co | --c ) $as_echo "$ac_cs_config"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; '') as_fn_error $? "missing file argument" ;; esac as_fn_append CONFIG_FILES " '$ac_optarg'" ac_need_defaults=false;; --he | --h | --help | --hel | -h ) $as_echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) as_fn_error $? "unrecognized option: \`$1' Try \`$0 --help' for more information." ;; *) as_fn_append ac_config_targets " $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 if \$ac_cs_recheck; then set X $SHELL '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion shift \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6 CONFIG_SHELL='$SHELL' export CONFIG_SHELL exec "\$@" fi _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX $as_echo "$ac_log" } >&5 _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; "scr/Makefile") CONFIG_FILES="$CONFIG_FILES scr/Makefile" ;; "nn_files/Makefile") CONFIG_FILES="$CONFIG_FILES nn_files/Makefile" ;; "examples/Makefile") CONFIG_FILES="$CONFIG_FILES examples/Makefile" ;; *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5;; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= ac_tmp= trap 'exit_status=$? : "${ac_tmp:=$tmp}" { test ! -d "$ac_tmp" || rm -fr "$ac_tmp"; } && exit $exit_status ' 0 trap 'as_fn_exit 1' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5 ac_tmp=$tmp # Set up the scripts for CONFIG_FILES section. # No need to generate them if there are no CONFIG_FILES. # This happens for instance with `./config.status config.h'. if test -n "$CONFIG_FILES"; then ac_cr=`echo X | tr X '\015'` # On cygwin, bash can eat \r inside `` if the user requested igncr. # But we know of no other shell where ac_cr would be empty at this # point, so we can use a bashism as a fallback. if test "x$ac_cr" = x; then eval ac_cr=\$\'\\r\' fi ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' /dev/null` if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then ac_cs_awk_cr='\\r' else ac_cs_awk_cr=$ac_cr fi echo 'BEGIN {' >"$ac_tmp/subs1.awk" && _ACEOF { echo "cat >conf$$subs.awk <<_ACEOF" && echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' && echo "_ACEOF" } >conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_num=`echo "$ac_subst_vars" | grep -c '^'` ac_delim='%!_!# ' for ac_last_try in false false false false false :; do . ./conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X` if test $ac_delim_n = $ac_delim_num; then break elif $ac_last_try; then as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done rm -f conf$$subs.sh cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 cat >>"\$ac_tmp/subs1.awk" <<\\_ACAWK && _ACEOF sed -n ' h s/^/S["/; s/!.*/"]=/ p g s/^[^!]*!// :repl t repl s/'"$ac_delim"'$// t delim :nl h s/\(.\{148\}\)..*/\1/ t more1 s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/ p n b repl :more1 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t nl :delim h s/\(.\{148\}\)..*/\1/ t more2 s/["\\]/\\&/g; s/^/"/; s/$/"/ p b :more2 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t delim ' >$CONFIG_STATUS || ac_write_fail=1 rm -f conf$$subs.awk cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACAWK cat >>"\$ac_tmp/subs1.awk" <<_ACAWK && for (key in S) S_is_set[key] = 1 FS = "" } { line = $ 0 nfields = split(line, field, "@") substed = 0 len = length(field[1]) for (i = 2; i < nfields; i++) { key = field[i] keylen = length(key) if (S_is_set[key]) { value = S[key] line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3) len += length(value) + length(field[++i]) substed = 1 } else len += 1 + keylen } print line } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g" else cat fi < "$ac_tmp/subs1.awk" > "$ac_tmp/subs.awk" \ || as_fn_error $? "could not setup config files machinery" "$LINENO" 5 _ACEOF # VPATH may cause trouble with some makes, so we remove sole $(srcdir), # ${srcdir} and @srcdir@ entries from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=[ ]*/{ h s/// s/^/:/ s/[ ]*$/:/ s/:\$(srcdir):/:/g s/:\${srcdir}:/:/g s/:@srcdir@:/:/g s/^:*// s/:*$// x s/\(=[ ]*\).*/\1/ G s/\n// s/^[^=]*=[ ]*$// }' fi cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 fi # test -n "$CONFIG_FILES" eval set X " :F $CONFIG_FILES " shift for ac_tag do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5;; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$ac_tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;; esac case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac as_fn_append ac_file_inputs " '$ac_f'" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 $as_echo "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) ac_sed_conf_input=`$as_echo "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac case $ac_tag in *:-:* | *:-) cat >"$ac_tmp/stdin" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir="$ac_dir"; as_fn_mkdir_p ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac ac_MKDIR_P=$MKDIR_P case $MKDIR_P in [\\/$]* | ?:[\\/]* ) ;; */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;; esac _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= ac_sed_dataroot=' /datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 $as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_datarootdir_hack=' s&@datadir@&$datadir&g s&@docdir@&$docdir&g s&@infodir@&$infodir&g s&@localedir@&$localedir&g s&@mandir@&$mandir&g s&\\\${datarootdir}&$datarootdir&g' ;; esac _ACEOF # Neutralize VPATH when `$srcdir' = `.'. # Shell code in configure.ac might set extrasub. # FIXME: do we really want to maintain this feature? cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_sed_extra="$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s|@configure_input@|$ac_sed_conf_input|;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@top_build_prefix@&$ac_top_build_prefix&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t s&@MKDIR_P@&$ac_MKDIR_P&;t t $ac_datarootdir_hack " eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$ac_tmp/subs.awk" \ >$ac_tmp/out || as_fn_error $? "could not create $ac_file" "$LINENO" 5 test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \ "$ac_tmp/out"`; test -z "$ac_out"; } && { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&5 $as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&2;} rm -f "$ac_tmp/stdin" case $ac_file in -) cat "$ac_tmp/out" && rm -f "$ac_tmp/out";; *) rm -f "$ac_file" && mv "$ac_tmp/out" "$ac_file";; esac \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac done # for ac_tag as_fn_exit 0 _ACEOF ac_clean_files=$ac_clean_files_save test $ac_write_fail = 0 || as_fn_error $? "write failure creating $CONFIG_STATUS" "$LINENO" 5 # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || as_fn_exit 1 fi if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} fi profbval-1.0.22/AUTHORS0000644015075101507510000000010211777007105011412 00000000000000Avner Schlessinger Guy Yachdav Burkhard Rost profbval-1.0.22/COPYING0000644015075101507510000010451311777007140011407 00000000000000 GNU GENERAL PUBLIC LICENSE Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such measures. When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a) The work must carry prominent notices stating that you modified it, and giving a relevant date. b) The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c) You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d) If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a) Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b) Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c) Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d) Limiting the use for publicity purposes of names of licensors or authors of the material; or e) Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f) Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of this License. Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively state the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . Also add information on how to contact you by electronic and paper mail. If the program does terminal interaction, make it output a short notice like this when it starts in an interactive mode: Copyright (C) This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, your program's commands might be different; for a GUI interface, you would use an "about box". You should also get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply and follow the GNU GPL, see . The GNU General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Lesser General Public License instead of this License. But first, please read . profbval-1.0.22/ChangeLog0000644015075101507510000000650112012433107012111 00000000000000profbval (1.0.22) unstable; urgency=low * Replaced non-free examples with free examples. -- Laszlo Kajan Tue, 14 Aug 2012 13:27:46 +0200 profbval (1.0.21) unstable; urgency=low * Described HSSP generation on man page. * Added call to pp_popcon_cnt. -- Laszlo Kajan Wed, 08 Aug 2012 13:55:13 +0200 profbval (1.0.20) unstable; urgency=low * Moved examples to $(docdir)/examples/ . -- Laszlo Kajan Thu, 12 Jul 2012 18:20:21 +0200 profbval (1.0.19) unstable; urgency=low * Fixed license (removed old) on man page. -- Laszlo Kajan Wed, 11 Jul 2012 15:40:37 +0200 profbval (1.0.18) unstable; urgency=low * Release under the GPL. -- Laszlo Kajan Tue, 10 Jul 2012 13:13:50 +0200 profbval (1.0.17) unstable; urgency=low * Removed Debianization in preparation of Debian packaging. -- Laszlo Kajan Tue, 03 Jul 2012 19:20:42 +0200 profbval (1.0.16) unstable; urgency=low * man page update for multiple output files and formats * moved references to PP standard section -- Laszlo Kajan Mon, 16 May 2011 13:37:18 +0200 profbval (1.0.15) unstable; urgency=low * Added ability to create multiple outputs with the intention to save output in multiple formats -- Laszlo Kajan Wed, 11 May 2011 15:39:45 +0200 profbval (1.0.14) stable; urgency=low * Made prof output regexp line recognize more prof outputs -- Laszlo Kajan Wed, 12 Jan 2011 17:41:42 +0100 profbval (1.0.13) * Input sequence now converted to upper case before processing (and so lower case sequences are now accepted) -- Laszlo Kajan Mon, 20 Sep 2010 17:19:10 +0200 profbval (1.0.12) * Now accepts `O' as a valid amino acid (for pyrrolysine) -- Laszlo Kajan Wed, 30 Jun 2010 11:07:23 +0200 profbval (1.0.11) * Now accepts `U' as a valid amino acid (for selenocysteine) -- Laszlo Kajan Tue, 29 Jun 2010 11:24:37 +0200 profbval (1.0.10) * Documented mode 5 a bit on the man page -- Laszlo Kajan Tue, 22 Jun 2010 12:44:59 +0200 profbval (1.0.9) * Made profbval completely silent when debug is off and operation is normal -- Laszlo Kajan Wed, 16 Jun 2010 11:48:10 +0200 profbval (1.0.8) * -> automake/autoconf -- Laszlo Kajan Mon, 14 Jun 2010 12:15:19 +0200 profbval (1.0.7) * Added early checking of input fasta sequence for valid sequence * Added debug command line option -- Laszlo Kajan Mon, 03 May 2010 14:39:22 +0200 profbval (1.0.6) * Documented environment variable PROFBVAL_ROOT -- Laszlo Kajan Sat, 19 Dec 2009 11:27:53 +0100 profbval (1.0.5) * snapfun(snap) output mode added -- Laszlo Kajan Fri, 11 Dec 2009 22:56:36 +0100 profbval (1.0.4) * temporary directory collision problem solved * prefix is now correctly respected -- Laszlo Kajan Fri, 11 Dec 2009 14:02:57 +0100 profbval (1.0.2) * Examples added. -- Guy Yachdav Wed, 09 Dec 2009 15:51:56 +0100 profbval (1.0.0) * Initial version. -- Guy Yachdav Tue, 01 Dec 2009 12:51:59 +0200 profbval-1.0.22/INSTALL0000644015075101507510000003660011777007104011406 00000000000000Installation Instructions ************************* Copyright (C) 1994-1996, 1999-2002, 2004-2011 Free Software Foundation, Inc. Copying and distribution of this file, with or without modification, are permitted in any medium without royalty provided the copyright notice and this notice are preserved. This file is offered as-is, without warranty of any kind. Basic Installation ================== Briefly, the shell commands `./configure; make; make install' should configure, build, and install this package. The following more-detailed instructions are generic; see the `README' file for instructions specific to this package. Some packages provide this `INSTALL' file but do not implement all of the features documented below. The lack of an optional feature in a given package is not necessarily a bug. More recommendations for GNU packages can be found in *note Makefile Conventions: (standards)Makefile Conventions. The `configure' shell script attempts to guess correct values for various system-dependent variables used during compilation. It uses those values to create a `Makefile' in each directory of the package. It may also create one or more `.h' files containing system-dependent definitions. Finally, it creates a shell script `config.status' that you can run in the future to recreate the current configuration, and a file `config.log' containing compiler output (useful mainly for debugging `configure'). It can also use an optional file (typically called `config.cache' and enabled with `--cache-file=config.cache' or simply `-C') that saves the results of its tests to speed up reconfiguring. Caching is disabled by default to prevent problems with accidental use of stale cache files. If you need to do unusual things to compile the package, please try to figure out how `configure' could check whether to do them, and mail diffs or instructions to the address given in the `README' so they can be considered for the next release. If you are using the cache, and at some point `config.cache' contains results you don't want to keep, you may remove or edit it. The file `configure.ac' (or `configure.in') is used to create `configure' by a program called `autoconf'. You need `configure.ac' if you want to change it or regenerate `configure' using a newer version of `autoconf'. The simplest way to compile this package is: 1. `cd' to the directory containing the package's source code and type `./configure' to configure the package for your system. Running `configure' might take a while. While running, it prints some messages telling which features it is checking for. 2. Type `make' to compile the package. 3. Optionally, type `make check' to run any self-tests that come with the package, generally using the just-built uninstalled binaries. 4. Type `make install' to install the programs and any data files and documentation. When installing into a prefix owned by root, it is recommended that the package be configured and built as a regular user, and only the `make install' phase executed with root privileges. 5. Optionally, type `make installcheck' to repeat any self-tests, but this time using the binaries in their final installed location. This target does not install anything. Running this target as a regular user, particularly if the prior `make install' required root privileges, verifies that the installation completed correctly. 6. You can remove the program binaries and object files from the source code directory by typing `make clean'. To also remove the files that `configure' created (so you can compile the package for a different kind of computer), type `make distclean'. There is also a `make maintainer-clean' target, but that is intended mainly for the package's developers. If you use it, you may have to get all sorts of other programs in order to regenerate files that came with the distribution. 7. Often, you can also type `make uninstall' to remove the installed files again. In practice, not all packages have tested that uninstallation works correctly, even though it is required by the GNU Coding Standards. 8. Some packages, particularly those that use Automake, provide `make distcheck', which can by used by developers to test that all other targets like `make install' and `make uninstall' work correctly. This target is generally not run by end users. Compilers and Options ===================== Some systems require unusual options for compilation or linking that the `configure' script does not know about. Run `./configure --help' for details on some of the pertinent environment variables. You can give `configure' initial values for configuration parameters by setting variables in the command line or in the environment. Here is an example: ./configure CC=c99 CFLAGS=-g LIBS=-lposix *Note Defining Variables::, for more details. Compiling For Multiple Architectures ==================================== You can compile the package for more than one kind of computer at the same time, by placing the object files for each architecture in their own directory. To do this, you can use GNU `make'. `cd' to the directory where you want the object files and executables to go and run the `configure' script. `configure' automatically checks for the source code in the directory that `configure' is in and in `..'. This is known as a "VPATH" build. With a non-GNU `make', it is safer to compile the package for one architecture at a time in the source code directory. After you have installed the package for one architecture, use `make distclean' before reconfiguring for another architecture. On MacOS X 10.5 and later systems, you can create libraries and executables that work on multiple system types--known as "fat" or "universal" binaries--by specifying multiple `-arch' options to the compiler but only a single `-arch' option to the preprocessor. Like this: ./configure CC="gcc -arch i386 -arch x86_64 -arch ppc -arch ppc64" \ CXX="g++ -arch i386 -arch x86_64 -arch ppc -arch ppc64" \ CPP="gcc -E" CXXCPP="g++ -E" This is not guaranteed to produce working output in all cases, you may have to build one architecture at a time and combine the results using the `lipo' tool if you have problems. Installation Names ================== By default, `make install' installs the package's commands under `/usr/local/bin', include files under `/usr/local/include', etc. You can specify an installation prefix other than `/usr/local' by giving `configure' the option `--prefix=PREFIX', where PREFIX must be an absolute file name. You can specify separate installation prefixes for architecture-specific files and architecture-independent files. If you pass the option `--exec-prefix=PREFIX' to `configure', the package uses PREFIX as the prefix for installing programs and libraries. Documentation and other data files still use the regular prefix. In addition, if you use an unusual directory layout you can give options like `--bindir=DIR' to specify different values for particular kinds of files. Run `configure --help' for a list of the directories you can set and what kinds of files go in them. In general, the default for these options is expressed in terms of `${prefix}', so that specifying just `--prefix' will affect all of the other directory specifications that were not explicitly provided. The most portable way to affect installation locations is to pass the correct locations to `configure'; however, many packages provide one or both of the following shortcuts of passing variable assignments to the `make install' command line to change installation locations without having to reconfigure or recompile. The first method involves providing an override variable for each affected directory. For example, `make install prefix=/alternate/directory' will choose an alternate location for all directory configuration variables that were expressed in terms of `${prefix}'. Any directories that were specified during `configure', but not in terms of `${prefix}', must each be overridden at install time for the entire installation to be relocated. The approach of makefile variable overrides for each directory variable is required by the GNU Coding Standards, and ideally causes no recompilation. However, some platforms have known limitations with the semantics of shared libraries that end up requiring recompilation when using this method, particularly noticeable in packages that use GNU Libtool. The second method involves providing the `DESTDIR' variable. For example, `make install DESTDIR=/alternate/directory' will prepend `/alternate/directory' before all installation names. The approach of `DESTDIR' overrides is not required by the GNU Coding Standards, and does not work on platforms that have drive letters. On the other hand, it does better at avoiding recompilation issues, and works well even when some directory options were not specified in terms of `${prefix}' at `configure' time. Optional Features ================= If the package supports it, you can cause programs to be installed with an extra prefix or suffix on their names by giving `configure' the option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'. Some packages pay attention to `--enable-FEATURE' options to `configure', where FEATURE indicates an optional part of the package. They may also pay attention to `--with-PACKAGE' options, where PACKAGE is something like `gnu-as' or `x' (for the X Window System). The `README' should mention any `--enable-' and `--with-' options that the package recognizes. For packages that use the X Window System, `configure' can usually find the X include and library files automatically, but if it doesn't, you can use the `configure' options `--x-includes=DIR' and `--x-libraries=DIR' to specify their locations. Some packages offer the ability to configure how verbose the execution of `make' will be. For these packages, running `./configure --enable-silent-rules' sets the default to minimal output, which can be overridden with `make V=1'; while running `./configure --disable-silent-rules' sets the default to verbose, which can be overridden with `make V=0'. Particular systems ================== On HP-UX, the default C compiler is not ANSI C compatible. If GNU CC is not installed, it is recommended to use the following options in order to use an ANSI C compiler: ./configure CC="cc -Ae -D_XOPEN_SOURCE=500" and if that doesn't work, install pre-built binaries of GCC for HP-UX. HP-UX `make' updates targets which have the same time stamps as their prerequisites, which makes it generally unusable when shipped generated files such as `configure' are involved. Use GNU `make' instead. On OSF/1 a.k.a. Tru64, some versions of the default C compiler cannot parse its `' header file. The option `-nodtk' can be used as a workaround. If GNU CC is not installed, it is therefore recommended to try ./configure CC="cc" and if that doesn't work, try ./configure CC="cc -nodtk" On Solaris, don't put `/usr/ucb' early in your `PATH'. This directory contains several dysfunctional programs; working variants of these programs are available in `/usr/bin'. So, if you need `/usr/ucb' in your `PATH', put it _after_ `/usr/bin'. On Haiku, software installed for all users goes in `/boot/common', not `/usr/local'. It is recommended to use the following options: ./configure --prefix=/boot/common Specifying the System Type ========================== There may be some features `configure' cannot figure out automatically, but needs to determine by the type of machine the package will run on. Usually, assuming the package is built to be run on the _same_ architectures, `configure' can figure that out, but if it prints a message saying it cannot guess the machine type, give it the `--build=TYPE' option. TYPE can either be a short name for the system type, such as `sun4', or a canonical name which has the form: CPU-COMPANY-SYSTEM where SYSTEM can have one of these forms: OS KERNEL-OS See the file `config.sub' for the possible values of each field. If `config.sub' isn't included in this package, then this package doesn't need to know the machine type. If you are _building_ compiler tools for cross-compiling, you should use the option `--target=TYPE' to select the type of system they will produce code for. If you want to _use_ a cross compiler, that generates code for a platform different from the build platform, you should specify the "host" platform (i.e., that on which the generated programs will eventually be run) with `--host=TYPE'. Sharing Defaults ================ If you want to set default values for `configure' scripts to share, you can create a site shell script called `config.site' that gives default values for variables like `CC', `cache_file', and `prefix'. `configure' looks for `PREFIX/share/config.site' if it exists, then `PREFIX/etc/config.site' if it exists. Or, you can set the `CONFIG_SITE' environment variable to the location of the site script. A warning: not all `configure' scripts look for a site script. Defining Variables ================== Variables not defined in a site shell script can be set in the environment passed to `configure'. However, some packages may run configure again during the build, and the customized values of these variables may be lost. In order to avoid this problem, you should set them in the `configure' command line, using `VAR=value'. For example: ./configure CC=/usr/local2/bin/gcc causes the specified `gcc' to be used as the C compiler (unless it is overridden in the site shell script). Unfortunately, this technique does not work for `CONFIG_SHELL' due to an Autoconf bug. Until the bug is fixed you can use this workaround: CONFIG_SHELL=/bin/bash /bin/bash ./configure CONFIG_SHELL=/bin/bash `configure' Invocation ====================== `configure' recognizes the following options to control how it operates. `--help' `-h' Print a summary of all of the options to `configure', and exit. `--help=short' `--help=recursive' Print a summary of the options unique to this package's `configure', and exit. The `short' variant lists options used only in the top level, while the `recursive' variant lists options also present in any nested packages. `--version' `-V' Print the version of Autoconf used to generate the `configure' script, and exit. `--cache-file=FILE' Enable the cache: use and save the results of the tests in FILE, traditionally `config.cache'. FILE defaults to `/dev/null' to disable caching. `--config-cache' `-C' Alias for `--cache-file=config.cache'. `--quiet' `--silent' `-q' Do not print messages saying which checks are being made. To suppress all normal output, redirect it to `/dev/null' (any error messages will still be shown). `--srcdir=DIR' Look for the package's source code in directory DIR. Usually `configure' can determine that directory automatically. `--prefix=DIR' Use DIR as the installation prefix. *note Installation Names:: for more details, including other options available for fine-tuning the installation locations. `--no-create' `-n' Run the configure checks, but stop before creating any output files. `configure' also accepts some other, not widely useful, options. Run `configure --help' for more details. profbval-1.0.22/NEWS0000644015075101507510000000000011777007104011035 00000000000000profbval-1.0.22/install-sh0000755015075101507510000003325611777007137012373 00000000000000#!/bin/sh # install - install a program, script, or datafile scriptversion=2011-01-19.21; # UTC # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit=${DOITPROG-} if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. chgrpprog=${CHGRPPROG-chgrp} chmodprog=${CHMODPROG-chmod} chownprog=${CHOWNPROG-chown} cmpprog=${CMPPROG-cmp} cpprog=${CPPROG-cp} mkdirprog=${MKDIRPROG-mkdir} mvprog=${MVPROG-mv} rmprog=${RMPROG-rm} stripprog=${STRIPPROG-strip} posix_glob='?' initialize_posix_glob=' test "$posix_glob" != "?" || { if (set -f) 2>/dev/null; then posix_glob= else posix_glob=: fi } ' posix_mkdir= # Desired mode of installed file. mode=0755 chgrpcmd= chmodcmd=$chmodprog chowncmd= mvcmd=$mvprog rmcmd="$rmprog -f" stripcmd= src= dst= dir_arg= dst_arg= copy_on_change=false no_target_directory= usage="\ Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: --help display this help and exit. --version display version info and exit. -c (ignored) -C install only if different (preserve the last data modification time) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) ;; -C) copy_on_change=true;; -d) dir_arg=true;; -g) chgrpcmd="$chgrpprog $2" shift;; --help) echo "$usage"; exit $?;; -m) mode=$2 case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac shift;; -o) chowncmd="$chownprog $2" shift;; -s) stripcmd=$stripprog;; -t) dst_arg=$2 # Protect names problematic for `test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac shift;; -T) no_target_directory=true;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac shift done if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dst_arg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dst_arg" shift # fnord fi shift # arg dst_arg=$arg # Protect names problematic for `test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call `install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then do_exit='(exit $ret); exit $ret' trap "ret=129; $do_exit" 1 trap "ret=130; $do_exit" 2 trap "ret=141; $do_exit" 13 trap "ret=143; $do_exit" 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names problematic for `test' and other utilities. case $src in -* | [=\(\)!]) src=./$src;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dst_arg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dst_arg # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dst_arg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writeable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix='/';; [-=\(\)!]*) prefix='./';; *) prefix='';; esac eval "$initialize_posix_glob" oIFS=$IFS IFS=/ $posix_glob set -f set fnord $dstdir shift $posix_glob set +f IFS=$oIFS prefixes= for d do test X"$d" = X && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # If -C, don't bother to copy if it wouldn't change the file. if $copy_on_change && old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && eval "$initialize_posix_glob" && $posix_glob set -f && set X $old && old=:$2:$4:$5:$6 && set X $new && new=:$2:$4:$5:$6 && $posix_glob set +f && test "$old" = "$new" && $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 then rm -f "$dsttmp" else # Rename the file to the real destination. $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. { # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { test ! -f "$dst" || $doit $rmcmd -f "$dst" 2>/dev/null || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; } } || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } fi || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: profbval-1.0.22/missing0000755015075101507510000002415211777007137011761 00000000000000#! /bin/sh # Common stub for a few missing GNU programs while installing. scriptversion=2012-01-06.13; # UTC # Copyright (C) 1996, 1997, 1999, 2000, 2002, 2003, 2004, 2005, 2006, # 2008, 2009, 2010, 2011, 2012 Free Software Foundation, Inc. # Originally by Fran,cois Pinard , 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program. If not, see . # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi run=: sed_output='s/.* --output[ =]\([^ ]*\).*/\1/p' sed_minuso='s/.* -o \([^ ]*\).*/\1/p' # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.ac; then configure_ac=configure.ac else configure_ac=configure.in fi msg="missing on your system" case $1 in --run) # Try to run requested program, and just exit if it succeeds. run= shift "$@" && exit 0 # Exit code 63 means version mismatch. This often happens # when the user try to use an ancient version of a tool on # a file that requires a minimum version. In this case we # we should proceed has if the program had been absent, or # if --run hadn't been passed. if test $? = 63; then run=: msg="probably too old" fi ;; -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit --run try to run the given command, and emulate it if it fails Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' autom4te touch the output file, or create a stub one automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c help2man touch the output file lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file yacc create \`y.tab.[ch]', if possible, from existing .[ch] Version suffixes to PROGRAM as well as the prefixes \`gnu-', \`gnu', and \`g' are ignored when checking the name. Send bug reports to ." exit $? ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing $scriptversion (GNU Automake)" exit $? ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; esac # normalize program name to check for. program=`echo "$1" | sed ' s/^gnu-//; t s/^gnu//; t s/^g//; t'` # Now exit if we have it, but it failed. Also exit now if we # don't have it and --version was passed (most likely to detect # the program). This is about non-GNU programs, so use $1 not # $program. case $1 in lex*|yacc*) # Not GNU programs, they don't have --version. ;; *) if test -z "$run" && ($1 --version) > /dev/null 2>&1; then # We have it, but it failed. exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then # Could not run --version or --help. This is probably someone # running `$TOOL --version' or `$TOOL --help' to check whether # $TOOL exists and not knowing $TOOL uses missing. exit 1 fi ;; esac # If it does not exist, or fails to run (possibly an outdated version), # try to emulate it. case $program in aclocal*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acconfig.h' or \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}` test -z "$files" && files="config.h" touch_files= for f in $files; do case $f in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; autom4te*) echo 1>&2 "\ WARNING: \`$1' is needed, but is $msg. You might have modified some files without having the proper tools for further handling them. You can get \`$1' as part of \`Autoconf' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo "#! /bin/sh" echo "# Created by GNU Automake missing as a replacement of" echo "# $ $@" echo "exit 0" chmod +x $file exit 1 fi ;; bison*|yacc*) echo 1>&2 "\ WARNING: \`$1' $msg. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if test $# -ne 1; then eval LASTARG=\${$#} case $LASTARG in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.h fi ;; esac fi if test ! -f y.tab.h; then echo >y.tab.h fi if test ! -f y.tab.c; then echo 'main() { return 0; }' >y.tab.c fi ;; lex*|flex*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if test $# -ne 1; then eval LASTARG=\${$#} case $LASTARG in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if test ! -f lex.yy.c; then echo 'main() { return 0; }' >lex.yy.c fi ;; help2man*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a dependency of a manual page. You may need the \`Help2man' package in order for those modifications to take effect. You can get \`Help2man' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo ".ab help2man is required to generate this page" exit $? fi ;; makeinfo*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." # The file to touch is that specified with -o ... file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -z "$file"; then # ... or it is the one specified with @setfilename ... infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n ' /^@setfilename/{ s/.* \([^ ]*\) *$/\1/ p q }' $infile` # ... or it is derived from the source name (dir/f.texi becomes f.info) test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info fi # If the file does not exist, the user really needs makeinfo; # let's fail without touching anything. test -f $file || exit 1 touch $file ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and is $msg. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequisites for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: profbval-1.0.22/examples/0000755015075101507510000000000012012433132012231 500000000000000profbval-1.0.22/examples/cad23.f0000644015075101507510000000054211777007102013230 00000000000000>cad23-cyt DYKDHDGDYKDHDIDYKDDDDKLAAANSNVLDVQPAISVQLPDDMSALQMAIIVLAILLF LAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKYSFDGANPVWLDPFC RNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAVKPDDDRYLRAAIQEYDN IAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSCHSSISELIHTDLEEEPG DHSPGQGSLRFRHKPPMELKGQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTA SEATAFERNARTESAKSTPLHKLRDVIMESPLEITEL profbval-1.0.22/examples/cad23-fil.hssp0000644015075101507510000024407012012432757014537 00000000000000HSSP HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 1.0 1991 PDBID query DATE file generated on 14-Aug-12 SEQBASE /tmp/Zg2z0u5k3S/COPF-tmp15030.msf_tmp PARAMETER CONVERTSEQ of query THRESHOLD according to: ALL REFERENCE Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991). HEADER COMPND SOURCE AUTHOR SEQLENGTH 337 NCHAIN 1 chain(s) in query data set NALIGN 53 NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry NOTATION : %IDE: percentage of residue identity of the alignment NOTATION : %SIM (%WSIM): (weighted) similarity of the alignment NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein NOTATION : LALI: length of the alignment excluding insertions and deletions NOTATION : NGAP: number of insertions and deletions in the alignment NOTATION : LGAP: total length of all insertions and deletions NOTATION : LSEQ2: length of the entire sequence of the aligned protein NOTATION : ACCESSION: SwissProt accession number NOTATION : PROTEIN: one-line description of aligned protein NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983) NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of INSERTION IN THIS sequence NOTATION : dots (....) in the alignend SEQUENCE INDICATE POINTS of deletion in this sequence NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their NOTATION : acid/amide form in proportion to their database frequencies NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence) NOTATION : NDEL: number of sequences with a deletion in the test protein at this position NOTATION : NINS: number of sequences with an insertion in the test protein at this position NOTATION : ENTROPY: entropy measure of sequence variability at this position NOTATION : RELENT: relative entropy, i.e. entropy normalized to the range 0-100 NOTATION : WEIGHT: conservation weight ## PROTEINS : EMBL/SWISSPROT identifier and alignment statistics NR. ID STRID %IDE %SIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCESSION PROTEIN 1 : A1DYI4|A1DYI 0.27 0.00 75 166 1 91 92 1 1 91 2 : A7RSN1|A7RSN 0.36 0.00 73 132 1 59 60 1 1 59 3 : B0X4T4|B0X4T 0.32 0.00 22 118 1 96 97 1 1 96 4 : B0XH34|B0XH3 0.25 0.00 11 175 1 158 165 3 7 158 5 : B1NJ42|B1NJ4 0.25 0.00 71 150 1 79 80 1 1 79 6 : B4PSQ9|B4PSQ 0.28 0.00 11 143 1 128 133 2 5 128 7 : B4UWK6|B4UWK 0.19 0.00 52 154 1 102 103 1 1 102 8 : B7Q6G4|B7Q6G 0.29 0.00 11 164 1 147 154 3 7 147 9 : C3XZY6|C3XZY 0.26 0.00 11 141 1 124 131 2 7 124 10 : C3ZWI6|C3ZWI 0.26 0.00 11 184 1 155 174 3 19 155 11 : D1LU99|D1LU9 0.22 0.00 75 166 1 91 92 1 1 91 12 : D3ZAN2|D3ZAN 0.25 0.00 17 175 1 150 159 3 9 150 13 : D6WAA6|D6WAA 0.31 0.00 11 145 1 131 135 1 4 131 14 : D6WC48|D6WC4 0.22 0.00 49 117 1 69 69 0 0 69 15 : E0VKT8|E0VKT 0.31 0.00 11 142 1 127 132 2 5 127 16 : E2A653|E2A65 0.29 0.00 11 165 1 150 155 2 5 150 17 : E3X5C6|E3X5C 0.30 0.00 11 116 1 102 106 1 4 102 18 : E3XAB3|E3XAB 0.24 0.00 35 175 1 140 141 1 1 140 19 : E7EC34|E7EC3 0.23 0.00 15 166 1 151 152 1 1 151 20 : E7ESV5|E7ESV 0.93 0.00 11 337 1 323 327 1 4 323 21 : E9FRR7|E9FRR 0.26 0.00 21 109 1 87 89 1 2 87 22 : F1NLE0|F1NLE 0.25 0.00 33 175 1 130 143 2 13 130 23 : F1S3A1|F1S3A 0.22 0.00 33 162 1 126 130 2 4 126 24 : F7BQS4|F7BQS 0.37 0.00 72 114 1 43 43 0 0 43 25 : F7I8E8|F7I8E 0.27 0.00 36 145 1 110 110 0 0 110 26 : G0EEC9|G0EEC 0.26 0.00 159 253 1 95 95 0 0 95 27 : G0ZL60|G0ZL6 0.23 0.00 67 166 1 98 100 2 2 98 28 : G1LKS5|G1LKS 0.25 0.00 46 168 1 122 123 1 1 122 29 : G1PUY7|G1PUY 0.26 0.00 14 133 1 114 120 2 6 114 30 : G1T2B6|G1T2B 0.29 0.00 11 118 1 108 108 0 0 108 31 : G3H190|G3H19 0.27 0.00 71 164 1 93 94 1 1 93 32 : G3NGW6|G3NGW 0.70 0.00 11 337 1 322 327 2 5 322 33 : G3Q384|G3Q38 0.27 0.00 44 165 1 121 122 1 1 121 34 : G3VVZ2|G3VVZ 0.27 0.00 51 138 1 88 88 0 0 88 35 : G6DQ40|G6DQ4 0.36 0.00 11 171 1 146 161 3 15 146 36 : H0VXC2|H0VXC 0.31 0.00 71 164 1 87 94 3 7 87 37 : H0YQH1|H0YQH 0.25 0.00 35 118 1 83 84 1 1 83 38 : H2LSL1|H2LSL 0.27 0.00 63 186 1 115 124 2 9 115 39 : H2TW84|H2TW8 0.29 0.00 41 133 1 93 93 0 0 93 40 : H3AUU3|H3AUU 0.71 0.00 11 337 1 323 327 1 4 323 41 : H3CJ85|H3CJ8 0.32 0.00 74 168 1 88 95 1 7 88 42 : H3DG84|H3DG8 0.24 0.00 229 333 1 105 105 0 0 105 43 : H3IKF9|H3IKF 0.27 0.00 27 140 1 101 114 2 13 101 44 : H9GB04|H9GB0 0.31 0.00 44 165 1 118 122 2 4 118 45 : H9JLL4|H9JLL 0.33 0.00 11 148 1 133 138 2 5 133 46 : Q0PKF9|Q0PKF 0.22 0.00 75 166 1 91 92 1 1 91 47 : Q11LN7|Q11LN 0.21 0.00 43 196 1 146 154 2 8 146 48 : Q171X2|Q171X 0.30 0.00 32 150 1 118 119 1 1 118 49 : Q174A5|Q174A 0.32 0.00 11 140 1 119 130 3 11 119 50 : Q7QCW0|Q7QCW 0.31 0.00 32 151 1 117 120 2 3 117 51 : Q8MZK3|Q8MZK 0.22 0.00 47 166 1 118 120 2 2 118 52 : Q95WK9|Q95WK 0.23 0.00 46 165 1 119 120 1 1 119 53 : Q9NDN3|Q9NDN 0.21 0.00 68 166 1 98 99 1 1 98 ## ALIGNMENTS 1 - 53 SeqNo PDBNo AA STRUCTURE BP1 BP2 ACC NOCC VAR ....:....1....:....2....:....3....:....4....:....5....:....6....:....7 1 1 D 0 0 0 1 0 2 2 Y 0 0 0 1 0 3 3 K 0 0 0 1 0 4 4 D 0 0 0 1 0 5 5 H 0 0 0 1 0 6 6 D 0 0 0 1 0 7 7 G 0 0 0 1 0 8 8 D 0 0 0 1 0 9 9 Y 0 0 0 1 0 10 10 K 0 0 0 1 0 11 11 D 0 0 0 17 0 D D DDD D DDD D D D D D D D 12 12 H 0 0 0 17 46 E S KEA Q RRK E L E K E E Q 13 13 D 0 0 0 17 22 N H NNN N NNH N S N N N N N 14 14 I 0 0 0 18 38 V I IYY T IIV K LV Q I K I I 15 15 D 0 0 0 19 8 E E EDE E EEE EE EM E E E E E 16 16 Y 0 0 0 19 53 M S FSF K KKK YQ DI Q H Q Y K 17 17 K 0 0 0 20 33 L L LLL KL LLL IL RR L L L L L 18 18 D 0 0 0 20 26 N N DEV DD DDD DR DN R D R D D 19 19 D 0 0 0 20 39 E G KRR QE SNR EN AD N D N E E 20 20 D 0 0 0 20 22 L L LLL DL LLL LL VE L L L L L 21 21 D 0 0 0 21 28 F F FFL AF FFF FFF TD F F F F F 22 22 K 0 0 0 22 32 KK K KKR LK KKK TRD QA R K R K K 23 23 L 0 0 0 7 51 T. . ... R. ... L.D LL . . . . . 24 24 A 0 0 0 7 51 A. . ... Q. ... R.T VT . . . . . 25 25 A 0 0 0 7 53 L. . ... L. ... T.A KQ . . . . . 26 26 A 0 0 0 7 54 S. . ... L. ... Q.R LL . . . . . 27 27 N 0 0 0 23 28 TE E EDD QE DEE END GL K E N D E E 28 28 S 0 0 0 23 24 RF L FFY LF YFF LYY LQ Y F Y L F F 29 29 N 0 0 0 23 22 NN N NNN GN NNN SNN VL N N N D N N 30 30 V 0 0 0 23 9 LV V VVV LV VVV LVV VG V V V V V V 31 31 L 0 0 0 23 9 LL L LIV VL LLL LLL LL V L L I L L 32 32 D 0 0 0 25 22 DD D YEE VD DDD DDD GV D D D A D DDD 33 33 V 0 0 0 27 37 VT T SVY VT STT LVTTS SV V T V V T VTV 34 34 Q 0 0 0 27 35 PQ Q ELQ SQ QQQ AQSEQ EL Q Q Q Y Q PQP 35 35 P 0 0 0 29 28 VA A PPV SP PPAPAPAPE AG P P P P P P VAP 36 36 A 0 0 0 30 34 SS A AFA QG AASTGAASS A NS A A G A L A TSL 37 37 I 0 0 0 29 44 SE E .VV EG EKQPGIEKQ Q LQ V E E V F E SEA 38 38 S 0 0 0 28 51 AA A .PP TP SSLLTS.EE K KQ T Y V I G Y IAT 39 39 V 0 0 0 29 45 AS Q DPQ QL QQIETV.KS S SS D Q T R G Q TSE 40 40 Q 0 0 0 30 49 AF L ARV EA EPQPVRPEE Q DQ K P K R G P EFA 41 41 L 0 0 0 31 34 IF L LTQ FL LITLLLLML E LE L L P VA G L QFL 42 42 P 0 0 0 31 43 ET T SKD NK KVPSPPGIP S PS P A T TP L T VVT 43 43 D 0 0 0 32 34 EA A DDV QA SQEEGDDGN D KD D D K TD G A DEAE 44 44 D 0 0 0 34 38 ND G ENT TA DEMVGDAVT P VQ DE T E DD GEE EQEA 45 45 M 0 0 0 34 46 QL P RIY QK IQDNEMLIL L LT IP L V TL LPM DSLD 46 46 S 0 0 0 36 42 ES T EDD LS IAEEYSTAR N SSK TV S E NT GSA SGSE S 47 47 A 0 0 0 37 47 LG R EIN LN NGLTAASGN Q DSQ TT S L PS VRS ELGTTA 48 48 L 0 0 0 35 43 LG G DVL TT .TSLLLVL. L LVL LD Q I LL LDN HLALVQ 49 49 Q 0 0 0 36 45 QS P QRI NTTATVQAQPA. I P.I QP Q G QQ ENQ HQPQYI 50 50 M 0 0 0 36 45 IV L MII VFLYFNTVMSA. S K.S LV A I YM AMT GRMIVI 51 51 A 0 0 0 38 38 IF F RLA IWKVWIVYALFV V L.V VKIV I IA ALV GILILV 52 52 I 0 0 0 39 30 LV VATLI ILAPLILIILLV I L.I VYIF A LI LLF VLILAY 53 53 I 0 0 0 39 48 IW WWWIA GTWWLWILIWVI I I.I IIAW G LI LGW WIWISV 54 54 V 0 0 0 40 39 VL LLLLA LALFTLVAVALG G SIG ILGL L GI AVL KVLVLL 55 55 L 0 0 0 40 32 VV IIIIM VAIILFAGLSFL L VIL LLLV A IL FIV IVFVSI 56 56 A 0 0 0 40 42 AI FGGGA VTGFTVGIAGIG G IGG AGGW A VA GAW AAVSAG 57 57 I 0 0 0 40 42 SS TVLVG SLVALTATITLV V TLV VMGT F AV IGT FSSAVL 58 58 L 0 0 0 40 45 AN NSSVI LFSLFNLALAIA A GGA LLAA L GL LLF AANALT 59 59 L 0 0 0 40 27 LI LVVIL VLVILLALLVAL L LVL LALG L LL LAL DLLLGV 60 60 F 0 0 0 40 35 VF FVFFV LLVVGVVLFFIV L GLA CGII I VF FGA FIFVFA 61 61 L 0 0 0 40 21 VI LLLFI VLLQALLALLLL L VLL LLLL F IL LCV MLILML 62 62 A 0 0 0 40 42 CG AGSGS LLGGLGCVAAAV V ALA AILS I AA GVL TCGCCG 63 63 A 0 0 0 41 36 VA TAVAI VLAVLSVIAMLI L LVI GIIA LMLA ALL AVAVLF 64 64 M 0 0 0 41 23 IL LIMWA ILLIILICMIVV V LIV VVIL IIVM LLV MILIVL 65 65 L 0 0 0 41 15 LL LLLIL MLLQLLLLLLLI I LVI LLIL MVVL ILL MLLLLC 66 66 F 0 0 0 41 36 LI VLAFI ICIICIFSFVTM M VIA FVMA TLLF FFA CLIFLI 67 67 V 0 0 0 42 28 VV VILIA TLLFVVVLVLIT T IIMA VVVV LTTI ALI FVVVLV 68 68 L 0 0 0 42 39 AI TAVCT AALVAVAVLG.M T TVTT TLVT VTTF IIM FAVATLV 69 69 M 0 0 0 42 28 FL IFILV LLILLIFIML.I A FVMV MISM LSTM IMM LFLFFLI 70 70 N 0 0 0 41 49 CA AISMC .CASCGFANC.L F IMAL NTLC VLLN LIC VCGFILF 71 71 W 0 0 0 45 27 ILWLLLLV VIFLLLIFWV.V M VLLVLWLVLVLLLW CLV MILIITI 72 72 Y 0 0 0 46 41 KCFCKCRC CNICSSKFYS.CCC RCCCCHCCSCTCCY CTS WKCKRCI 73 73 Y 0 0 0 47 49 QIQRQTQYW FQIQQQIIYQ.VVV TTTVVYTTQMTTTY LVQ LIQITIR 74 74 R 0 0 0 48 16 TRRTRRRKT RRRRRRRRRR.QRR RRRRRQRRRRRRRQR RKR IRRRRRT 75 75 T 0 0 0 52 43 RKSSRNASRSRKQTSALSNTLRKKK AKKKKRRKAKSRKTR RKASNSASATK 76 76 I 0 0 0 45 44 AR.KAGLRLRTSTRKSS.RVVSSSS .SSSSVNSDS.NNIN RSDAA.S..RK 77 77 H 0 0 0 52 31 LQLYLYNYYLLYYLYFYLLHLYYHY LYYHYHYYFYYYYHY LYYLALYLLLL 78 78 K 0 0 0 52 38 NKKRNRQEKKNHHNKQRNNKMKRKN NHRRHQKKTHKRKKK LTVNNNRNNNN 79 79 R 0 0 0 52 3 RRRRRRRRRRRRRQRRRRRRRRRRR RRRRRRRRRRRRRRR RRRRERRRRRR 80 80 K 0 0 0 51 27 QKEQRQ.QNERKKRAQRQRKKKKQK RKKKKKKKRKKKKKK KKRRQQQQRRR 81 81 L 0 0 0 52 7 LLLLLLILVLLLLIILLLILLLLLL LLLLLLLLLILLLLL MLLMTLLLLLL 82 82 K 0 0 0 52 25 QRKRERKKRRQRKQRKRKEKKKRRR ERRQQKKRRRSKKKK QKKKRKRKEEE 83 83 A 0 0 0 52 9 AAAAAAKAAAAAAKAAAAAASAAAA AAAAAAAAAAAAAAA GSAAAAAAAAA 84 84 I 0 0 0 52 35 LALALALAASLMALAAALLIALMVM LVIMMIAVAMMAAVA GLAMAMALLLL 85 85 V 0 0 0 52 42 STSRSKSTIQSKTSTNKSSVSKKKK SKKKKVKKTKVEKVK GVTSLSRSSST 86 86 A 0 0 0 52 27 MAAVTVSAAAMAANAAIATAVAAAA MAAAAAAAAAAAAAA VAAMAAVAMMV 87 87 G 0 0 0 52 39 TATATNTTGMTGSTTSATTGTAALA TAAAGGMRYSTMLGM TSTTSTATTTK 88 88 S 0 0 0 52 41 KSDNKIKASLKKDKAPADNSATKKK KKKKKSNKSRTKKSK LTAKYDNDKRK 89 89 A 0 0 0 52 46 YYFYFFFFIYYEIFFFYFQAFTEVE YEEEETSESEFSSTS GFYFFFYFYYY 90 90 G 0 0 0 52 31 GGGAGRGGASSADGDGGGDGGLAAA GAAAAGAAQANTANA KSSGNVAGGGG 91 91 N 0 0 0 52 41 SASTSGSSGTSRGSSATSQNSSQKR SQRRRNSMTQPVSNT AASSPSASSSS 92 92 R 0 0 0 52 43 DSSKDHQRAKQKRQQSSSTRQPKTK DKKQKQMKSNANDNM HTADVARSDDD 93 93 G 0 0 0 52 37 STDGSSSSQDSTGSTDGSMGSATLT STTTTGVTGTTSNGV APGSKSGSSSS 94 94 F 0 0 0 52 46 GTILGSGAVVGPLGNSPEDFNVAPA GAAAPLTNEAADPFT DMEGLDVEGGG 95 95 I 0 0 0 52 42 LQNLLMLLIILISLIESLSIVVVVA LAAAIMSEAAQNKLS LQSLIMMLLLL 96 96 D 0 0 0 51 37 NFGSNSNNQDNEANDFRNDDNQGEG NGGGEDDIDGQQNFD .QDNDNNNNNN 97 97 I 0 0 0 49 49 RSG.RLRRNARTLRSMATLIRGVMV RVVVAINLMIGKTIN .GMRRV.TRRR 98 98 M 0 0 0 48 47 AIR.VTQVPLVMSQMRYRNMTAMVM VMMMTLQTTVAGAFQ .PTM.R.RAAV 99 99 D 0 0 0 50 43 GSKSSRGDNQGTRGHRQTHDQGAQP GAAANDKSRSGGVEK .ARG.KSNGGG 100 100 M 0 0 0 51 17 LMVVVVVVPVLIVLVVVVAMVIIII LIIIIMVIVIIVVLV LIVI.VVVIII 101 101 P 0 0 0 51 4 PPPPPPPPAPPPPPPPPPPPPPPPP PPPPPPPPPPPPPAP KPPP.PPPPPP 102 102 N 0 0 0 52 28 GTTNGNTNAGGGNTNNNTNNNGGGG GGGGGNGGNGGGGNG EGNGNTNTGGG 103 103 T 0 0 0 52 4 TTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTKT NTTTTSTTTTT 104 104 N 0 0 0 52 4 NNNNNNNNPNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNN RNNNNNNNNNN 105 105 K 0 0 0 52 34 KLLKKKKQVQKVKKIKKIKKQKVKM KMMMMKKLKMQKKKK SQKKRVKIKKK 106 106 Y 0 0 0 52 33 HHFHHHHHTFHYHHHHHFHYLYYFY HYYYYYYFHYYYYIY TYHHKFHFHHH 107 107 S 0 0 0 52 35 AVSSASASSAANSASSSSASRNNNN ATTNNSTNSNNTTST SNSTGSSSTAA 108 108 F 0 0 0 52 40 VAIIVVIVHIVTMIVVMIVFFATST VAATTFMATTAMTFM YKTVLIVIVVV 109 109 D 0 0 0 52 16 EEEEEQEEPDEDEEEEKEEDQEEDE EEDEDEEEKEEEESE QEKEEEEEEEE 110 110 G 0 0 0 51 27 GGGGGGGGRGGRGGGGGGGG RRGR GRRRRGGRGRGGGRG GGGGGGGGGGG 111 111 A 0 0 0 51 24 SSSSSSSSASSASSSSSSSA AAAA SAAAAAAASAAAAAA SASSQSSSSSS 112 112 N 0 0 0 51 1 NNNNNNNNNNNNNNNNNNNN NNNN NNNNNNNNNNNNNNN NNNNGNNNNNN 113 113 P 0 0 0 51 0 PPPPPPPPPPPPPPPPPPPP PPPP PPPPPPPPPPPPPPP PPPPPPPPPPP 114 114 V 0 0 0 51 20 MIVIIIVIIMIMIVIIIVIV MMMM IMVMMVVMIVMVVVV LVIIQVIVIII 115 115 W 0 0 0 48 22 WWLWWWYWWWW.WYWWWLWW LL L WLLL.WLLWYLLLWL WLWYVLWLFWW 116 116 L 0 0 0 50 40 NVNLNLNMLGNLMNMMINNL NN N NNNNLLNNLLNNNLN LLLNSNMNNNN 117 117 D 0 0 0 49 46 EDDKEKNHDKEDQNKH DED LL L ELLLDDLFHDQLLDL DDHETDKDEEE 118 118 P 0 0 0 46 41 APSAQGESP.TLA GA NNP SP P TPPPLPHSASPHNPN .PANEKANATT 119 119 F 0 0 0 40 42 IY YIYVYY.LPY YY EIF L. D I.. PFISYY YIYM .FYIAFYEIII 120 120 C 0 0 0 30 49 .. ...D.Y..TE EF Y.C DT L .TT TCDMEV DDCD .EE.DTEF... 121 121 R 0 0 0 43 38 RH ERDKDS.KKN NK GKR PK D KKK KRADNR TTRT .ENKQRNRKKK 122 122 N 0 0 0 43 40 AN NANDNQ.ADE NN RAN SD Y ADD DNALDS SANA .NDASGEDTAA 123 123 L 0 0 0 43 55 PW EPEID.EPLW WD HPL HL V PLL LLMGWW LLMI .PWPEDWRPPP 124 124 E 0 0 0 42 48 DG WDWDW.VDGD EE GDE DG S DNG GEIFKW DVEA .SYDKD.MDDD 125 125 L 0 0 0 41 39 FL FFFRY.YFLE FS GFL LF L FFF LLLET. ILLL .FKFSV.GLFF 126 126 A 0 0 0 41 42 DN KDKTKFVDEF TF GDA GE N DEE EADSD. DGAG ..SDTS.GDDD 127 127 A 0 0 0 42 43 AT NASSEANACS CS GSA FS S ASS CAMLD. ELAL A.DADV.SAAS 128 128 Q 0 0 0 43 43 ID DIEVDEELHQ QH GIQ HQ L IQQ LQDSQ. QDQD DEDIQQ.GILM 129 129 A 0 0 0 44 46 SD ESETEFISSN TT YSA ES D SSS SAESM. TEAE TVQSPSFGSSS 130 130 E 0 0 0 45 38 DE GESSEHAESS SS YEE ES D DSS SDDRSG SEEE SASDSYKGEDD 131 131 H 0 0 0 45 44 AD HDGGTEEQSE EE DMH TS N VSS SHSNHR DTCT QSEMGENVGVA 132 132 E 0 0 0 45 42 SK VSSDRPESDH KR DSE SS S SSS DESERR VSES PLRSESDYSSS 133 133 D 0 0 0 44 27 G KDDSNTSYND DD LND ND V NDD NDDDDK DDDD DNDNNDDDNNN 134 134 D 0 0 0 41 31 D NNSDAEDDSS SS SDD SL D DL SD.DSD K DD DSSDDDDDDED 135 135 L 0 0 0 42 38 S ISLLQISSLL LL VSL LD V SD LLVLLL V LS WLLSKLLLSSF 136 136 P 0 0 0 41 35 D PDDISPDDDD DD QDP DH D DH DPDDDE S PL PDDDPFT.DDP 137 137 E 0 0 0 41 36 E EEDGKVDEEE NE SEE EI K EM KEKEEK L ES DEEEAAK.EER 138 138 N 0 0 0 42 28 D SDNVRVSDNN NN DDN NS N DS NNNNNN N NS SNNDDNNSDDD 139 139 L 0 0 0 41 41 M LLFEGLLLSV AA ELL KL S LL ALS AT S LL IMALFTILLMV 140 140 S 0 0 0 41 47 P EPLDSEDPVV VL SPS VN Q PN VSL VQ L SD SVVPQRSQPPD 141 141 E 0 0 0 39 33 Q EQADPDDQDS NN DQE DS E QS DEN DS D EN DDQNP SHQE 142 142 I 0 0 0 35 48 F NFVER NFLC IN FFI .L I FL LIS .L N IY A.FAQ EFFF 143 143 A 0 0 0 36 44 R IRAKR ERDG E TRA .D K RD DTL QA S TE SQRTK EGKT 144 144 D 0 0 0 35 36 D IY FQ VNTD E DDD .D E ND TDD DK D DD EDGDD SNLD 145 145 L 0 0 0 34 46 D SN DL DDDL M MDL .N L DN DLY LQ F LF .LDLD DVDK 146 146 W 0 0 0 31 47 Y AY FR VYS M DYW .S YS SWM S. I WS .SFAG FFYP 147 147 N 0 0 0 33 44 N DF SK KFK N KFN .V NV KNT NQ D NK SNLDL NMNE 148 148 S 0 0 0 33 37 K DP YS SPE E DPS SD DD KSN .S S SE DEPTS DDED 149 149 P 0 0 0 30 38 P LP PT PP. . MPP PL TL IPP .P G PT P PRP VPPI 150 150 T 0 0 0 31 44 V TS TV QA. A FAT KA VE KAD .S S TD A AKA DEVV 151 151 R 0 0 0 28 47 T K KY .N. N ANR EN AK KRK .S V RS T NY RVAA 152 152 T 0 0 0 27 41 T T DV .H. T TQT DS TD PTD .T T TV P HS NST 153 153 H 0 0 0 27 42 H L NS .N. N KEH NK HK HHK .P M HK A KD EHH 154 154 G 0 0 0 27 43 G N QH .N. Q RNG FQ GE NGP .E K GQ V NQ KNN 155 155 T 0 0 0 25 43 N R T .N. R KNT KE NT STM .P E T. K NN ANN 156 156 F 0 0 0 25 48 F F P .FF A EFF TI FT PFG .H . F. V FF NFF 157 157 G 0 0 0 25 40 G D I .GK E SGG KK KK KGS .A . G. R GF GGG 158 158 R 0 0 0 25 57 F A T .FR D LSR RK FS QRG D. . R. R FS YFF 159 159 E 0 0 0 27 40 K K A .NK K NNE SL ENE EEP KE . E. A MN NNK 160 160 P 0 0 0 27 26 S Q P .SD P PSP PP KAP PPP PP . P. P TP PAS 161 161 A 0 0 0 28 49 T Y V ATL Y ATA HK ASL EQE YE . A. P SY TTT 162 162 A 0 0 0 29 43 K N A PPP Y FPA PA HPH PAY FP . AI A PA PPP 163 163 V 0 0 0 27 40 Y L L SFH I MFV T TFS L.I IL . SI T FV FFF 164 164 K 0 0 0 29 45 L Y T ASN E ESK D HSP SKE TK K KK N SL SSS 165 165 P 0 0 0 26 22 P S PPP P HPP S PPM PP P K PE P PA PPP 166 166 D 0 0 0 22 33 Q Q PES IED T SEE E S S EE EE E E 167 167 D 0 0 0 14 46 V R D R D E L L D G D DD . 168 168 D 0 0 0 14 20 D D S Q D D K D D D D DD . 169 169 R 0 0 0 12 34 K D E R R E R R Q E R . 170 170 Y 0 0 0 12 52 F Y P S Y V A Y D S Y . 171 171 L 0 0 0 13 31 T A L L L L L L L S L I 172 172 R 0 0 0 12 45 N D T N R A Q R E R A 173 173 A 0 0 0 12 34 K E A P A A T A D A A 174 174 A 0 0 0 12 42 N E A M A A L A G A D 175 175 I 0 0 0 11 15 I I L V I L V I . I V 176 176 Q 0 0 0 8 35 D Q K Q E Q G 177 177 E 0 0 0 8 44 E E Y E A E Q 178 178 Y 0 0 0 8 41 Y Y A Y F Y D 179 179 D 0 0 0 8 13 D D E D D D Q 180 180 N 0 0 0 8 39 N N M N A S N 181 181 I 0 0 0 8 25 Y I I I L I V 182 182 A 0 0 0 8 35 T A E A A T S 183 183 K 0 0 0 8 13 K K K K R K R 184 184 L 0 0 0 8 19 F L L L L L K 185 185 G 0 0 0 7 12 G D G G G G 186 186 Q 0 0 0 7 37 Q P Q K Q E 187 187 I 0 0 0 6 37 I R I I V 188 188 I 0 0 0 6 33 I L M M Q 189 189 R 0 0 0 6 33 R K R R I 190 190 E 0 0 0 6 30 E G E E A 191 191 G 0 0 0 6 0 G G G G G 192 192 P 0 0 0 6 26 P E P P P 193 193 I 0 0 0 6 26 I V I I S 194 194 K 0 0 0 6 39 K H K K S 195 195 G 0 0 0 6 0 G G G G G 196 196 S 0 0 0 6 45 S L S S A 197 197 L 0 0 0 5 7 L F L L 198 198 L 0 0 0 5 0 L L L L 199 199 K 0 0 0 5 55 K Y N K 200 200 V 0 0 0 5 31 V A V V 201 201 V 0 0 0 5 9 V I V V 202 202 L 0 0 0 5 43 L P L L 203 203 E 0 0 0 5 12 E E D D 204 204 D 0 0 0 5 12 D E D D 205 205 Y 0 0 0 5 28 Y L Y Y 206 206 L 0 0 0 5 43 L K L L 207 207 R 0 0 0 5 0 R R R R 208 208 L 0 0 0 5 43 L P L L 209 209 K 0 0 0 5 28 K E K K 210 210 K 0 0 0 5 40 K V K K 211 211 L 0 0 0 5 17 L I L L 212 212 F 0 0 0 5 47 F R F F 213 213 A 0 0 0 5 38 A H A A 214 214 Q 0 0 0 5 43 Q H A A 215 215 R 0 0 0 5 17 R K R R 216 216 M 0 0 0 5 41 M R L L 217 217 V 0 0 0 5 0 V V V V 218 218 Q 0 0 0 5 56 Q L T H 219 219 K 0 0 0 5 46 K E V K 220 220 A 0 0 0 5 21 A S S S 221 221 S 0 0 0 5 55 S Y T T 222 222 S 0 0 0 5 31 S K S S 223 223 C 0 0 0 5 55 C P Q N 224 224 H 0 0 0 5 37 H P H Q 225 225 S 0 0 0 5 0 S S S S 226 226 S 0 0 0 5 0 S S S S 227 227 I 0 0 0 5 35 I T V V 228 228 S 0 0 0 5 53 S L T T 229 229 E 0 0 0 6 32 E V E E E 230 230 L 0 0 0 6 8 L L L L V 231 231 I 0 0 0 6 32 I Y I I L 232 232 H 0 0 0 6 26 Q P Q Q Q 233 233 T 0 0 0 6 47 T L S S S 234 234 D 0 0 0 6 25 E D D D I 235 235 L 0 0 0 6 0 L L L L L 236 236 E 0 0 0 6 3 D D D D D 237 237 E 0 0 0 6 37 E A D E H 238 238 E 0 0 0 6 46 E K D E Y 239 239 P 0 0 0 6 37 P P E E T 240 240 G 0 0 0 6 37 G A D E Q 241 241 D 0 0 0 6 38 D T E D K 242 242 H 0 0 0 6 48 H S Q Q A 243 243 S 0 0 0 6 33 S S G N D 244 244 P 0 0 0 6 24 P P G P G 245 245 G 0 0 0 6 42 G R G S S 246 246 Q 0 0 0 6 24 Q H R H H 247 247 G 0 0 0 6 44 G R G G Q 248 248 S 0 0 0 6 44 S K T T D 249 249 L 0 0 0 6 8 L L L L V 250 250 R 0 0 0 6 20 R R R H H 251 251 F 0 0 0 6 34 F S F F F 252 252 R 0 0 0 6 24 R K K K H 253 253 H 0 0 0 6 22 H H H H M 254 254 K 0 0 0 5 26 K K K A 255 255 P 0 0 0 5 54 P L Q E 256 256 P 0 0 0 5 0 P P P P 257 257 M 0 0 0 5 20 V M V V 258 258 E 0 0 0 5 0 E E E E 259 259 L 0 0 0 5 4 L L F L 260 260 K 0 0 0 5 22 K K K S 261 261 G 0 0 0 5 14 G G G A 262 262 Q 0 0 0 5 23 P P P A 263 263 D 0 0 0 5 14 D D D N 264 264 G 0 0 0 5 0 G G G G 265 265 I 0 0 0 5 30 I V I A 266 266 H 0 0 0 5 19 H H H D 267 267 M 0 0 0 5 15 V V V M 268 268 V 0 0 0 5 22 V V V A 269 269 H 0 0 0 5 0 H H H H 270 270 G 0 0 0 5 0 G G G G 271 271 S 0 0 0 5 0 S S S S 272 272 T 0 0 0 5 22 T T T N 273 273 G 0 0 0 5 14 G G G A 274 274 T 0 0 0 5 20 T T T P 275 275 L 0 0 0 5 32 L L L S 276 276 L 0 0 0 5 0 L L L L 277 277 A 0 0 0 5 37 A T T S 278 278 T 0 0 0 5 36 T S S G 279 279 D 0 0 0 5 0 D D D D 280 280 L 0 0 0 5 37 L L I K 281 281 N 0 0 0 5 33 N N K T 282 282 S 0 0 0 5 27 S S S V 283 283 L 0 0 0 5 3 L L L M 284 284 P 0 0 0 5 31 P P P L 285 285 E 0 0 0 5 19 E E E H 286 286 D 0 0 0 5 13 E D D E 287 287 D 0 0 0 5 34 D D D Y 288 288 Q 0 0 0 5 27 Q Q Q S 289 289 K 0 0 0 5 19 K R K R 290 290 G 0 0 0 5 54 G A I F 291 291 L 0 0 0 5 0 L L L L 292 292 D 0 0 0 5 45 G A A L 293 293 R 0 0 0 5 19 R R R Q 294 294 S 0 0 0 5 19 S S S A 295 295 L 0 0 0 5 4 L L F L 296 296 E 0 0 0 5 0 E E E E 297 297 T 0 0 0 5 43 T A T R 298 298 L 0 0 0 5 27 L L L T 299 299 T 0 0 0 5 41 T N N S 300 300 A 0 0 0 5 50 A S T H 301 301 S 0 0 0 5 35 A D D S 302 302 E 0 0 0 5 39 E G S A 303 303 A 0 0 0 5 19 A G G G 304 304 T 0 0 0 5 46 T L I F 305 305 A 0 0 0 5 56 A Y Y P 306 306 F 0 0 0 5 64 F S N P 307 307 E 0 0 0 5 25 E E D A 308 308 R 0 0 0 5 24 R R R S 309 309 N 0 0 0 5 17 N N N E 310 310 A 0 0 0 5 17 A A A P 311 311 R 0 0 0 5 34 R R R F 312 312 T 0 0 0 5 0 T T T T 313 313 E 0 0 0 5 22 E E E S 314 314 S 0 0 0 5 0 S S S S 315 315 A 0 0 0 5 20 A A A C 316 316 K 0 0 0 5 22 K K K S 317 317 S 0 0 0 5 15 S S S G 318 318 T 0 0 0 5 22 T T T N 319 319 P 0 0 0 5 0 P P P P 320 320 L 0 0 0 5 13 L M I L 321 321 H 0 0 0 5 20 H H H Y 322 322 K 0 0 0 5 26 K K K A 323 323 L 0 0 0 5 57 L G M D 324 324 R 0 0 0 5 35 R E K K 325 325 D 0 0 0 5 26 D N E N 326 326 V 0 0 0 5 29 V T V I 327 327 I 0 0 0 5 33 I L I Y 328 328 M 0 0 0 5 49 M S M T 329 329 E 0 0 0 5 22 E E E T 330 330 S 0 0 0 5 37 T I S S 331 331 P 0 0 0 5 0 P P P P 332 332 L 0 0 0 5 0 L L L L 333 333 E 0 0 0 5 0 E E E E 334 334 I 0 0 0 4 0 I I I 335 335 T 0 0 0 4 0 T T T 336 336 E 0 0 0 4 0 E E E 337 337 L 0 0 0 4 0 L L L ## SEQUENCE PROFILE AND ENTROPY SeqNo PDBNo V L I M F W Y G A P S T C H R K Q E N D NOCC NDEL NINS ENTROPY RELENT WEIGHT 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 1 0 0 0.000 0 1.00 2 2 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0.000 0 1.00 3 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 1 0 0 0.000 0 1.00 4 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 1 0 0 0.000 0 1.00 5 5 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 1 0 0 0.000 0 1.00 6 6 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 1 0 0 0.000 0 1.00 7 7 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0.000 0 1.00 8 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 1 0 0 0.000 0 1.00 9 9 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0.000 0 1.00 10 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 1 0 0 0.000 0 1.00 11 11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 17 0 0 0.000 0 1.60 12 12 0 6 0 0 0 0 0 0 6 0 6 0 0 6 12 18 12 35 0 0 17 0 0 1.844 65 0.81 13 13 0 0 0 0 0 0 0 0 0 0 6 0 0 12 0 0 0 0 76 6 17 0 0 0.790 28 1.28 14 14 17 6 44 0 0 0 11 0 0 0 0 6 0 0 0 11 6 0 0 0 18 0 0 1.629 56 0.87 15 15 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 84 0 11 19 0 0 0.537 18 1.38 16 16 0 0 5 5 11 0 16 0 0 0 11 0 0 5 0 26 16 0 0 5 19 0 0 2.028 69 0.61 17 17 0 75 5 0 0 0 0 0 0 0 0 0 0 0 10 10 0 0 0 0 20 0 0 0.826 28 1.07 18 18 5 0 0 0 0 0 0 0 0 0 0 0 0 0 15 0 0 5 15 60 20 0 0 1.175 39 1.05 19 19 0 0 0 0 0 0 0 5 5 0 5 0 0 0 15 5 5 25 20 15 20 0 0 1.987 66 0.88 20 20 5 80 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 10 20 0 0 0.708 24 1.16 21 21 0 5 0 0 76 0 0 0 5 0 0 5 0 0 0 0 0 0 0 10 21 0 0 0.866 29 1.02 22 22 0 5 0 0 0 0 0 0 5 0 0 5 0 0 18 59 5 0 0 5 22 0 0 1.323 44 1.03 23 23 0 57 0 0 0 0 0 0 0 0 0 14 0 0 14 0 0 0 0 14 7 15 0 1.154 59 0.71 24 24 14 0 0 0 0 0 0 0 29 0 0 29 0 0 14 0 14 0 0 0 7 15 0 1.550 80 0.70 25 25 0 29 0 0 0 0 0 0 29 0 0 14 0 0 0 14 14 0 0 0 7 15 0 1.550 80 0.65 26 26 0 43 0 0 0 0 0 0 14 0 14 0 0 0 14 0 14 0 0 0 7 15 0 1.475 76 0.61 27 27 0 4 0 0 0 0 0 4 0 0 0 4 0 0 0 4 4 43 13 22 23 0 0 1.641 55 1.03 28 28 0 22 0 0 39 0 26 0 0 0 4 0 0 0 4 0 4 0 0 0 23 0 0 1.458 49 1.08 29 29 4 4 0 0 0 0 0 4 0 0 4 0 0 0 0 0 0 0 78 4 23 0 0 0.873 29 1.17 30 30 83 13 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 23 0 0 0.560 19 1.39 31 31 13 78 9 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 23 0 0 0.670 22 1.41 32 32 8 0 0 0 0 0 4 4 4 0 0 0 0 0 0 0 0 8 0 72 25 0 0 1.027 34 1.14 33 33 41 4 0 0 0 0 4 0 0 0 15 37 0 0 0 0 0 0 0 0 27 0 0 1.261 42 0.89 34 34 0 7 0 0 0 0 4 0 4 11 7 0 0 0 0 0 56 11 0 0 27 0 0 1.445 48 0.90 35 35 10 0 0 0 0 0 0 3 24 55 3 0 0 0 0 0 0 3 0 0 29 0 0 1.254 42 1.06 36 36 0 7 0 0 3 0 0 10 43 0 23 7 0 0 0 0 3 0 3 0 30 0 0 1.633 55 0.90 37 37 14 3 7 0 3 0 0 7 3 3 7 0 0 0 0 7 14 31 0 0 29 1 0 2.112 70 0.71 38 38 4 7 7 0 0 0 7 4 14 11 14 14 0 0 0 7 4 7 0 0 28 2 0 2.373 79 0.66 39 39 7 3 3 0 0 0 0 3 3 3 21 10 0 0 3 3 24 7 0 7 29 1 0 2.270 76 0.73 40 40 7 3 0 0 7 0 0 3 13 17 0 0 0 0 10 7 13 17 0 3 30 0 0 2.247 75 0.68 41 41 3 48 6 3 10 0 0 3 3 3 0 6 0 0 0 0 6 6 0 0 31 0 0 1.838 61 0.90 42 42 10 3 3 0 0 0 0 3 3 26 13 19 0 0 0 10 0 3 3 3 31 0 0 2.159 72 0.77 43 43 3 0 0 0 0 0 0 9 16 0 3 3 0 0 0 6 6 16 3 34 32 0 0 1.949 65 0.96 44 44 9 0 0 3 0 0 0 9 9 3 0 12 0 0 0 0 6 24 6 21 34 0 0 2.101 70 0.87 45 45 3 26 12 9 0 0 3 0 0 9 3 6 0 0 3 3 9 3 3 9 34 0 0 2.353 79 0.70 46 46 3 3 3 0 0 0 3 6 8 0 31 11 0 0 3 3 0 17 6 6 36 0 0 2.191 73 0.79 47 47 3 14 3 0 0 0 0 11 11 3 14 14 0 0 5 0 5 5 11 3 37 0 0 2.396 80 0.69 48 48 11 46 3 0 0 0 0 6 3 0 3 9 0 3 0 0 6 0 3 9 35 2 0 1.862 62 0.80 49 49 3 0 11 0 0 0 3 3 8 14 3 8 0 3 3 0 33 3 6 0 36 2 0 2.156 72 0.73 50 50 14 8 17 17 6 0 6 3 8 0 8 6 0 0 3 3 0 0 3 0 36 2 0 2.373 79 0.76 51 51 24 16 21 0 8 5 3 3 13 0 0 0 0 0 3 5 0 0 0 0 38 1 0 2.025 68 0.84 52 52 13 33 28 0 5 0 5 0 10 3 0 3 0 0 0 0 0 0 0 0 39 1 0 1.713 57 1.02 53 53 5 10 36 0 0 31 0 8 5 0 3 3 0 0 0 0 0 0 0 0 39 1 0 1.654 55 0.69 54 54 18 40 8 0 3 0 0 13 13 0 3 3 0 0 0 3 0 0 0 0 40 0 0 1.755 59 0.87 55 55 20 25 28 3 10 0 0 3 8 0 5 0 0 0 0 0 0 0 0 0 40 0 0 1.782 59 1.03 56 56 10 0 10 0 5 5 0 35 28 0 3 5 0 0 0 0 0 0 0 0 40 0 0 1.725 58 0.84 57 57 23 15 8 3 5 0 0 8 10 0 13 18 0 0 0 0 0 0 0 0 40 0 0 2.046 68 0.81 58 58 3 30 5 0 8 0 0 8 28 0 8 3 0 0 0 0 0 0 10 0 40 0 0 1.864 62 0.76 59 59 18 58 8 0 0 0 0 5 10 0 0 0 0 0 0 0 0 0 0 3 40 0 0 1.290 43 1.08 60 60 25 13 13 0 30 0 0 10 8 0 0 0 3 0 0 0 0 0 0 0 40 0 0 1.744 58 0.92 61 61 10 60 10 5 5 0 0 0 5 0 0 0 3 0 0 0 3 0 0 0 40 0 0 1.401 47 1.19 62 62 10 15 5 0 0 0 0 23 25 0 8 3 13 0 0 0 0 0 0 0 40 0 0 1.893 63 0.80 63 63 20 24 15 5 2 0 0 2 27 0 2 2 0 0 0 0 0 0 0 0 41 0 0 1.807 60 0.92 64 64 22 27 32 12 0 2 0 0 2 0 0 0 2 0 0 0 0 0 0 0 41 0 0 1.578 53 1.14 65 65 7 66 15 7 0 0 0 0 0 0 0 0 2 0 0 0 2 0 0 0 41 0 0 1.120 37 1.28 66 66 10 15 22 7 22 0 0 0 10 0 2 5 7 0 0 0 0 0 0 0 41 0 0 2.022 67 0.89 67 67 38 19 17 2 5 0 0 0 7 0 0 12 0 0 0 0 0 0 0 0 42 0 0 1.658 55 1.05 68 68 21 12 7 5 5 0 0 2 19 0 0 26 2 0 0 0 0 0 0 0 42 1 0 1.907 64 0.85 69 69 7 26 21 19 17 0 0 0 2 0 5 2 0 0 0 0 0 0 0 0 42 1 0 1.807 60 1.08 70 70 5 17 10 5 10 0 0 5 12 0 5 2 20 0 0 0 0 0 10 0 41 2 0 2.238 75 0.67 71 71 20 40 16 4 4 11 0 0 0 0 0 2 2 0 0 0 0 0 0 0 45 1 0 1.668 56 1.06 72 72 0 0 4 0 4 2 7 0 0 0 11 4 46 2 7 11 0 0 2 0 46 1 0 1.855 62 0.79 73 73 13 4 15 2 2 2 11 0 0 0 0 21 0 0 4 0 26 0 0 0 47 1 0 1.977 66 0.66 74 74 0 0 2 0 0 0 0 0 0 0 0 8 0 0 79 4 6 0 0 0 48 1 0 0.778 26 1.25 75 75 0 4 0 0 0 0 0 0 13 0 19 10 0 0 19 27 2 0 6 0 52 0 0 1.848 62 0.81 76 76 7 4 4 0 0 0 0 2 9 0 33 4 0 0 16 7 0 0 9 4 45 7 0 2.085 70 0.74 77 77 0 33 0 0 4 0 46 0 2 0 0 0 0 12 0 0 2 0 2 0 52 0 0 1.325 44 0.97 78 78 2 2 0 2 0 0 0 0 0 0 0 4 0 10 15 29 6 2 29 0 52 0 0 1.824 61 0.89 79 79 0 0 0 0 0 0 0 0 0 0 0 0 0 0 96 0 2 2 0 0 52 0 0 0.190 6 1.53 80 80 0 0 0 0 0 0 0 0 2 0 0 0 0 0 24 47 22 4 2 0 51 1 0 1.307 44 1.10 81 81 2 83 10 4 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 52 0 0 0.660 22 1.44 82 82 0 0 0 0 0 0 0 0 0 0 2 0 0 0 35 40 12 12 0 0 52 0 0 1.308 44 1.09 83 83 0 0 0 0 0 0 0 2 90 0 4 0 0 0 0 4 0 0 0 0 52 0 0 0.418 14 1.44 84 84 8 29 8 17 0 0 0 2 35 0 2 0 0 0 0 0 0 0 0 0 52 0 0 1.576 53 0.93 85 85 12 2 2 0 0 0 0 2 0 0 29 13 0 0 4 31 2 2 2 0 52 0 0 1.822 61 0.78 86 86 12 0 2 12 0 0 0 0 67 0 2 4 0 0 0 0 0 0 2 0 52 0 0 1.118 37 1.09 87 87 0 4 0 8 0 0 2 13 19 0 10 38 0 0 2 2 0 0 2 0 52 0 0 1.806 60 0.86 88 88 0 4 2 0 0 0 2 0 10 2 13 6 0 0 4 40 0 0 8 10 52 0 0 1.927 64 0.81 89 89 2 0 4 0 31 0 23 2 4 0 10 6 0 0 0 0 2 17 0 0 52 0 0 1.873 63 0.72 90 90 2 2 0 0 0 0 0 38 31 0 8 2 0 0 2 2 2 0 6 6 52 0 0 1.713 57 0.99 91 91 2 0 0 2 0 0 0 6 10 4 40 10 0 0 10 2 8 0 8 0 52 0 0 1.954 65 0.84 92 92 2 0 0 4 0 0 0 0 8 2 13 6 0 4 10 17 13 0 6 15 52 0 0 2.286 76 0.77 93 93 4 2 0 2 0 0 0 19 4 2 33 23 0 0 0 2 2 0 2 6 52 0 0 1.892 63 0.88 94 94 8 8 2 2 6 0 0 19 15 10 4 6 0 0 0 0 0 8 6 8 52 0 0 2.390 80 0.71 95 95 8 31 15 8 0 0 0 0 12 0 12 0 0 0 0 2 6 4 4 0 52 0 0 2.035 68 0.80 96 96 0 0 2 0 6 0 0 14 2 0 4 0 0 0 2 0 10 6 33 22 51 1 0 1.889 63 0.89 97 97 12 8 10 8 0 0 0 8 6 0 4 8 0 0 27 2 0 0 6 0 49 3 0 2.212 74 0.66 98 98 15 4 2 21 2 0 2 2 13 4 2 13 0 0 10 0 8 0 2 0 48 4 0 2.319 77 0.70 99 99 2 0 0 0 0 0 0 24 10 2 12 4 0 4 10 8 8 2 6 8 50 2 0 2.325 78 0.79 100 100 43 12 33 8 0 0 0 0 2 2 0 0 0 0 0 0 0 0 0 0 51 1 0 1.335 45 1.25 101 101 0 0 0 0 0 0 0 0 4 94 0 0 0 0 0 2 0 0 0 0 51 1 0 0.261 9 1.50 102 102 0 0 0 0 0 0 0 50 2 0 0 13 0 0 0 0 0 2 33 0 52 0 0 1.134 38 1.07 103 103 0 0 0 0 0 0 0 0 0 0 2 94 0 0 0 2 0 0 2 0 52 0 0 0.284 9 1.49 104 104 0 0 0 0 0 0 0 0 0 2 0 0 0 0 2 0 0 0 96 0 52 0 0 0.190 6 1.51 105 105 8 6 6 12 0 0 0 0 0 0 2 0 0 0 2 56 10 0 0 0 52 0 0 1.478 49 0.93 106 106 0 2 2 0 13 0 35 0 0 0 0 4 0 42 0 2 0 0 0 0 52 0 0 1.354 45 0.96 107 107 2 0 0 0 0 0 0 2 19 0 38 15 0 0 2 0 0 0 21 0 52 0 0 1.529 51 0.92 108 108 27 2 15 10 10 0 2 0 12 0 2 17 0 2 0 2 0 0 0 0 52 0 0 2.024 68 0.83 109 109 0 0 0 0 0 0 0 0 0 2 2 0 0 0 0 6 6 71 0 13 52 0 0 0.993 33 1.30 110 110 0 0 0 0 0 0 0 76 0 0 0 0 0 0 24 0 0 0 0 0 51 0 0 0.546 18 1.10 111 111 0 0 0 0 0 0 0 0 43 0 55 0 0 0 0 0 2 0 0 0 51 0 0 0.769 26 1.15 112 112 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 98 0 51 0 0 0.097 3 1.57 113 113 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 51 0 0 0.000 0 1.60 114 114 33 2 39 24 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 51 0 0 1.228 41 1.22 115 115 2 35 0 0 2 52 8 0 0 0 0 0 0 0 0 0 0 0 0 0 48 2 0 1.076 36 1.18 116 116 2 28 2 10 0 0 0 2 0 0 2 0 0 0 0 0 0 0 54 0 50 0 0 1.232 41 0.84 117 117 0 20 0 0 2 0 0 0 0 0 0 2 0 8 0 10 4 18 4 31 49 0 0 1.855 62 0.78 118 118 0 4 0 0 0 0 0 4 17 28 11 9 0 4 0 2 2 4 13 0 46 2 0 2.092 70 0.81 119 119 3 5 25 3 13 0 35 0 3 5 3 0 0 0 0 0 0 5 0 3 40 5 0 1.884 63 0.81 120 120 3 3 0 3 7 0 7 0 0 0 0 20 13 0 0 0 0 20 0 23 30 15 0 1.953 65 0.65 121 121 0 0 0 0 0 0 0 2 2 2 2 7 0 2 21 33 2 5 12 9 43 2 0 2.017 67 0.89 122 122 0 2 0 0 0 0 2 2 26 0 9 2 0 0 2 0 2 5 26 21 43 2 0 1.913 64 0.87 123 123 2 23 5 5 0 16 0 2 0 23 0 0 0 5 2 0 0 9 0 7 43 2 0 2.071 69 0.61 124 124 5 0 2 2 2 10 2 14 2 0 5 0 0 0 0 5 0 14 2 33 42 3 0 2.115 71 0.71 125 125 2 32 2 0 37 0 5 5 0 0 5 2 0 0 2 2 0 5 0 0 41 4 0 1.774 59 0.94 126 126 2 0 0 0 7 0 0 12 10 0 7 7 0 0 0 7 0 12 5 29 41 4 0 2.103 70 0.79 127 127 2 7 0 2 2 0 0 2 31 0 26 2 7 0 0 0 0 5 5 7 42 3 0 2.014 67 0.80 128 128 2 9 14 2 0 0 0 5 0 0 2 0 0 7 0 0 30 9 0 19 43 2 0 1.982 66 0.80 129 129 2 0 2 2 5 0 2 2 9 2 36 11 0 0 0 0 2 16 2 5 44 1 0 2.094 70 0.78 130 130 0 0 0 0 0 0 4 7 4 0 33 0 0 2 2 2 0 27 0 18 45 0 0 1.737 58 0.90 131 131 7 0 0 4 0 0 0 9 4 0 16 9 2 11 2 0 4 16 7 9 45 0 0 2.414 81 0.74 132 132 4 2 0 0 0 0 2 0 0 4 42 0 0 2 11 4 0 16 0 11 45 0 0 1.811 60 0.81 133 133 2 2 0 0 0 0 2 2 0 0 5 2 0 0 0 5 0 0 27 52 44 0 0 1.404 47 1.06 134 134 0 5 0 0 0 0 0 0 2 0 27 0 0 0 0 2 0 5 5 54 41 1 0 1.310 44 1.01 135 135 10 48 5 0 2 2 0 0 0 0 24 0 0 0 0 2 2 0 0 5 42 0 0 1.565 52 0.83 136 136 0 2 2 0 2 0 0 0 0 22 5 2 0 5 0 0 2 2 0 54 41 1 0 1.505 50 0.92 137 137 2 2 2 2 0 0 0 2 5 0 5 0 0 0 2 15 0 51 2 7 41 1 0 1.744 58 0.94 138 138 5 0 0 0 0 0 0 0 0 0 17 0 0 0 2 0 0 0 50 26 42 0 0 1.230 41 1.04 139 139 5 41 5 7 5 0 0 2 12 0 10 5 0 0 0 2 0 5 0 0 41 0 0 1.958 65 0.84 140 140 20 10 0 0 0 0 0 0 0 20 20 0 0 0 2 0 10 5 5 10 41 0 0 2.023 68 0.70 141 141 0 0 0 0 0 0 0 0 3 5 13 0 0 3 0 0 18 18 13 28 39 0 0 1.840 61 0.98 142 142 3 14 17 0 29 0 3 0 6 0 3 0 3 0 3 0 3 6 11 0 35 3 0 2.123 71 0.73 143 143 0 3 3 0 0 0 0 6 11 0 6 14 0 0 19 11 6 11 0 11 36 1 0 2.250 75 0.73 144 144 3 3 3 0 3 0 3 3 0 0 3 6 0 0 0 3 3 9 9 51 35 1 0 1.841 61 0.94 145 145 3 29 0 6 6 0 3 0 0 0 3 0 0 0 0 3 3 0 9 35 34 2 0 1.794 60 0.70 146 146 3 0 3 6 13 13 19 3 6 3 23 0 0 0 3 0 0 0 0 3 31 3 0 2.201 73 0.66 147 147 6 6 0 3 9 0 0 0 0 0 6 3 0 0 0 18 3 3 33 9 33 1 0 2.046 68 0.72 148 148 0 0 0 0 0 0 3 0 0 12 30 3 0 0 0 6 0 15 3 27 33 1 0 1.746 58 0.88 149 149 3 10 7 3 0 0 0 3 0 60 0 10 0 0 3 0 0 0 0 0 30 3 0 1.401 47 0.93 150 150 16 0 0 0 3 0 0 0 26 0 10 16 0 0 0 10 3 6 0 10 31 2 0 2.015 67 0.75 151 151 7 0 0 0 0 0 7 0 14 0 7 7 0 0 18 18 0 4 18 0 28 3 0 2.074 69 0.68 152 152 7 0 0 0 0 0 0 0 0 7 11 44 0 7 0 0 4 0 4 15 27 3 0 1.710 57 0.86 153 153 0 4 0 4 0 0 0 0 4 4 4 0 0 33 0 22 0 7 15 4 27 3 0 1.909 64 0.80 154 154 4 0 0 0 4 0 0 22 0 4 0 0 0 4 4 7 19 7 26 0 27 3 0 1.992 67 0.79 155 155 0 0 0 4 0 0 0 0 4 4 4 24 0 0 8 12 0 8 32 0 25 4 0 1.881 63 0.79 156 156 4 0 4 0 56 0 0 4 4 8 0 8 0 4 0 0 0 4 4 0 25 4 0 1.630 54 0.74 157 157 0 0 4 0 4 0 0 44 4 0 8 0 0 0 4 24 0 4 0 4 25 4 0 1.678 56 0.79 158 158 0 4 0 0 24 0 4 4 4 0 12 4 0 0 28 4 4 0 0 8 25 4 0 2.057 69 0.61 159 159 0 4 0 4 0 0 0 0 7 4 4 0 0 0 0 22 0 30 26 0 27 3 0 1.726 58 0.85 160 160 0 0 0 0 0 0 0 0 7 63 15 4 0 0 0 4 4 0 0 4 27 3 0 1.255 42 1.10 161 161 4 7 0 0 0 0 14 0 21 4 7 21 0 4 0 4 4 11 0 0 28 2 0 2.150 72 0.65 162 162 0 0 3 0 7 0 7 0 28 41 0 0 0 7 0 3 0 0 3 0 29 1 0 1.622 54 0.78 163 163 11 15 15 4 26 0 4 0 0 0 11 11 0 4 0 0 0 0 0 0 27 2 0 2.014 67 0.82 164 164 0 7 0 0 0 0 3 0 3 3 28 7 0 3 0 24 0 10 7 3 29 0 0 2.067 69 0.72 165 165 0 0 0 4 0 0 0 0 4 73 8 0 0 4 0 4 0 4 0 0 26 0 0 1.053 35 1.14 166 166 0 0 5 0 0 0 0 0 0 5 18 5 0 0 0 0 9 50 0 9 22 0 0 1.514 51 0.97 167 167 7 14 0 0 0 0 0 7 0 0 0 0 0 0 14 0 0 7 0 50 14 1 0 1.468 56 0.77 168 168 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 7 7 0 0 79 14 1 0 0.755 29 1.26 169 169 0 0 0 0 0 0 0 0 0 0 0 0 0 0 50 8 8 25 0 8 12 1 0 1.314 53 0.94 170 170 8 0 0 0 8 0 42 0 8 8 17 0 0 0 0 0 0 0 0 8 12 1 0 1.699 68 0.61 171 171 0 69 8 0 0 0 0 0 8 0 8 8 0 0 0 0 0 0 0 0 13 0 0 1.044 41 1.02 172 172 0 0 0 0 0 0 0 0 17 0 0 8 0 0 33 0 8 8 17 8 12 0 0 1.792 72 0.72 173 173 0 0 0 0 0 0 0 0 58 8 0 8 0 0 0 8 0 8 0 8 12 0 0 1.350 54 0.98 174 174 0 8 0 8 0 0 0 8 50 0 0 0 0 0 0 0 0 8 8 8 12 0 0 1.589 64 0.83 175 175 27 18 55 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 1 0 0.995 41 1.32 176 176 0 0 0 0 0 0 0 13 0 0 0 0 0 0 0 13 50 13 0 13 8 0 0 1.386 67 0.93 177 177 0 0 0 0 0 0 13 0 13 0 0 0 0 0 0 0 13 63 0 0 8 0 0 1.074 52 0.84 178 178 0 0 0 0 13 0 63 0 13 0 0 0 0 0 0 0 0 0 0 13 8 0 0 1.074 52 0.82 179 179 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13 13 0 75 8 0 0 0.736 35 1.34 180 180 0 0 0 13 0 0 0 0 13 0 13 0 0 0 0 0 0 0 63 0 8 0 0 1.074 52 0.90 181 181 13 13 63 0 0 0 13 0 0 0 0 0 0 0 0 0 0 0 0 0 8 0 0 1.074 52 1.13 182 182 0 0 0 0 0 0 0 0 50 0 13 25 0 0 0 0 0 13 0 0 8 0 0 1.213 58 0.93 183 183 0 0 0 0 0 0 0 0 0 0 0 0 0 0 25 75 0 0 0 0 8 0 0 0.562 27 1.35 184 184 0 75 0 0 13 0 0 0 0 0 0 0 0 0 0 13 0 0 0 0 8 0 0 0.736 35 1.14 185 185 0 0 0 0 0 0 0 86 0 0 0 0 0 0 0 0 0 0 0 14 7 0 0 0.410 21 1.40 186 186 0 0 0 0 0 0 0 0 0 14 0 0 0 0 0 14 57 14 0 0 7 0 0 1.154 59 0.91 187 187 17 0 67 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 0 0 6 0 0 0.868 48 0.91 188 188 0 17 33 33 0 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 6 0 0 1.330 74 0.85 189 189 0 0 17 0 0 0 0 0 0 0 0 0 0 0 67 17 0 0 0 0 6 0 0 0.868 48 0.82 190 190 0 0 0 0 0 0 0 17 17 0 0 0 0 0 0 0 0 67 0 0 6 0 0 0.868 48 0.98 191 191 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.000 0 1.60 192 192 0 0 0 0 0 0 0 0 0 83 0 0 0 0 0 0 0 17 0 0 6 0 0 0.451 25 1.15 193 193 17 0 67 0 0 0 0 0 0 0 17 0 0 0 0 0 0 0 0 0 6 0 0 0.868 48 0.96 194 194 0 0 0 0 0 0 0 0 0 0 17 0 0 17 0 67 0 0 0 0 6 0 0 0.868 48 0.78 195 195 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.000 0 1.60 196 196 0 17 0 0 0 0 0 0 17 0 67 0 0 0 0 0 0 0 0 0 6 0 0 0.868 48 0.72 197 197 0 80 0 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.46 198 198 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 199 199 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 60 0 0 20 0 5 0 0 0.950 59 0.61 200 200 80 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.98 201 201 80 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.41 202 202 0 80 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.74 203 203 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 60 0 40 5 0 0 0.673 42 1.39 204 204 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 20 0 80 5 0 0 0.500 31 1.36 205 205 0 20 0 0 0 0 80 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.03 206 206 0 80 0 0 0 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 5 0 0 0.500 31 0.74 207 207 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 5 0 0 0.000 0 1.60 208 208 0 80 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.74 209 209 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80 0 20 0 0 5 0 0 0.500 31 1.03 210 210 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 5 0 0 0.500 31 0.79 211 211 0 80 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.27 212 212 0 0 0 0 80 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 5 0 0 0.500 31 0.64 213 213 0 0 0 0 0 0 0 0 80 0 0 0 0 20 0 0 0 0 0 0 5 0 0 0.500 31 0.84 214 214 0 0 0 0 0 0 0 0 40 0 0 0 0 20 0 0 40 0 0 0 5 0 0 1.055 66 0.79 215 215 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80 20 0 0 0 0 5 0 0 0.500 31 1.27 216 216 0 40 0 40 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 5 0 0 1.055 66 0.80 217 217 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 218 218 0 20 0 0 0 0 0 0 0 0 0 20 0 20 0 0 40 0 0 0 5 0 0 1.332 83 0.61 219 219 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 60 0 20 0 0 5 0 0 0.950 59 0.74 220 220 0 0 0 0 0 0 0 0 40 0 60 0 0 0 0 0 0 0 0 0 5 0 0 0.673 42 1.14 221 221 0 0 0 0 0 0 20 0 0 0 40 40 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.61 222 222 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 20 0 0 0 0 5 0 0 0.500 31 0.98 223 223 0 0 0 0 0 0 0 0 0 20 0 0 40 0 0 0 20 0 20 0 5 0 0 1.332 83 0.61 224 224 0 0 0 0 0 0 0 0 0 20 0 0 0 60 0 0 20 0 0 0 5 0 0 0.950 59 0.89 225 225 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 226 226 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 227 227 40 0 40 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.91 228 228 0 20 0 0 0 0 0 0 0 0 40 40 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.61 229 229 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 83 0 0 6 0 0 0.451 25 1.04 230 230 17 83 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.451 25 1.37 231 231 0 17 67 0 0 0 17 0 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.868 48 0.98 232 232 0 0 0 0 0 0 0 0 0 17 0 0 0 17 0 0 67 0 0 0 6 0 0 0.868 48 1.10 233 233 0 17 0 0 0 0 0 0 0 0 50 33 0 0 0 0 0 0 0 0 6 0 0 1.011 56 0.74 234 234 0 0 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 67 6 0 0 0.868 48 0.98 235 235 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.000 0 1.60 236 236 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 83 6 0 0 0.451 25 1.51 237 237 0 0 0 0 0 0 0 0 17 0 0 0 0 17 0 0 0 50 0 17 6 0 0 1.242 69 0.86 238 238 0 0 0 0 0 0 17 0 0 0 0 0 0 0 0 17 0 50 0 17 6 0 0 1.242 69 0.61 239 239 0 0 0 0 0 0 0 0 0 50 0 17 0 0 0 0 0 33 0 0 6 0 0 1.011 56 0.88 240 240 0 0 0 0 0 0 0 33 17 0 0 0 0 0 0 0 17 17 0 17 6 0 0 1.561 87 0.88 241 241 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 17 0 17 0 50 6 0 0 1.242 69 0.83 242 242 0 0 0 0 0 0 0 0 17 0 17 0 0 33 0 0 33 0 0 0 6 0 0 1.330 74 0.65 243 243 0 0 0 0 0 0 0 17 0 0 50 0 0 0 0 0 0 0 17 17 6 0 0 1.242 69 0.98 244 244 0 0 0 0 0 0 0 33 0 67 0 0 0 0 0 0 0 0 0 0 6 0 0 0.637 36 1.12 245 245 0 0 0 0 0 0 0 50 0 0 33 0 0 0 17 0 0 0 0 0 6 0 0 1.011 56 0.83 246 246 0 0 0 0 0 0 0 0 0 0 0 0 0 50 17 0 33 0 0 0 6 0 0 1.011 56 1.16 247 247 0 0 0 0 0 0 0 67 0 0 0 0 0 0 17 0 17 0 0 0 6 0 0 0.868 48 0.73 248 248 0 0 0 0 0 0 0 0 0 0 33 33 0 0 0 17 0 0 0 17 6 0 0 1.330 74 0.73 249 249 17 83 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 0 0 0.451 25 1.37 250 250 0 0 0 0 0 0 0 0 0 0 0 0 0 33 67 0 0 0 0 0 6 0 0 0.637 36 1.20 251 251 0 0 0 0 83 0 0 0 0 0 17 0 0 0 0 0 0 0 0 0 6 0 0 0.451 25 1.01 252 252 0 0 0 0 0 0 0 0 0 0 0 0 0 17 33 50 0 0 0 0 6 0 0 1.011 56 1.04 253 253 0 0 0 17 0 0 0 0 0 0 0 0 0 83 0 0 0 0 0 0 6 0 0 0.451 25 1.01 254 254 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 80 0 0 0 0 5 0 0 0.500 31 0.88 255 255 0 20 0 0 0 0 0 0 0 40 0 0 0 0 0 0 20 20 0 0 5 0 0 1.332 83 0.62 256 256 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 257 257 60 0 0 40 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.673 42 1.26 258 258 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 5 0 0 0.000 0 1.60 259 259 0 80 0 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.53 260 260 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 80 0 0 0 0 5 0 0 0.500 31 0.98 261 261 0 0 0 0 0 0 0 80 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.22 262 262 0 0 0 0 0 0 0 0 20 60 0 0 0 0 0 0 20 0 0 0 5 0 0 0.950 59 0.96 263 263 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 20 80 5 0 0 0.500 31 1.22 264 264 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 265 265 20 0 60 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.950 59 0.86 266 266 0 0 0 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 20 5 0 0 0.500 31 1.08 267 267 60 0 0 40 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.673 42 1.19 268 268 80 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.98 269 269 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 5 0 0 0.000 0 1.60 270 270 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 271 271 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 272 272 0 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 0 20 0 5 0 0 0.500 31 0.98 273 273 0 0 0 0 0 0 0 80 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.22 274 274 0 0 0 0 0 0 0 0 0 20 0 80 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.03 275 275 0 80 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.69 276 276 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 277 277 0 0 0 0 0 0 0 0 40 0 20 40 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.86 278 278 0 0 0 0 0 0 0 20 0 0 40 40 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.91 279 279 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 5 0 0 0.000 0 1.60 280 280 0 60 20 0 0 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 5 0 0 0.950 59 0.66 281 281 0 0 0 0 0 0 0 0 0 0 0 20 0 0 0 20 0 0 60 0 5 0 0 0.950 59 0.84 282 282 20 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.84 283 283 0 80 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.51 284 284 0 20 0 0 0 0 0 0 0 80 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.74 285 285 0 0 0 0 0 0 0 0 0 0 0 0 0 20 0 0 0 80 0 0 5 0 0 0.500 31 1.08 286 286 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 40 0 60 5 0 0 0.673 42 1.38 287 287 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 0 80 5 0 0 0.500 31 0.64 288 288 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 80 0 0 0 5 0 0 0.500 31 0.84 289 289 0 0 0 0 0 0 0 0 0 0 0 0 0 0 40 60 0 0 0 0 5 0 0 0.673 42 1.26 290 290 0 0 20 0 20 0 0 40 20 0 0 0 0 0 0 0 0 0 0 0 5 0 0 1.332 83 0.61 291 291 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 292 292 0 20 0 0 0 0 0 20 40 0 0 0 0 0 0 0 0 0 0 20 5 0 0 1.332 83 0.61 293 293 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80 0 20 0 0 0 5 0 0 0.500 31 1.08 294 294 0 0 0 0 0 0 0 0 20 0 80 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.08 295 295 0 80 0 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.53 296 296 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 5 0 0 0.000 0 1.60 297 297 0 0 0 0 0 0 0 0 20 0 0 60 0 0 20 0 0 0 0 0 5 0 0 0.950 59 0.67 298 298 0 80 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 5 0 0 0.500 31 0.84 299 299 0 0 0 0 0 0 0 0 0 0 20 40 0 0 0 0 0 0 40 0 5 0 0 1.055 66 0.80 300 300 0 0 0 0 0 0 0 0 40 0 20 20 0 20 0 0 0 0 0 0 5 0 0 1.332 83 0.61 301 301 0 0 0 0 0 0 0 0 20 0 40 0 0 0 0 0 0 0 0 40 5 0 0 1.055 66 0.93 302 302 0 0 0 0 0 0 0 20 20 0 20 0 0 0 0 0 0 40 0 0 5 0 0 1.332 83 0.85 303 303 0 0 0 0 0 0 0 60 40 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.673 42 1.27 304 304 0 20 20 0 20 0 0 0 0 0 0 40 0 0 0 0 0 0 0 0 5 0 0 1.332 83 0.75 305 305 0 0 0 0 0 0 40 0 40 20 0 0 0 0 0 0 0 0 0 0 5 0 0 1.055 66 0.61 306 306 0 0 0 0 40 0 0 0 0 20 20 0 0 0 0 0 0 0 20 0 5 0 0 1.332 83 0.61 307 307 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 60 0 20 5 0 0 0.950 59 0.96 308 308 0 0 0 0 0 0 0 0 0 0 20 0 0 0 80 0 0 0 0 0 5 0 0 0.500 31 0.93 309 309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 20 80 0 5 0 0 0.500 31 1.12 310 310 0 0 0 0 0 0 0 0 80 20 0 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.12 311 311 0 0 0 0 20 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 5 0 0 0.500 31 0.64 312 312 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 313 313 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 80 0 0 5 0 0 0.500 31 0.98 314 314 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 315 315 0 0 0 0 0 0 0 0 80 0 0 0 20 0 0 0 0 0 0 0 5 0 0 0.500 31 1.03 316 316 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 80 0 0 0 0 5 0 0 0.500 31 0.98 317 317 0 0 0 0 0 0 0 20 0 0 80 0 0 0 0 0 0 0 0 0 5 0 0 0.500 31 1.17 318 318 0 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 0 20 0 5 0 0 0.500 31 0.98 319 319 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 320 320 0 60 20 20 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.950 59 1.38 321 321 0 0 0 0 0 0 20 0 0 0 0 0 0 80 0 0 0 0 0 0 5 0 0 0.500 31 1.03 322 322 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 80 0 0 0 0 5 0 0 0.500 31 0.88 323 323 0 40 0 20 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 20 5 0 0 1.332 83 0.61 324 324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 40 40 0 20 0 0 5 0 0 1.055 66 1.04 325 325 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 20 40 40 5 0 0 1.055 66 1.13 326 326 60 0 20 0 0 0 0 0 0 0 0 20 0 0 0 0 0 0 0 0 5 0 0 0.950 59 1.13 327 327 0 20 60 0 0 0 20 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.950 59 0.86 328 328 0 0 0 60 0 0 0 0 0 0 20 20 0 0 0 0 0 0 0 0 5 0 0 0.950 59 0.68 329 329 0 0 0 0 0 0 0 0 0 0 0 20 0 0 0 0 0 80 0 0 5 0 0 0.500 31 0.98 330 330 0 0 20 0 0 0 0 0 0 0 60 20 0 0 0 0 0 0 0 0 5 0 0 0.950 59 1.01 331 331 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 332 332 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0.000 0 1.60 333 333 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 5 0 0 0.000 0 1.60 334 334 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0.000 0 1.60 335 335 0 0 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 4 0 0 0.000 0 1.60 336 336 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100 0 0 4 0 0 0.000 0 1.60 337 337 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0.000 0 1.60 // profbval-1.0.22/examples/cad23-fil.rdbProf0000644015075101507510000011066312012432757015160 00000000000000# Perl-RDB # PROF3 # # Copyright : Burkhard Rost, CUBIC NYC / LION Heidelberg # Email : rost@columbia.edu # WWW : http://cubic.bioc.columbia.edu # Version : 2000.02 # # -------------------------------------------------------------------------------- # About your protein : # # VALUE PROT_ID : query # VALUE PROT_NCHN : 1 # VALUE PROT_NRES : 337 # VALUE PROT_NALI : 53 # VALUE PROT_NFAR : 50 # VALUE PROT_NFAR50-5: 6 # VALUE PROT_NFAR40-5: 6 # VALUE PROT_NFAR30-5: 6 # VALUE PROT_NFAR5-5: 0 # # -------------------------------------------------------------------------------- # About the alignment: # # VALUE ALI_ORIG : cad23-fil.hssp # # -------------------------------------------------------------------------------- # PROFhtm summary: # # VALUE HTM_NHTM_BEST : 1 (number of helices for best model) # VALUE HTM_NHTM_2ND_BEST : 0 (number of helices for second best model) # VALUE HTM_REL_BEST : 0.000 (reliability of best model =zscore) # VALUE HTM_REL_BEST_DIFF : 0.045 (reliability of best model =1st-2nd) # VALUE HTM_REL_BEST_DPROJ : 4 (reliability of best model projection of (1st-2nd) # VALUE HTM_MODEL : iteratively adding transmembrane helices (HTM's) # VALUE HTM_MODEL_DAT : 1 , 0.9637 , 0.9022 , 51 - 69 # VALUE HTM_HTMTOP_OBS : unk (first loop region) # VALUE HTM_HTMTOP_PRD : out (first loop region, mode=top_fin) # VALUE HTM_HTMTOP_MODPRD : out (first loop region, mode=PRHL) # VALUE HTM_HTMTOP_RID : 12.840 (difference num(K+R), even-odd) # VALUE HTM_HTMTOP_RIP : 9 (reliability index =int(min{9,2*sqrt((DC)^2)}) ) # # -------------------------------------------------------------------------------- # About PROF specifics: # # VALUE PROF_FPAR : acc=/usr/share/profphd/prof/net/PROFboth_best.par # VALUE PROF_NNET : acc=6 # # -------------------------------------------------------------------------------- # Notation used : # # ------------------------------------------------------------------------ # NOTATION HEADER : PROTEIN # NOTATION PROT_ID : identifier of protein [w] # NOTATION PROT_NRES : number of residues [d] # NOTATION PROT_NCHN : number of chains (if PDB protein) [d] # NOTATION PROT_NALI : number of proteins aligned in family [d] # NOTATION PROT_NFAR : number of distant relatives [d] # # ------------------------------------------------------------------------ # NOTATION HEADER : ALIGNMENT # NOTATION HEADER : ALIGNMENT: input file # # ------------------------------------------------------------------------ # NOTATION HEADER : INTERNAL # NOTATION PROF_FPAR : name of parameter file, used [w] # NOTATION PROF_NNET : number of networks used for prediction [d] # # # ------------------------------------------------------------------------ # NOTATION BODY : PROTEIN # NOTATION NO : counting residues [d] # NOTATION AA : amino acid one letter code [A-Z!a-z] # NOTATION CHN : protein chain [A-Z!a-z] # # ------------------------------------------------------------------------ # NOTATION BODY : PROF # # ------------------------------------------------------------------------ # NOTATION BODY : PROFsec # NOTATION OHEL : observed secondary structure: H=helix, E=extended (sheet), blank=other (loop) # NOTATION PHEL : PROF predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PROF = PROF: Profile network prediction HeiDelberg # NOTATION RI_S : reliability index for PROFsec prediction (0=lo 9=high) Note: for the brief presentation strong predictions marked by '*' # NOTATION pH : 'probability' for assigning helix (1=high, 0=low) # NOTATION pE : 'probability' for assigning strand (1=high, 0=low) # NOTATION pL : 'probability' for assigning neither helix, nor strand (1=high, 0=low) # NOTATION OtH : actual neural network output from PROFsec for helix unit # NOTATION OtE : actual neural network output from PROFsec for strand unit # NOTATION OtL : actual neural network output from PROFsec for 'no-regular' unit # # ------------------------------------------------------------------------ # NOTATION BODY : PROFacc # NOTATION OACC : observed solvent accessibility (acc) in square Angstroem (taken from DSSP: W Kabsch and C Sander, Biopolymers, 22, 2577-2637, 1983) # NOTATION PACC : PROF predicted solvent accessibility (acc) in square Angstroem # NOTATION OREL : observed relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). # NOTATION PREL : PROF predicted relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). # NOTATION RI_A : reliability index for PROFacc prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' # NOTATION Obe : observerd relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. # NOTATION Pbe : PROF predicted relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. # NOTATION Obie : observerd relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. # NOTATION Pbie : PROF predicted relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. # NOTATION Ot4 : actual neural network output from PROFsec for unit 0 coding for a relative solvent accessibility of 4*4 - 5*5 percent (16-25%). Note: OtN, with N=0-9 give the same information for the other output units! # # ------------------------------------------------------------------------ # NOTATION BODY : PROFhtm # NOTATION OMN : observed membrane helix: M=helical transmembrane region, blank=non-membrane # NOTATION PMN : PROF predicted membrane helix: M=helical transmembrane region, blank=non-membrane PROF = PROF: Profile network prediction HeiDelberg # NOTATION PRMN : refined PROF prediction: M=helical transmembrane region, blank=non-membrane # NOTATION RI_M : reliability index for PROFhtm prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' # NOTATION pM : 'probability' for assigning transmembrane helix # NOTATION pN : 'probability' for assigning globular region # # -------------------------------------------------------------------------------- # No AA OHEL PHEL RI_S OACC PACC OREL PREL RI_A PMN PRMN PiMo RI_M pH pE pL pM pN Obe Pbe Obie Pbie OtH OtE OtL Ot0 Ot1 Ot2 Ot3 Ot4 Ot5 Ot6 Ot7 Ot8 Ot9 OtM OtN 1 D L L 9 0 146 0 90 4 L L o 9 0 0 9 0 9 b e b e 1 1 96 1 1 2 4 8 13 20 25 33 35 2 97 2 Y L L 7 0 44 0 20 2 L L o 9 1 0 8 0 9 b e b i 12 8 82 8 11 15 21 24 23 20 15 13 12 1 98 3 K L L 5 0 114 0 56 6 L L o 9 1 1 7 0 9 b e b e 19 11 75 0 0 2 5 10 18 27 33 33 30 1 98 4 D L L 3 0 117 0 72 3 L L o 9 3 0 6 0 9 b e b e 34 8 68 3 3 5 8 12 18 25 28 29 27 1 98 5 H L L 4 0 36 0 20 1 L L o 9 2 0 6 0 9 b e b i 29 7 71 8 10 14 20 23 23 21 18 17 15 1 98 6 D L L 4 0 117 0 72 3 L L o 9 2 0 6 0 9 b e b e 32 6 72 4 5 7 11 14 18 23 26 29 29 1 98 7 G L L 5 0 75 0 90 1 L L o 9 2 0 7 0 9 b e b e 24 5 78 6 7 10 14 17 18 19 20 23 24 1 98 8 D L L 4 0 91 0 56 3 L L o 9 2 0 6 0 9 b e b e 29 9 69 5 6 8 12 15 20 25 27 26 24 1 98 9 Y L L 1 0 26 0 12 3 L L o 9 3 1 5 0 9 b b b i 43 11 56 14 18 24 27 26 21 15 11 9 7 1 98 10 K L L 0 0 114 0 56 6 L L o 9 4 0 5 0 9 b e b e 49 7 58 0 1 2 5 10 18 28 32 31 27 1 98 11 D L L 1 0 117 0 72 1 L L o 9 4 0 5 0 9 b e b e 47 4 61 7 8 10 13 15 18 21 22 23 22 1 98 12 H L L 0 0 103 0 56 2 L L o 9 4 0 5 0 9 b e b e 49 4 57 6 7 9 13 16 20 22 23 22 21 1 98 13 D L L 1 0 68 0 42 2 L L o 9 4 0 5 0 9 b e b e 46 3 57 8 8 9 12 15 19 22 22 18 14 1 98 14 I L H 4 0 33 0 20 2 L L o 9 6 0 2 0 9 b e b i 72 2 30 13 15 18 22 23 22 19 15 10 7 1 98 15 D L H 5 0 91 0 56 5 L L o 9 7 0 2 0 9 b e b e 74 4 22 3 4 5 8 11 16 23 29 28 25 1 98 16 Y L H 7 0 66 0 30 2 L L o 9 8 0 1 0 9 b e b i 85 3 12 11 12 15 19 22 24 23 18 12 8 1 98 17 K L H 7 0 0 0 0 1 L L o 9 8 0 1 0 9 b b b b 85 2 14 26 24 21 20 19 17 14 10 7 5 1 98 18 D L H 6 0 68 0 42 2 L L o 9 8 0 1 0 9 b e b e 83 2 16 8 9 12 17 20 23 24 20 15 10 1 98 19 D L H 7 0 68 0 42 3 L L o 9 8 0 1 0 9 b e b e 86 2 12 4 5 8 12 16 21 24 22 17 13 1 98 20 D L H 8 0 0 0 0 0 L L o 9 8 0 0 0 9 b b b b 89 1 9 23 22 22 21 19 16 13 9 5 3 1 98 21 D L H 8 0 0 0 0 0 L L o 9 8 0 0 0 9 b b b b 89 2 8 22 21 21 21 21 20 17 14 9 7 1 98 22 K L H 8 0 114 0 56 6 L L o 9 8 0 0 0 9 b e b e 89 3 8 2 2 3 5 10 17 26 31 28 23 1 98 23 L L H 8 0 32 0 20 1 L L o 9 8 0 0 0 9 b e b i 89 1 9 12 13 15 19 22 22 21 17 11 8 1 98 24 A L H 6 0 21 0 20 1 L L o 9 8 0 1 0 9 b e b i 82 2 16 16 16 17 20 22 22 19 14 10 7 1 98 25 A L H 5 0 59 0 56 2 L L o 9 7 0 2 0 9 b e b e 76 3 22 9 9 10 12 14 17 19 21 21 19 1 98 26 A L H 1 0 21 0 20 1 L L o 9 5 0 3 0 9 b e b i 58 4 41 11 13 16 20 22 22 20 17 14 11 1 98 27 N L L 2 0 87 0 56 1 L L o 9 3 0 6 0 9 b e b e 36 6 64 8 9 11 14 17 20 22 23 20 18 1 98 28 S L L 4 0 7 0 6 2 L L o 9 2 1 6 0 9 b b b b 22 11 69 21 23 25 25 21 17 13 10 7 6 1 98 29 N L L 4 0 9 0 6 0 L L o 9 1 2 6 0 9 b b b b 14 21 67 20 20 21 21 20 18 16 14 12 10 1 98 30 V L E 0 0 0 0 0 3 L L o 9 0 4 4 0 9 b b b b 10 50 45 30 28 22 20 16 13 10 7 6 4 1 98 31 L L E 3 0 0 0 0 3 L L o 9 0 6 2 0 9 b b b b 6 68 31 31 28 22 18 14 11 7 5 3 3 1 98 32 D L E 2 0 48 0 30 1 L L o 9 0 5 3 0 9 b e b i 8 61 37 15 15 15 17 19 21 20 17 13 10 1 98 33 V L L 2 0 0 0 0 0 L L o 9 0 3 5 0 9 b b b b 9 38 60 24 23 22 21 19 17 13 10 8 7 2 97 34 Q L L 5 0 59 0 30 2 L L o 9 0 2 6 0 9 b e b i 10 22 72 11 11 13 16 19 21 20 18 14 12 1 98 35 P L L 4 0 57 0 42 0 L L o 9 2 0 6 0 9 b e b e 28 9 71 13 13 14 16 18 20 22 22 21 19 1 98 36 A L L 2 0 76 0 72 0 L L o 9 3 0 5 0 9 b e b e 41 10 63 12 12 13 15 17 19 20 21 22 22 1 98 37 I L L 1 0 94 0 56 1 L L o 9 3 1 4 0 9 b e b e 44 15 54 8 9 12 15 18 21 22 23 22 21 1 98 38 S L L 1 0 93 0 72 1 L L o 9 3 1 5 0 9 b e b e 42 13 57 8 8 10 13 16 19 22 23 24 23 1 98 39 V L L 2 0 42 0 30 0 L L o 9 3 1 5 0 9 b e b i 33 17 59 9 10 13 17 20 21 21 21 21 20 1 98 40 Q L L 3 0 142 0 72 3 L L o 9 2 1 5 0 9 b e b e 25 19 62 5 6 7 10 13 18 22 26 28 28 3 96 41 L L L 5 0 19 0 12 1 L L o 9 1 1 7 0 9 b b b i 19 12 74 17 19 22 23 21 18 14 11 9 8 4 95 42 P L L 4 0 57 0 42 0 L L o 8 2 0 6 0 9 b e b e 26 10 69 10 10 12 15 18 21 22 22 21 20 5 94 43 D L L 3 0 146 0 90 3 L L o 8 2 0 6 0 9 b e b e 31 8 65 3 4 5 8 11 15 19 24 30 32 6 93 44 D L L 2 0 91 0 56 3 L L o 8 3 0 6 0 9 b e b e 34 6 61 4 5 7 10 13 18 23 25 25 23 9 90 45 M L H 0 0 22 0 12 1 L L o 6 4 0 4 1 8 b b b i 49 7 47 19 20 22 23 22 19 15 12 10 9 17 82 46 S L H 0 0 72 0 56 2 L L o 3 4 0 4 3 6 b e b e 51 7 45 9 9 10 12 15 19 22 23 22 21 30 69 47 A L H 2 0 31 0 30 1 L L o 1 5 0 3 4 5 b e b i 61 6 36 15 15 16 18 20 21 20 17 14 11 43 56 48 L L H 4 0 0 0 0 1 H L o 2 6 1 2 6 3 b b b b 68 10 22 27 25 22 21 19 15 11 8 5 4 61 38 49 Q L H 5 0 0 0 0 1 H L o 4 7 1 1 7 2 b b b b 73 11 16 25 23 20 20 18 16 13 9 6 4 75 25 50 M L H 6 0 0 0 0 4 H L o 6 7 1 0 8 1 b b b b 76 15 8 32 28 19 16 13 11 8 5 2 1 82 17 51 A L H 6 0 0 0 0 6 H H T 7 7 1 0 8 1 b b b b 81 17 5 37 31 19 14 11 8 5 2 1 0 86 13 52 I L H 7 0 0 0 0 9 H H T 7 8 0 0 8 1 b b b b 88 10 4 41 33 17 11 8 6 4 2 1 0 88 11 53 I L H 8 0 0 0 0 6 H H T 8 8 0 0 9 0 b b b b 90 8 4 35 29 18 14 11 8 5 3 1 0 90 9 54 V L H 8 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 92 5 4 41 32 16 11 7 5 3 2 1 0 91 8 55 L L H 9 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 94 2 3 42 33 16 10 6 4 2 1 0 0 91 8 56 A L H 8 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 93 2 5 41 32 15 10 7 5 3 2 1 0 91 8 57 I L H 8 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 93 1 4 41 32 15 10 6 4 3 2 1 0 90 9 58 L L H 8 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 93 1 5 40 31 15 10 7 5 3 2 1 0 89 10 59 L L H 9 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 94 1 4 41 32 16 10 7 5 3 1 0 0 88 11 60 F L H 8 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 93 1 4 42 33 16 10 7 5 3 1 0 0 88 11 61 L L H 9 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 94 1 4 46 35 14 8 5 3 1 0 0 0 89 10 62 A L H 9 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 94 1 4 44 33 14 9 6 4 3 2 1 0 89 10 63 A L H 8 0 0 0 0 9 H H T 7 9 0 0 8 1 b b b b 93 1 4 44 33 14 9 6 4 2 1 0 0 89 10 64 M L H 8 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 93 2 4 46 36 16 9 5 3 1 0 0 0 90 9 65 L L H 8 0 0 0 0 9 H H T 8 9 0 0 9 0 b b b b 93 2 4 47 35 14 8 4 2 1 0 0 0 90 9 66 F L H 8 0 0 0 0 8 H H T 8 9 0 0 9 0 b b b b 92 3 5 40 32 18 12 8 5 3 1 0 0 90 9 67 V L H 8 0 0 0 0 9 H H T 8 8 0 0 9 0 b b b b 90 4 7 45 34 15 9 6 4 2 1 0 0 91 8 68 L L H 8 0 0 0 0 9 H H T 8 8 0 0 9 0 b b b b 89 4 7 43 34 18 12 8 5 3 1 0 0 90 9 69 M L H 7 0 0 0 0 8 H H T 7 8 0 0 8 1 b b b b 86 5 8 41 33 18 12 8 5 3 2 1 0 87 12 70 N L H 6 0 0 0 0 4 H L i 6 8 0 1 8 1 b b b b 81 6 12 32 28 20 17 14 11 7 4 2 1 84 15 71 W L H 7 0 0 0 0 4 H L i 5 8 0 1 7 2 b b b b 82 7 10 33 28 21 17 13 10 7 4 2 1 77 22 72 Y L H 5 0 0 0 0 4 H L i 3 7 0 1 6 3 b b b b 77 4 20 32 28 21 17 15 11 8 4 2 1 66 33 73 Y L H 5 0 0 0 0 3 H L i 0 7 0 2 5 4 b b b b 72 5 21 28 25 20 18 16 13 10 7 5 4 53 45 74 R L H 5 0 49 0 20 2 L L i 2 7 0 2 3 6 b e b i 74 3 23 16 16 17 20 23 23 20 15 10 7 35 64 75 T L H 4 0 42 0 30 2 L L i 3 7 0 2 3 6 b e b i 72 3 24 11 12 14 18 21 23 22 19 15 12 30 69 76 I L H 5 0 33 0 20 0 L L i 6 7 0 2 1 8 b e b i 77 2 21 18 17 18 19 21 21 19 16 12 9 19 79 77 H L H 6 0 0 0 0 1 L L i 7 8 0 1 1 8 b b b b 80 1 19 25 24 22 21 19 15 12 9 7 5 10 89 78 K L H 6 0 61 0 30 2 L L i 8 8 0 1 0 9 b e b i 81 1 18 13 13 15 19 22 24 23 20 15 11 6 93 79 R L H 6 0 104 0 42 2 L L i 9 8 0 1 0 9 b e b e 82 2 16 8 9 12 16 20 23 24 21 14 10 4 95 80 K L H 6 0 41 0 20 1 L L i 9 8 0 1 0 9 b e b i 83 2 15 18 17 18 20 22 22 19 14 9 6 3 96 81 L L H 7 0 0 0 0 5 L L i 9 8 0 1 0 9 b b b b 87 2 10 36 31 22 17 13 9 6 4 2 1 2 97 82 K L H 8 0 86 0 42 3 L L i 9 8 0 0 0 9 b e b e 90 3 8 7 8 11 16 21 25 26 22 15 10 1 98 83 A L H 8 0 0 0 0 5 L L i 9 9 0 0 0 9 b b b b 90 3 7 31 26 17 14 13 12 11 9 7 5 1 98 84 I L H 7 0 0 0 0 2 L L i 9 8 0 0 0 9 b b b b 88 4 9 27 25 21 20 18 14 11 8 5 4 1 98 85 V L H 7 0 59 0 42 1 L L i 9 8 0 1 0 9 b e b e 86 7 12 14 14 14 17 19 22 23 21 17 13 1 98 86 A L H 5 0 0 0 0 2 L L i 9 7 0 1 0 9 b b b b 78 7 20 28 25 21 19 17 15 12 10 8 7 1 98 87 G L H 3 0 25 0 30 0 L L i 9 6 0 2 0 9 b e b i 66 7 29 18 17 16 18 20 21 19 16 13 11 1 98 88 S L H 3 0 93 0 72 3 L L i 9 6 0 2 0 9 b e b e 65 8 31 4 5 7 9 13 16 21 25 26 25 1 98 89 A L H 2 0 21 0 20 1 L L i 9 5 1 3 0 9 b e b i 57 13 36 12 13 16 20 23 23 22 19 16 14 1 98 90 G L L 1 0 16 0 20 0 L L i 9 3 0 5 0 9 b e b i 42 9 56 15 15 16 18 20 20 20 18 17 16 1 98 91 N L L 3 0 113 0 72 1 L L i 9 3 0 5 0 9 b e b e 33 10 64 8 9 11 13 16 18 21 23 24 24 1 98 92 R L L 3 0 178 0 72 1 L L i 9 2 1 6 0 9 b e b e 27 13 66 7 8 11 14 17 20 22 23 24 23 1 98 93 G L L 4 0 35 0 42 1 L L i 9 2 1 6 0 9 b e b e 26 14 67 13 14 15 17 19 21 22 21 19 17 1 98 94 F L L 3 0 23 0 12 0 L L i 9 2 1 5 0 9 b b b i 30 18 62 19 19 19 20 20 19 18 16 14 12 1 98 95 I L L 2 0 20 0 12 0 L L i 9 2 1 5 0 9 b b b i 31 21 58 20 21 21 22 20 18 15 12 10 8 1 98 96 D L L 2 0 91 0 56 1 L L i 9 2 1 5 0 9 b e b e 32 20 60 10 11 12 15 17 20 22 23 21 20 1 98 97 I L L 2 0 33 0 20 0 L L i 9 2 1 5 0 9 b e b i 31 22 59 19 19 20 21 22 21 18 15 13 11 1 98 98 M L L 3 0 22 0 12 0 L L i 9 2 2 5 0 9 b b b i 23 24 61 19 19 20 21 21 19 17 14 12 11 1 98 99 D L L 4 0 91 0 56 2 L L i 9 1 2 6 0 9 b e b e 15 22 65 10 10 11 14 16 19 22 23 23 22 1 98 100 M L L 5 0 0 0 0 1 L L i 9 0 1 7 0 9 b b b b 6 20 76 26 25 23 22 20 17 12 8 5 4 1 98 101 P L L 5 0 0 0 0 0 L L i 9 0 1 7 0 9 b b b b 10 19 72 20 20 19 20 20 19 18 16 15 14 1 98 102 N L L 5 0 87 0 56 0 L L i 9 1 1 7 0 9 b e b e 11 18 73 15 14 15 17 18 20 20 21 21 21 1 98 103 T L L 5 0 0 0 0 0 L L i 9 1 1 6 0 9 b b b b 14 18 72 22 22 21 22 21 19 16 12 10 9 1 98 104 N L L 5 0 18 0 12 0 L L i 9 1 1 6 0 9 b b b i 16 16 73 20 20 20 21 20 19 17 14 12 11 1 98 105 K L L 3 0 86 0 42 1 L L i 9 1 2 5 0 9 b e b e 20 24 60 12 12 14 17 20 22 23 22 19 17 1 98 106 Y L L 2 0 26 0 12 2 L L i 9 1 2 5 0 9 b b b i 18 30 58 17 19 21 24 23 21 17 13 10 8 1 98 107 S L L 3 0 0 0 0 0 L L i 9 1 2 5 0 9 b b b b 20 27 57 21 20 19 19 20 20 18 16 14 12 1 98 108 F L L 3 0 0 0 0 0 L L i 9 2 2 5 0 9 b b b b 21 25 59 22 22 21 22 20 18 15 12 10 9 1 98 109 D L L 5 0 68 0 42 0 L L i 9 1 1 6 0 9 b e b e 17 15 72 10 10 11 14 17 19 21 21 21 20 1 98 110 G L L 6 0 10 0 12 0 L L i 9 1 1 7 0 9 b b b i 16 12 77 19 19 19 21 21 21 19 16 14 12 0 99 111 A L L 6 0 0 0 0 1 L L i 9 1 1 7 0 9 b b b b 13 13 76 24 23 20 20 18 16 14 12 10 9 1 98 112 N L L 6 0 0 0 0 0 L L i 9 1 1 7 0 9 b b b b 12 14 76 23 23 22 22 20 18 15 12 9 7 1 98 113 P L L 3 0 0 0 0 1 L L i 9 2 1 6 0 9 b b b b 26 15 65 27 26 22 21 18 15 11 8 6 5 1 98 114 V L L 2 0 0 0 0 2 L L i 9 2 2 4 0 9 b b b b 30 27 52 28 26 22 20 17 13 9 7 5 4 1 98 115 W L L 2 0 0 0 0 1 L L i 9 2 2 4 0 9 b b b b 30 27 52 26 25 23 22 20 17 13 10 7 6 1 98 116 L L L 2 0 0 0 0 0 L L i 9 3 1 5 0 9 b b b b 36 18 60 24 23 21 21 19 17 14 12 9 8 1 98 117 D L L 3 0 48 0 30 1 L L i 9 2 1 5 0 9 b e b i 29 15 65 10 11 13 17 20 22 22 20 18 17 1 98 118 P L L 2 0 76 0 56 1 L L i 9 3 1 5 0 9 b e b e 38 12 61 13 13 13 16 18 20 21 22 21 21 1 98 119 F L L 1 0 23 0 12 1 L L i 9 3 1 4 0 9 b b b i 40 18 54 17 18 20 22 21 19 15 13 11 10 1 98 120 C L L 1 0 40 0 30 1 L L i 9 3 1 4 0 9 b e b i 40 19 56 12 13 16 19 21 22 22 20 18 16 1 98 121 R L L 3 0 178 0 72 1 L L i 9 2 1 5 0 9 b e b e 33 14 64 5 6 8 12 16 19 21 23 24 23 1 98 122 N L L 4 0 65 0 42 0 L L i 9 2 0 6 0 9 b e b e 30 9 71 11 12 13 16 18 20 21 21 21 21 1 99 123 L L L 3 0 32 0 20 1 L L i 9 3 0 6 0 9 b e b i 33 9 67 11 13 16 18 20 20 19 16 15 14 0 99 124 E L L 3 0 139 0 72 1 L L i 9 2 1 5 0 9 b e b e 31 13 63 7 8 10 13 15 19 22 24 25 24 0 99 125 L L L 3 0 19 0 12 1 L L i 9 2 1 6 0 9 b b b i 29 14 66 19 21 23 24 22 18 13 10 8 7 0 99 126 A L L 4 0 44 0 42 0 L L i 9 2 1 6 0 9 b e b e 25 13 71 11 11 13 16 18 20 21 21 21 20 0 99 127 A L L 4 0 31 0 30 0 L L i 9 2 1 6 0 9 b e b i 25 13 69 14 14 16 19 20 21 20 19 18 16 0 99 128 Q L L 4 0 83 0 42 0 L L i 9 2 1 6 0 9 b e b e 24 13 69 9 10 13 16 19 21 22 21 21 20 0 99 129 A L L 5 0 76 0 72 0 L L i 9 2 0 6 0 9 b e b e 23 10 73 9 10 12 15 18 20 21 21 22 22 0 99 130 E L L 4 0 139 0 72 1 L L i 9 2 0 6 0 9 b e b e 24 8 73 7 8 10 13 15 19 22 24 25 25 1 98 131 H L L 3 0 132 0 72 0 L L i 9 2 0 6 0 9 b e b e 30 9 65 9 10 13 16 19 20 21 21 22 21 0 99 132 E L L 3 0 139 0 72 1 L L i 9 2 0 6 0 9 b e b e 31 7 67 7 8 10 14 17 20 22 23 24 23 0 99 133 D L L 5 0 146 0 90 1 L L i 9 2 0 7 0 9 b e b e 24 7 75 5 6 8 12 15 18 21 23 26 27 0 99 134 D L L 4 0 91 0 56 1 L L i 9 2 0 6 0 9 b e b e 26 8 72 9 9 11 15 18 21 22 23 22 21 1 98 135 L L L 3 0 19 0 12 1 L L i 9 3 0 6 0 9 b b b i 34 7 66 17 19 22 23 21 18 14 11 8 7 1 98 136 P L L 1 0 76 0 56 1 L L i 9 4 0 5 0 9 b e b e 45 7 59 10 11 12 15 18 21 22 23 22 21 1 98 137 E L L 1 0 139 0 72 4 L L i 9 3 0 5 0 9 b e b e 41 8 58 2 2 4 7 11 16 22 28 32 32 1 98 138 N L L 2 0 87 0 56 2 L L i 9 3 0 5 0 9 b e b e 40 7 60 8 9 10 13 16 19 22 23 22 21 0 99 139 L L H 0 0 9 0 6 1 L L i 9 4 0 4 0 9 b b b b 51 6 51 21 21 22 22 21 18 15 12 9 8 1 98 140 S L H 0 0 72 0 56 5 L L i 9 5 0 4 0 9 b e b e 54 6 47 4 5 6 8 12 17 25 30 28 26 1 98 141 E L H 2 0 81 0 42 2 L L i 9 5 0 3 0 9 b e b e 61 6 41 5 6 8 12 17 22 27 27 22 18 1 98 142 I L H 2 0 0 0 0 3 L L i 9 6 0 3 0 9 b b b b 63 6 34 28 25 21 18 16 12 9 7 5 4 0 99 143 A L H 2 0 31 0 30 2 L L i 9 5 0 3 0 9 b e b i 58 7 38 13 14 15 19 21 23 22 20 16 13 1 99 144 D L L 0 0 117 0 72 5 L L i 9 4 0 4 0 9 b e b e 49 8 50 2 3 4 6 9 14 22 29 31 30 1 98 145 L L L 0 0 32 0 20 1 L L i 9 4 0 4 0 9 b e b i 51 9 48 12 13 16 20 23 23 21 18 15 12 1 98 146 W L L 2 0 27 0 12 1 L L i 9 3 1 5 0 9 b b b i 37 12 59 18 20 23 24 22 18 14 11 10 10 1 98 147 N L L 5 0 87 0 56 3 L L i 9 2 0 7 0 9 b e b e 22 9 74 6 6 8 11 15 19 23 26 26 26 1 98 148 S L L 7 0 39 0 30 0 L L i 9 1 0 8 0 9 b e b i 12 7 84 9 10 14 18 21 22 22 21 19 17 1 98 149 P L L 4 0 97 0 72 1 L L i 9 2 0 6 0 9 b e b e 25 8 71 9 10 12 14 17 19 21 22 23 23 1 98 150 T L L 1 0 127 0 90 2 L L i 9 3 0 5 0 9 b e b e 42 9 58 7 7 9 12 14 17 20 23 27 28 1 98 151 R L L 2 0 104 0 42 0 L L i 9 3 1 5 0 9 b e b e 37 12 60 6 7 10 14 17 20 23 23 23 22 1 98 152 T L L 2 0 42 0 30 0 L L i 9 3 1 5 0 9 b e b i 34 12 62 12 13 14 18 20 21 21 20 18 17 1 98 153 H L L 3 0 55 0 30 0 L L i 9 2 1 5 0 9 b e b i 32 13 65 10 11 14 18 20 22 22 21 19 18 1 98 154 G L L 3 0 60 0 72 2 L L i 9 2 1 5 0 9 b e b e 31 13 64 6 7 9 13 16 18 21 23 25 25 1 98 155 T L L 3 0 79 0 56 2 L L i 9 2 1 6 0 9 b e b e 28 13 66 7 8 10 13 16 20 23 24 24 23 1 98 156 F L L 3 0 23 0 12 1 L L i 9 2 1 6 0 9 b b b i 26 16 65 17 19 22 23 22 19 15 12 10 10 1 98 157 G L L 5 0 60 0 72 2 L L i 9 1 1 7 0 9 b e b e 17 12 75 7 7 9 12 15 19 22 24 26 26 1 98 158 R L L 5 0 178 0 72 1 L L i 9 1 1 7 0 9 b e b e 14 12 72 5 6 9 13 16 19 22 23 25 25 0 99 159 E L L 7 0 81 0 42 0 L L i 9 0 1 8 0 9 b e b e 6 10 83 6 8 11 15 19 22 23 23 21 20 0 99 160 P L L 7 0 97 0 72 1 L L i 9 0 0 8 0 9 b e b e 6 8 84 11 11 13 16 17 19 20 21 23 23 0 99 161 A L L 7 0 21 0 20 0 L L i 9 0 0 8 0 9 b e b i 7 8 86 9 10 14 19 21 21 20 18 17 16 0 99 162 A L L 7 0 95 0 90 1 L L i 9 0 0 8 0 9 b e b e 6 8 85 7 7 9 12 14 17 20 23 25 26 0 99 163 V L L 7 0 17 0 12 3 L L i 9 0 0 8 0 9 b b b i 5 10 87 14 17 22 25 23 18 13 10 10 10 0 99 164 K L L 8 0 114 0 56 3 L L i 9 0 0 9 0 9 b e b e 3 6 91 2 3 5 9 14 20 25 26 23 19 0 99 165 P L L 5 0 76 0 56 2 L L i 9 2 0 7 0 9 b e b e 21 3 76 6 7 8 12 16 19 22 23 22 20 0 99 166 D L L 0 0 146 0 90 2 L L i 9 4 0 5 0 9 b e b e 47 3 51 5 5 7 9 13 17 21 25 28 29 0 99 167 D L H 1 0 48 0 30 1 L L i 9 5 0 4 0 9 b e b i 56 2 42 10 11 13 17 19 21 21 19 16 14 1 98 168 D L H 4 0 48 0 30 2 L L i 9 6 0 2 0 9 b e b i 70 1 30 13 13 15 18 20 22 21 19 14 12 1 98 169 R L H 6 0 104 0 42 3 L L i 9 8 0 1 0 9 b e b e 82 3 14 5 6 9 12 17 21 25 24 19 14 1 98 170 Y L H 8 0 44 0 20 1 L L i 9 8 0 0 0 9 b e b i 88 4 8 15 16 17 20 22 21 19 14 9 6 1 98 171 L L H 8 0 0 0 0 5 L L i 9 9 0 0 0 9 b b b b 92 2 6 34 29 21 17 14 11 7 4 2 1 1 98 172 R L H 8 0 74 0 30 3 L L i 9 9 0 0 0 9 b e b i 93 1 5 10 11 13 18 22 25 24 19 12 7 1 98 173 A L H 8 0 59 0 56 3 L L i 9 9 0 0 0 9 b e b e 93 1 6 7 7 8 11 14 20 25 27 21 16 1 98 174 A L H 8 0 0 0 0 3 L L i 9 9 0 0 0 9 b b b b 90 1 8 30 26 19 17 15 12 9 6 4 2 1 98 175 I L H 8 0 0 0 0 6 L L i 9 9 0 0 0 9 b b b b 90 1 8 37 31 21 16 12 9 6 4 2 1 1 98 176 Q L H 7 0 110 0 56 5 L L i 9 8 0 1 0 9 b e b e 88 1 12 2 3 4 7 13 20 28 30 23 17 1 98 177 E L H 7 0 81 0 42 3 L L i 9 8 0 1 0 9 b e b e 86 0 15 9 9 11 15 19 23 25 22 17 13 1 98 178 Y L H 6 0 0 0 0 3 L L i 9 7 0 1 0 9 b b b b 79 1 19 29 26 22 19 16 12 8 5 3 2 1 98 179 D L H 4 0 68 0 42 3 L L i 9 7 0 2 0 9 b e b e 72 2 28 7 8 10 13 17 21 25 23 19 14 1 98 180 N L H 4 0 65 0 42 2 L L i 9 7 0 2 0 9 b e b e 71 2 27 12 12 13 16 19 22 23 22 17 14 1 98 181 I L H 7 0 0 0 0 4 L L i 9 8 0 1 0 9 b b b b 85 3 11 32 28 22 18 15 11 8 6 5 4 1 98 182 A L H 6 0 44 0 42 1 L L i 9 8 0 1 0 9 b e b e 82 5 14 11 11 12 14 17 19 22 22 19 17 1 98 183 K L H 6 0 114 0 56 4 L L i 9 7 0 1 0 9 b e b e 80 5 18 4 4 5 8 12 17 23 27 26 25 1 98 184 L L H 3 0 0 0 0 1 L L i 9 6 0 3 0 9 b b b b 68 5 33 25 24 22 21 19 16 13 10 8 7 1 98 185 G L L 1 0 0 0 0 1 L L i 9 4 0 5 0 9 b b b b 46 6 56 24 22 20 20 19 18 17 15 12 10 1 98 186 Q L H 0 0 83 0 42 3 L L i 9 4 1 4 0 9 b e b e 51 11 47 9 10 12 15 19 24 26 24 20 16 1 98 187 I L H 3 0 0 0 0 0 L L i 9 5 2 2 0 9 b b b b 60 25 28 22 22 21 21 21 18 15 12 10 8 1 98 188 I L H 3 0 0 0 0 1 L L i 9 5 2 2 0 9 b b b b 60 29 25 26 24 21 21 19 17 14 11 9 8 1 98 189 R L H 1 0 138 0 56 1 L L i 9 4 2 3 0 9 b e b e 51 23 33 9 10 12 15 18 21 23 24 22 21 1 98 190 E L L 2 0 108 0 56 3 L L i 9 3 1 5 0 9 b e b e 30 17 50 4 5 8 11 15 20 25 27 26 24 1 98 191 G L L 6 0 0 0 0 0 L L i 9 0 1 7 0 9 b b b b 8 15 78 22 22 22 22 20 18 15 12 9 8 2 97 192 P L L 6 0 57 0 42 1 L L i 9 0 1 7 0 9 b e b e 9 16 79 14 14 15 17 20 22 23 22 20 19 3 96 193 I L L 4 0 3 0 2 1 L L i 9 1 1 6 0 9 b b b b 17 19 68 22 23 23 22 19 16 13 10 9 8 2 97 194 K L L 1 0 86 0 42 1 L L i 9 3 2 4 0 9 b e b e 34 21 48 8 9 10 14 17 21 23 23 20 18 2 97 195 G L H 1 0 0 0 0 1 L L i 9 4 1 3 0 9 b b b b 50 17 38 26 24 21 20 19 17 14 11 8 7 2 97 196 S L H 3 0 0 0 0 0 L L i 9 5 1 2 0 9 b b b b 61 17 28 22 21 19 20 20 19 16 13 9 7 3 96 197 L L H 5 0 0 0 0 5 L L i 9 6 1 1 0 9 b b b b 75 21 16 35 30 21 17 14 11 8 5 3 3 3 96 198 L L H 6 0 0 0 0 5 L L i 9 7 1 0 0 9 b b b b 82 13 10 36 31 22 18 14 10 6 3 2 1 3 96 199 K L H 7 0 61 0 30 3 L L i 9 8 0 0 0 9 b e b i 85 8 8 11 12 15 19 23 25 23 18 12 8 3 96 200 V L H 7 0 0 0 0 2 L L i 9 8 0 0 0 9 b b b b 86 8 7 27 24 20 19 18 15 11 7 4 2 4 95 201 V L H 7 0 0 0 0 9 L L i 8 8 0 1 0 9 b b b b 87 5 11 44 35 19 13 9 6 3 2 1 0 7 92 202 L L H 8 0 0 0 0 5 L L i 8 9 0 0 0 9 b b b b 91 1 7 33 28 19 15 13 11 8 5 3 2 7 92 203 E L H 8 0 58 0 30 2 L L i 8 9 0 0 0 9 b e b i 91 0 8 7 8 11 15 19 23 23 20 14 9 5 94 204 D L H 8 0 48 0 30 2 L L i 9 9 0 0 0 9 b e b i 90 0 8 12 14 17 22 24 25 20 14 8 4 4 95 205 Y L H 8 0 0 0 0 2 L L i 9 9 0 0 0 9 b b b b 91 0 7 28 25 22 20 17 12 8 5 3 2 4 95 206 L L H 7 0 32 0 20 1 L L i 9 8 0 1 0 9 b e b i 87 1 11 9 10 13 17 20 20 20 15 10 6 3 96 207 R L H 6 0 49 0 20 2 L L i 9 8 0 1 0 9 b e b i 81 1 17 12 13 16 20 23 23 20 14 8 4 2 97 208 L L H 7 0 0 0 0 4 L L i 9 8 0 1 0 9 b b b b 87 0 10 31 27 21 17 14 11 8 5 3 2 2 97 209 K L H 8 0 86 0 42 3 L L i 9 9 0 0 0 9 b e b e 92 0 6 7 7 9 13 18 23 24 21 14 10 1 98 210 K L H 8 0 86 0 42 3 L L i 9 9 0 0 0 9 b e b e 91 2 5 8 8 11 15 20 24 25 22 17 13 1 98 211 L L H 8 0 0 0 0 1 L L i 9 9 0 0 0 9 b b b b 90 1 9 26 25 23 22 19 15 10 6 3 2 1 98 212 F L H 8 0 0 0 0 3 L L i 9 9 0 0 0 9 b b b b 92 2 6 29 26 21 19 16 13 9 6 3 2 1 98 213 A L H 8 0 0 0 0 4 L L i 9 9 0 0 0 9 b b b b 92 2 7 30 25 16 14 12 11 10 8 6 5 1 98 214 Q L H 7 0 59 0 30 2 L L i 9 8 0 1 0 9 b e b i 86 4 10 13 14 16 21 24 25 22 17 11 7 1 98 215 R L H 5 0 49 0 20 2 L L i 9 7 0 2 0 9 b e b i 80 3 21 16 17 20 23 24 22 19 14 10 7 1 98 216 M L H 5 0 0 0 0 2 L L i 9 7 0 2 0 9 b b b b 77 6 23 27 25 22 20 18 15 11 8 5 4 1 98 217 V L H 4 0 0 0 0 6 L L i 9 6 0 2 0 9 b b b b 70 10 26 36 30 19 14 11 8 6 5 3 3 1 98 218 Q L H 5 0 59 0 30 2 L L i 9 6 0 2 0 9 b e b i 73 9 23 9 10 12 16 20 23 23 21 16 13 1 98 219 K L H 4 0 114 0 56 4 L L i 9 6 0 2 0 9 b e b e 73 7 26 3 4 6 10 15 21 27 29 27 23 1 98 220 A L H 1 0 0 0 0 1 L L i 9 5 0 4 0 9 b b b b 53 8 41 24 23 21 20 18 15 11 8 7 7 1 98 221 S L L 4 0 54 0 42 0 L L i 9 2 0 6 0 9 b e b e 27 6 71 10 11 13 16 19 21 23 22 21 20 1 98 222 S L L 7 0 117 0 90 1 L L i 9 1 0 8 0 9 b e b e 13 6 83 8 8 10 13 15 18 20 23 24 25 1 98 223 C L L 6 0 40 0 30 1 L L i 9 1 0 8 0 9 b e b i 14 4 82 9 11 14 18 21 23 22 20 19 17 1 98 224 H L L 6 0 55 0 30 1 L L i 9 1 0 7 0 9 b e b i 19 6 80 13 14 16 19 20 21 21 19 17 16 1 98 225 S L L 4 0 0 0 0 0 L L i 9 2 0 6 0 9 b b b b 29 10 69 24 24 22 22 19 17 14 12 10 9 1 98 226 S L L 2 0 0 0 0 2 L L i 9 3 1 5 0 9 b b b b 35 11 63 26 24 20 19 18 16 13 10 7 5 1 98 227 I L H 3 0 0 0 0 2 L L i 9 6 0 2 0 9 b b b b 67 10 28 28 26 21 20 17 14 10 7 5 4 1 98 228 S L H 4 0 39 0 30 1 L L i 9 6 1 2 0 9 b e b i 69 11 21 16 16 16 19 20 21 19 15 10 6 1 98 229 E L H 6 0 58 0 30 1 L L i 9 7 1 1 0 9 b e b i 74 12 13 14 15 16 19 20 22 20 17 13 10 1 98 230 L L H 5 0 0 0 0 3 L L i 9 6 1 1 0 9 b b b b 69 17 15 32 28 22 19 16 13 9 6 4 3 0 99 231 I L H 4 0 0 0 0 3 L L i 9 6 1 1 0 9 b b b b 67 19 19 31 27 21 19 17 13 9 6 3 2 0 99 232 H L H 3 0 0 0 0 0 L L i 9 5 1 2 0 9 b b b b 62 12 30 20 19 17 17 17 17 17 15 13 11 0 99 233 T L H 2 0 42 0 30 1 L L i 9 5 1 3 0 9 b e b i 57 11 36 13 13 15 18 21 22 22 19 16 13 1 98 234 D L H 0 0 48 0 30 3 L L i 9 4 0 4 0 9 b e b i 52 10 44 8 10 13 18 22 25 25 21 15 11 1 98 235 L L L 2 0 0 0 0 1 L L i 9 3 0 5 0 9 b b b b 38 7 65 29 29 27 24 19 13 7 4 3 3 0 99 236 E L L 4 0 81 0 42 1 L L i 9 2 0 6 0 9 b e b e 27 8 71 11 12 13 16 19 22 23 22 19 17 0 99 237 E L L 4 0 139 0 72 4 L L i 9 2 0 6 0 9 b e b e 28 8 71 2 3 5 8 11 16 22 26 30 30 0 99 238 E L L 6 0 108 0 56 4 L L i 9 1 0 7 0 9 b e b e 17 8 77 2 2 5 9 14 19 25 28 28 27 1 98 239 P L L 4 0 76 0 56 2 L L i 9 2 0 6 0 9 b e b e 24 8 72 6 7 9 12 16 19 23 25 25 25 0 99 240 G L L 6 0 75 0 90 1 L L i 9 1 0 7 0 9 b e b e 15 7 80 9 10 11 14 16 19 21 22 24 25 0 99 241 D L L 5 0 117 0 72 2 L L i 9 1 1 7 0 9 b e b e 17 12 73 5 6 8 11 15 19 23 26 28 28 0 99 242 H L L 6 0 165 0 90 2 L L i 9 1 1 7 0 9 b e b e 12 11 78 6 7 9 12 15 17 20 22 26 27 0 99 243 S L L 7 0 93 0 72 0 L L i 9 0 1 8 0 9 b e b e 8 11 83 10 11 12 16 18 20 21 21 22 22 0 99 244 P L L 6 0 122 0 90 1 L L i 9 1 0 7 0 9 b e b e 13 8 82 10 10 11 14 16 18 20 21 24 25 0 99 245 G L L 6 0 75 0 90 2 L L i 9 0 1 7 0 9 b e b e 9 12 81 7 7 8 11 14 17 20 24 27 28 0 99 246 Q L L 4 0 59 0 30 1 L L i 9 1 2 6 0 9 b e b i 12 23 68 11 12 14 17 20 22 22 20 18 16 0 99 247 G L L 2 0 16 0 20 0 L L i 9 0 3 5 0 9 b e b i 9 33 61 18 18 18 20 21 21 19 17 14 12 0 99 248 S L E 0 0 54 0 42 1 L L i 9 0 4 4 0 9 b e b e 6 52 47 11 12 13 17 20 22 23 20 16 12 1 98 249 L L E 3 0 0 0 0 2 L L i 9 0 6 3 0 9 b b b b 6 66 32 31 30 26 23 18 13 8 4 3 2 1 98 250 R L E 3 0 74 0 30 2 L L i 9 0 6 3 0 9 b e b i 6 65 33 12 13 16 20 23 24 22 17 11 7 1 98 251 F L E 2 0 0 0 0 2 L L i 9 0 5 3 0 9 b b b b 8 63 35 29 27 24 21 17 13 8 5 4 4 1 98 252 R L L 0 0 104 0 42 2 L L i 9 0 4 5 0 9 b e b e 7 44 51 7 8 10 15 19 23 25 23 19 16 1 98 253 H L L 3 0 22 0 12 1 L L i 9 1 3 5 0 9 b b b i 11 32 62 17 18 20 22 22 20 17 14 12 10 1 98 254 K L L 5 0 147 0 72 3 L L i 9 0 1 7 0 9 b e b e 8 19 76 3 4 5 8 12 18 23 28 30 30 0 99 255 P L L 6 0 40 0 30 1 L L i 9 0 1 8 0 9 b e b i 6 14 82 11 13 15 19 21 22 22 20 18 16 1 98 256 P L L 6 0 40 0 30 1 L L i 9 0 1 7 0 9 b e b i 10 17 77 15 15 15 18 19 21 21 19 16 13 1 99 257 M L L 0 0 0 0 0 0 L L i 9 0 4 4 0 9 b b b b 10 44 50 24 24 24 24 21 17 12 10 8 7 1 99 258 E L E 2 0 81 0 42 2 L L i 9 0 5 3 0 9 b e b e 9 61 33 8 9 11 15 18 22 25 25 21 17 1 98 259 L L E 2 0 0 0 0 2 L L i 9 0 5 3 0 9 b b b b 7 61 37 31 29 26 22 18 13 8 4 3 3 0 99 260 K L E 1 0 114 0 56 4 L L i 9 0 5 3 0 9 b e b e 6 59 42 3 4 5 9 14 20 25 28 26 23 1 98 261 G L L 5 0 10 0 12 0 L L i 9 0 2 7 0 9 b b b i 6 21 76 21 21 21 22 21 19 17 14 14 13 1 98 262 Q L L 7 0 142 0 72 2 L L i 9 0 0 8 0 9 b e b e 10 10 82 6 6 8 11 15 18 22 24 25 25 1 98 263 D L L 7 0 117 0 72 1 L L i 9 0 0 8 0 9 b e b e 8 9 84 8 8 10 12 15 19 22 23 24 23 1 98 264 G L L 3 0 0 0 0 2 L L i 9 0 2 6 0 9 b b b b 8 30 65 29 27 22 20 18 15 12 9 6 5 1 98 265 I L E 3 0 0 0 0 4 L L i 9 0 6 2 0 9 b b b b 5 67 29 31 27 20 17 14 12 9 7 4 3 1 98 266 H L E 5 0 0 0 0 2 L L i 9 0 7 1 0 9 b b b b 4 77 18 28 27 23 21 18 15 11 6 3 2 1 98 267 M L E 5 0 0 0 0 9 L L i 9 0 7 1 0 9 b b b b 7 73 19 42 33 18 12 9 6 4 2 1 1 1 98 268 V L E 4 0 0 0 0 7 L L i 9 0 7 2 0 9 b b b b 6 71 24 38 31 18 13 10 7 5 3 2 1 1 98 269 H L E 1 0 0 0 0 2 L L i 9 0 5 3 0 9 b b b b 8 57 42 30 28 24 21 18 14 9 6 3 2 1 98 270 G L L 4 0 0 0 0 3 L L i 9 1 2 6 0 9 b b b b 11 23 70 31 27 21 18 15 12 9 7 6 5 2 97 271 S L L 5 0 0 0 0 2 L L i 9 2 1 6 0 9 b b b b 22 12 75 28 26 23 21 18 14 10 7 5 4 2 97 272 T L L 1 0 42 0 30 2 L L i 9 3 0 5 0 9 b e b i 44 9 60 15 16 16 20 22 24 22 18 13 10 2 97 273 G L H 2 0 0 0 0 2 L L i 9 6 0 3 0 9 b b b b 65 7 36 28 26 21 20 18 16 12 9 6 5 2 97 274 T L H 4 0 0 0 0 2 L L i 9 6 1 2 0 9 b b b b 72 11 27 26 23 19 19 18 17 14 12 9 7 2 97 275 L L H 4 0 0 0 0 1 L L i 9 6 1 2 0 9 b b b b 69 14 21 25 23 20 20 20 19 16 14 11 10 1 98 276 L L H 2 0 0 0 0 4 L L i 9 5 1 3 0 9 b b b b 57 14 33 32 28 21 18 15 12 9 6 4 3 1 98 277 A L H 1 0 0 0 0 1 L L i 9 5 1 3 0 9 b b b b 55 11 41 24 22 20 19 19 17 15 13 11 9 1 98 278 T L L 2 0 42 0 30 2 L L i 9 3 0 5 0 9 b e b i 37 10 63 16 15 16 19 21 23 22 19 15 13 1 98 279 D L L 5 0 48 0 30 0 L L i 9 2 0 7 0 9 b e b i 25 5 77 14 15 17 18 19 20 19 18 15 13 1 98 280 L L L 0 0 49 0 30 1 L L i 9 4 0 4 0 9 b e b i 52 6 54 12 13 15 18 20 21 21 18 15 13 1 98 281 N L L 2 0 141 0 90 3 L L i 9 3 0 5 0 9 b e b e 38 7 65 4 5 6 8 11 15 19 25 30 32 1 98 282 S L L 4 0 54 0 42 0 L L i 9 2 0 6 0 9 b e b e 28 8 70 10 10 11 14 16 19 21 21 20 19 1 98 283 L L L 8 0 9 0 6 3 L L i 9 0 0 8 0 9 b b b b 8 4 88 24 26 27 27 21 15 9 6 4 3 1 98 284 P L L 6 0 57 0 42 4 L L i 9 1 0 8 0 9 b e b e 16 3 83 4 5 7 12 17 24 28 26 20 14 1 98 285 E L H 2 0 139 0 72 4 L L i 9 6 0 3 0 9 b e b e 61 1 39 1 2 3 5 9 16 24 31 32 32 1 98 286 D L H 5 0 91 0 56 2 L L i 9 7 0 2 0 9 b e b e 75 1 23 5 6 9 12 15 18 21 23 22 21 1 98 287 D L H 5 0 48 0 30 1 L L i 9 7 0 2 0 9 b e b i 78 1 21 14 14 15 18 20 21 20 17 12 9 1 98 288 Q L H 7 0 39 0 20 1 L L i 9 8 0 1 0 9 b e b i 87 1 11 16 16 17 19 20 20 18 15 10 8 1 98 289 K L H 8 0 114 0 56 5 L L i 9 9 0 0 0 9 b e b e 88 2 7 1 2 4 7 11 18 26 29 23 17 0 99 290 G L H 8 0 25 0 30 1 L L i 9 8 0 0 0 9 b e b i 89 4 6 15 15 17 20 22 23 21 16 11 7 1 98 291 L L H 8 0 0 0 0 6 L L i 9 9 0 0 0 9 b b b b 92 1 5 37 31 21 16 12 9 6 3 2 1 0 99 292 D L H 8 0 48 0 30 2 L L i 9 9 0 0 0 9 b e b i 92 1 5 15 15 15 19 22 24 23 19 13 9 0 99 293 R L H 8 0 104 0 42 3 L L i 9 9 0 0 0 9 b e b e 90 2 7 5 7 10 16 22 26 27 21 12 6 0 99 294 S L H 7 0 0 0 0 4 L L i 9 8 0 0 0 9 b b b b 89 2 10 33 28 20 17 14 11 8 5 3 2 0 99 295 L L H 8 0 0 0 0 5 L L i 9 9 0 0 0 9 b b b b 93 1 5 35 30 22 17 13 9 6 4 2 1 1 98 296 E L H 7 0 108 0 56 4 L L i 9 8 0 1 0 9 b e b e 88 3 11 5 6 7 10 15 20 27 29 25 20 1 98 297 T L H 5 0 59 0 42 2 L L i 9 7 0 2 0 9 b e b e 76 4 22 5 6 9 13 17 21 24 24 20 16 1 98 298 L L H 0 0 9 0 6 2 L L i 9 5 0 4 0 9 b b b b 52 6 46 22 23 24 24 22 17 12 7 5 4 1 98 299 T L L 1 0 59 0 42 0 L L i 9 3 0 5 0 9 b e b e 42 8 58 11 11 12 14 17 20 23 23 22 20 1 98 300 A L L 2 0 76 0 72 1 L L i 9 3 0 5 0 9 b e b e 38 7 61 8 9 10 13 16 18 20 22 24 24 1 98 301 S L L 2 0 93 0 72 1 L L i 9 3 0 5 0 9 b e b e 33 9 62 7 8 10 13 16 18 21 22 24 24 1 98 302 E L L 4 0 174 0 90 3 L L i 9 2 0 6 0 9 b e b e 25 8 71 5 5 6 9 11 16 21 26 31 32 1 98 303 A L L 7 0 12 0 12 0 L L i 9 1 0 7 0 9 b b b i 11 10 82 20 20 20 21 19 18 15 14 14 14 1 98 304 T L L 5 0 42 0 30 1 L L i 9 1 1 7 0 9 b e b i 11 16 75 13 13 15 17 19 21 21 19 16 14 1 98 305 A L L 3 0 31 0 30 1 L L i 9 2 2 5 0 9 b e b i 24 22 58 14 14 16 19 21 22 21 19 17 15 1 98 306 F L L 0 0 59 0 30 0 L L i 9 3 1 4 0 9 b e b i 41 19 50 13 13 14 17 20 21 20 19 18 18 1 98 307 E L L 0 0 81 0 42 0 L L i 9 3 1 4 0 9 b e b e 43 17 49 12 13 14 17 19 20 21 21 21 20 1 98 308 R L L 2 0 74 0 30 0 L L i 9 3 1 5 0 9 b e b i 37 18 57 10 11 13 17 20 22 22 21 20 19 1 98 309 N L L 2 0 113 0 72 1 L L i 9 2 1 5 0 9 b e b e 31 18 59 9 10 11 14 16 19 22 23 24 24 1 98 310 A L L 3 0 12 0 12 0 L L i 9 2 1 5 0 9 b b b i 26 19 64 20 21 22 23 21 18 14 12 10 10 1 98 311 R L L 3 0 104 0 42 1 L L i 9 2 2 5 0 9 b e b e 25 24 60 7 8 11 15 19 23 25 25 22 19 1 98 312 T L L 2 0 0 0 0 0 L L i 9 2 1 5 0 9 b b b b 31 21 59 21 21 21 21 20 19 16 14 11 10 1 98 313 E L L 2 0 139 0 72 3 L L i 9 2 1 5 0 9 b e b e 32 15 60 5 6 7 10 14 17 21 24 27 27 1 98 314 S L L 5 0 93 0 72 0 L L i 9 1 1 6 0 9 b e b e 20 14 73 15 15 15 17 18 20 20 20 21 20 1 98 315 A L L 5 0 12 0 12 0 L L i 9 1 1 7 0 9 b b b i 16 14 74 20 20 19 21 20 19 17 15 14 13 1 98 316 K L L 6 0 147 0 72 4 L L i 9 1 0 7 0 9 b e b e 12 10 80 3 4 5 8 12 16 23 28 32 32 1 98 317 S L L 6 0 93 0 72 1 L L i 9 1 1 7 0 9 b e b e 12 12 79 10 11 12 15 17 18 19 19 22 22 1 98 318 T L L 6 0 42 0 30 1 L L i 9 0 1 7 0 9 b e b i 9 12 81 12 13 15 18 21 22 20 18 16 15 1 98 319 P L L 5 0 27 0 20 0 L L i 9 1 1 7 0 9 b e b i 20 11 74 18 18 18 20 21 21 20 18 17 15 1 98 320 L L L 2 0 0 0 0 0 L L i 9 3 1 5 0 9 b b b b 38 12 59 23 22 22 22 21 19 15 12 10 9 1 98 321 H L L 1 0 22 0 12 1 L L i 9 3 1 5 0 9 b b b i 40 14 57 17 18 21 24 23 21 18 14 11 10 1 98 322 K L L 0 0 114 0 56 4 L L i 9 4 1 4 0 9 b e b e 47 14 52 5 6 7 9 13 18 24 27 27 26 1 98 323 L L L 0 0 19 0 12 1 L L i 9 4 1 4 0 9 b b b i 49 16 50 17 18 20 21 21 20 17 14 13 12 1 98 324 R L L 0 0 104 0 42 1 L L i 9 4 1 4 0 9 b e b e 47 16 52 9 9 12 16 19 21 22 21 19 17 1 98 325 D L L 2 0 91 0 56 3 L L i 9 2 2 5 0 9 b e b e 30 23 56 5 6 8 11 14 18 23 25 25 23 1 98 326 V L L 0 0 0 0 0 0 L L i 9 2 3 4 0 9 b b b b 23 38 47 22 21 21 21 21 19 16 13 10 8 1 98 327 I L E 2 0 20 0 12 0 L L i 9 1 5 3 0 9 b b b i 20 54 33 20 20 20 21 20 19 17 15 12 10 1 98 328 M L E 1 0 37 0 20 1 L L i 9 1 4 3 0 9 b e b i 20 51 38 17 17 18 21 22 22 20 17 14 11 1 98 329 E L L 1 0 139 0 72 1 L L i 9 2 3 4 0 9 b e b e 23 34 51 6 7 10 13 16 18 20 22 23 23 1 98 330 S L L 5 0 15 0 12 0 L L i 9 0 1 7 0 9 b b b i 10 19 76 20 20 21 22 22 20 17 13 9 6 1 98 331 P L L 5 0 0 0 0 0 L L i 9 1 1 6 0 9 b b b b 15 16 72 22 21 20 20 20 19 18 16 14 12 1 98 332 L L L 2 0 0 0 0 0 L L i 9 2 2 4 0 9 b b b b 27 28 50 24 23 22 22 20 17 14 11 10 9 1 98 333 E L L 0 0 81 0 42 1 L L i 9 2 3 3 0 9 b e b e 27 36 40 11 12 13 16 19 21 22 20 17 15 1 98 334 I L L 0 0 0 0 0 2 L L i 9 2 3 3 0 9 b b b b 31 33 42 28 26 22 20 19 18 15 13 11 10 1 98 335 T L L 2 0 0 0 0 0 L L i 9 2 2 5 0 9 b b b b 22 30 54 20 19 19 20 20 20 19 17 16 15 1 98 336 E L L 2 0 139 0 72 3 L L i 9 1 2 5 0 9 b e b e 17 30 58 4 5 6 9 12 16 20 23 26 26 1 98 337 L L L 9 0 147 0 90 1 L L i 9 0 0 9 0 9 b e b e 3 3 93 11 11 12 13 15 15 16 15 19 20 2 98 profbval-1.0.22/examples/cad23.profbval0000644015075101507510000001440212012432757014617 00000000000000number residue raw Bnorm NS S 1 D 99 2.87 F F 2 Y 54 2.14 F F 3 K 69 1.82 F F 4 D 65 1.19 F F 5 H 28 1.13 F F 6 D 19 0.92 F - 7 G -42 0.91 - - 8 D 30 0.85 F F 9 Y 33 0.77 F F 10 K 36 0.78 F F 11 D 49 0.86 F F 12 H 52 1.01 F F 13 D 38 0.90 F F 14 I 31 0.87 F F 15 D 46 0.80 F F 16 Y 4 0.61 F - 17 K -3 0.45 F - 18 D 22 0.23 F F 19 D 15 0.08 F - 20 D -9 -0.13 - - 21 D 1 -0.14 F - 22 K -29 -0.08 - - 23 L -15 -0.11 - - 24 A -18 -0.15 - - 25 A 1 -0.15 F - 26 A 13 -0.22 F - 27 N 13 -0.24 F - 28 S 5 -0.31 F - 29 N -11 -0.31 - - 30 V -21 -0.34 - - 31 L -33 -0.32 - - 32 D -39 -0.30 - - 33 V -18 -0.24 - - 34 Q -8 -0.11 - - 35 P 19 0.07 F - 36 A 20 0.31 F - 37 I 24 0.54 F F 38 S 29 0.74 F F 39 V 35 0.91 F F 40 Q 41 0.99 F F 41 L 31 1.02 F F 42 P 43 1.01 F F 43 D 47 0.92 F F 44 D 43 0.71 F F 45 M 29 0.45 F F 46 S 20 0.18 F - 47 A 1 -0.16 F - 48 L -30 -0.52 - - 49 Q -39 -0.88 - - 50 M -51 -1.20 - - 51 A -61 -1.49 - - 52 I -65 -1.71 - - 53 I -69 -1.83 - - 54 V -69 -1.93 - - 55 L -68 -1.98 - - 56 A -69 -2.00 - - 57 I -67 -2.04 - - 58 L -69 -2.06 - - 59 L -65 -2.08 - - 60 F -70 -2.10 - - 61 L -75 -2.12 - - 62 A -77 -2.15 - - 63 A -73 -2.16 - - 64 M -75 -2.20 - - 65 L -77 -2.20 - - 66 F -75 -2.17 - - 67 V -73 -2.10 - - 68 L -75 -1.97 - - 69 M -71 -1.83 - - 70 N -65 -1.62 - - 71 W -55 -1.38 - - 72 Y -33 -1.14 - - 73 Y -33 -0.92 - - 74 R -13 -0.67 - - 75 T -1 -0.45 F - 76 I 2 -0.31 F - 77 H -7 -0.27 F - 78 K 5 -0.19 F - 79 R 4 -0.23 F - 80 K -12 -0.24 - - 81 L -20 -0.25 - - 82 K -11 -0.24 - - 83 A -24 -0.25 - - 84 I -4 -0.23 F - 85 V -2 -0.13 F - 86 A -3 -0.05 F - 87 G 3 0.03 F - 88 S 8 0.19 F - 89 A 19 0.22 F - 90 G 7 0.23 F - 91 N 13 0.26 F - 92 R 25 0.26 F F 93 G 6 0.20 F - 94 F -1 0.10 F - 95 I 7 0.08 F - 96 D 3 -0.03 F - 97 I -9 -0.10 - - 98 M -12 -0.12 - - 99 D 0 -0.10 F - 100 M -20 -0.16 - - 101 P 3 -0.12 F - 102 N -1 -0.10 F - 103 T 6 -0.06 F - 104 N -13 -0.01 - - 105 K 15 0.16 F - 106 Y -1 0.18 F - 107 S 1 0.14 F - 108 F 14 0.01 F - 109 D 31 -0.07 F F 110 G 11 -0.25 F - 111 A -15 -0.39 - - 112 N -34 -0.50 - - 113 P -37 -0.56 - - 114 V -40 -0.66 - - 115 W -44 -0.66 - - 116 L -33 -0.54 - - 117 D -5 -0.33 F - 118 P 2 -0.11 F - 119 F 9 0.12 F - 120 C 23 0.37 F F 121 R 29 0.57 F F 122 N 33 0.67 F F 123 L 31 0.77 F F 124 E 31 0.84 F F 125 L 29 0.91 F F 126 A 27 1.01 F F 127 A 33 1.04 F F 128 Q 31 1.10 F F 129 A 45 1.18 F F 130 E 57 1.21 F F 131 H 45 1.22 F F 132 E 49 1.26 F F 133 D 55 1.34 F F 134 D 38 1.33 F F 135 L 31 1.21 F F 136 P 45 1.15 F F 137 E 54 1.13 F F 138 N 43 1.00 F F 139 L 19 0.97 F - 140 S 29 0.98 F F 141 E 40 0.89 F F 142 I 15 0.78 F - 143 A 29 0.78 F F 144 D 35 0.85 F F 145 L 17 0.85 F - 146 W 21 0.86 F - 147 N 41 0.94 F F 148 S 43 0.92 F F 149 P 29 0.92 F F 150 T 43 0.98 F F 151 R 39 1.02 F F 152 T 24 0.98 F F 153 H 35 0.98 F F 154 G 33 1.01 F F 155 T 35 0.99 F F 156 F 29 0.98 F F 157 G 41 1.02 F F 158 R 39 1.02 F F 159 E 37 0.97 F F 160 P 37 0.99 F F 161 A 36 1.06 F F 162 A 33 1.12 F F 163 V 18 1.11 F - 164 K 43 1.01 F F 165 P 51 0.86 F F 166 D 59 0.74 F F 167 D 35 0.60 F F 168 D 6 0.54 F - 169 R -8 0.40 - - 170 Y -1 0.14 F - 171 L -11 -0.08 - - 172 R 1 -0.18 F - 173 A -3 -0.15 F - 174 A -27 -0.21 - - 175 I -9 -0.28 - - 176 Q 4 -0.33 F - 177 E 14 -0.40 F - 178 Y -26 -0.32 - - 179 D -22 -0.21 - - 180 N -27 -0.19 - - 181 I -19 -0.19 - - 182 A 19 -0.18 F - 183 K 7 -0.08 F - 184 L -3 -0.02 F - 185 G 5 0.03 F - 186 Q 18 0.17 F - 187 I 3 0.08 F - 188 I -3 0.12 F - 189 R -10 0.19 - - 190 E 24 0.14 F F 191 G -10 0.03 - - 192 P 19 -0.04 F - 193 I 20 -0.14 F - 194 K -11 -0.21 - - 195 G -16 -0.41 - - 196 S -18 -0.46 - - 197 L -33 -0.68 - - 198 L -33 -0.82 - - 199 K -37 -0.81 - - 200 V -26 -0.76 - - 201 V -48 -0.71 - - 202 L -23 -0.59 - - 203 E -10 -0.54 - - 204 D 1 -0.55 F - 205 Y -2 -0.49 F - 206 L 2 -0.41 F - 207 R -16 -0.45 - - 208 L -40 -0.54 - - 209 K -7 -0.69 F - 210 K -24 -0.79 - - 211 L -37 -0.91 - - 212 F -37 -0.90 - - 213 A -44 -0.83 - - 214 Q -35 -0.86 - - 215 R -33 -0.82 - - 216 M -12 -0.73 - - 217 V -19 -0.54 - - 218 Q -16 -0.28 - - 219 K -13 -0.08 - - 220 A -9 0.02 - - 221 S 21 0.05 F - 222 S 37 0.06 F F 223 C 27 -0.02 F F 224 H -3 -0.11 F - 225 S -4 -0.26 F - 226 S -15 -0.47 - - 227 I -40 -0.72 - - 228 S -41 -0.86 - - 229 E -56 -0.84 - - 230 L -43 -0.89 - - 231 I -39 -0.74 - - 232 H -16 -0.45 - - 233 T 2 -0.10 F - 234 D -18 0.29 - - 235 L 30 0.66 F F 236 E 50 1.02 F F 237 E 65 1.20 F F 238 E 65 1.33 F F 239 P 71 1.47 F F 240 G 71 1.42 F F 241 D 41 1.30 F F 242 H 41 1.10 F F 243 S 27 0.88 F F 244 P 13 0.66 F - 245 G 15 0.34 F - 246 Q 3 0.08 F - 247 G -5 -0.13 F - 248 S 5 -0.25 F - 249 L -29 -0.34 - - 250 R -38 -0.30 - - 251 F -23 -0.22 - - 252 R -12 -0.18 - - 253 H -13 -0.14 - - 254 K 26 0.04 F F 255 P 27 0.16 F F 256 P 9 0.27 F - 257 M 18 0.34 F - 258 E 24 0.47 F F 259 L 1 0.42 F - 260 K 9 0.25 F - 261 G 12 0.05 F - 262 Q 25 -0.18 F F 263 D 13 -0.45 F - 264 G -27 -0.67 - - 265 I -52 -0.93 - - 266 H -53 -1.07 - - 267 M -59 -1.25 - - 268 V -68 -1.42 - - 269 H -71 -1.51 - - 270 G -30 -1.48 - - 271 S -31 -1.41 - - 272 T -40 -1.30 - - 273 G -55 -1.15 - - 274 T -43 -0.90 - - 275 L -30 -0.88 - - 276 L -25 -0.78 - - 277 A -22 -0.52 - - 278 T 4 -0.26 F - 279 D -22 -0.06 - - 280 L 1 0.22 F - 281 N 38 0.51 F F 282 S 27 0.66 F F 283 L 17 0.66 F - 284 P 56 0.80 F F 285 E 64 0.81 F F 286 D 25 0.62 F F 287 D 4 0.40 F - 288 Q 21 0.28 F - 289 K 4 -0.01 F - 290 G -19 -0.35 - - 291 L -43 -0.54 - - 292 D -19 -0.66 - - 293 R -32 -0.83 - - 294 S -41 -0.90 - - 295 L -35 -0.87 - - 296 E -32 -0.70 - - 297 T -32 -0.62 - - 298 L -17 -0.43 - - 299 T -10 -0.25 - - 300 A 8 -0.15 F - 301 S 7 -0.08 F - 302 E 27 -0.01 F F 303 A 15 -0.02 F - 304 T -5 0.04 F - 305 A -11 0.07 - - 306 F -9 0.04 - - 307 E -22 -0.07 - - 308 R 8 -0.05 F - 309 N 19 0.04 F - 310 A -2 0.17 F - 311 R -8 0.36 - - 312 T 21 0.56 F - 313 E 24 0.61 F F 314 S 29 0.60 F F 315 A 49 0.64 F F 316 K 41 0.60 F F 317 S 23 0.59 F F 318 T 15 0.58 F - 319 P 9 0.51 F - 320 L -20 0.36 - - 321 H 19 0.33 F - 322 K 20 0.26 F - 323 L 9 0.16 F - 324 R 3 0.01 F - 325 D 32 0.11 F F 326 V 0 -0.05 F - 327 I -17 -0.10 - - 328 M -37 -0.11 - - 329 E 11 -0.21 F - 330 S -28 -0.24 - - 331 P 2 -0.05 F - 332 L 8 0.25 F - 333 E -28 0.58 - - 334 I 22 0.83 F F 335 T 58 1.11 F F 336 E 75 1.92 F F 337 L 67 1.93 F F profbval-1.0.22/examples/Makefile.am0000644015075101507510000000020611777574727014244 00000000000000pkgdataexamplesdir = $(docdir)/examples dist_pkgdataexamples_DATA = $(srcdir)/cad23* dist-hook: rm -rf `find $(distdir) -name .svn` profbval-1.0.22/examples/Makefile.in0000644015075101507510000002701312012433127014225 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = examples DIST_COMMON = $(dist_pkgdataexamples_DATA) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = SOURCES = DIST_SOURCES = am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(pkgdataexamplesdir)" DATA = $(dist_pkgdataexamples_DATA) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ pkgdataexamplesdir = $(docdir)/examples dist_pkgdataexamples_DATA = $(srcdir)/cad23* all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu examples/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu examples/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): install-dist_pkgdataexamplesDATA: $(dist_pkgdataexamples_DATA) @$(NORMAL_INSTALL) @list='$(dist_pkgdataexamples_DATA)'; test -n "$(pkgdataexamplesdir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(pkgdataexamplesdir)'"; \ $(MKDIR_P) "$(DESTDIR)$(pkgdataexamplesdir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; \ done | $(am__base_list) | \ while read files; do \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(pkgdataexamplesdir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(pkgdataexamplesdir)" || exit $$?; \ done uninstall-dist_pkgdataexamplesDATA: @$(NORMAL_UNINSTALL) @list='$(dist_pkgdataexamples_DATA)'; test -n "$(pkgdataexamplesdir)" || list=; \ files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \ dir='$(DESTDIR)$(pkgdataexamplesdir)'; $(am__uninstall_files_from_dir) tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile $(DATA) installdirs: for dir in "$(DESTDIR)$(pkgdataexamplesdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dist_pkgdataexamplesDATA install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-dist_pkgdataexamplesDATA .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic dist-hook \ distclean distclean-generic distdir dvi dvi-am html html-am \ info info-am install install-am install-data install-data-am \ install-dist_pkgdataexamplesDATA install-dvi install-dvi-am \ install-exec install-exec-am install-html install-html-am \ install-info install-info-am install-man install-pdf \ install-pdf-am install-ps install-ps-am install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am uninstall uninstall-am \ uninstall-dist_pkgdataexamplesDATA dist-hook: rm -rf `find $(distdir) -name .svn` # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: profbval-1.0.22/nn_files/0000755015075101507510000000000012012433132012210 500000000000000profbval-1.0.22/nn_files/jct.in0000644015075101507510000022520411777007103013261 00000000000000* NNout_jct file from FORTRAN NN.f (junctions) * * ------------------------------- * Output from neural network (NN) * ------------------------------- * * author: Burkhard Rost, Columbia Univ NYC / LION Heidelberg * fax: +1-212-305-7932 * email: rost@columbia.edu * www: http://cubic.bioc.columbia.edu/ * * All rights reserved. * * date: * * * MODEPRED sec * MODENET 1st,unbal * MODEIN win=5,loc=aa * MODEJOB mode_of_job * TRN-, TRG-, ERRTYPE ONLINE, SIG, DELTASQ * NUMIN, -HID, -OUT 209, 35, 2 * NUMSAM 237433 * STPSWPMAX, -MAX, -INF 200, 75000, 75000 * ERRBINSTOP, -STOP 0, 0.0000 * EPSILON, ALPHA, TEMP 0.0300, 0.3000, 1.0000 * * -------------------- * overall: (A,T25,I8) NUMIN: 209 NUMHID: 35 NUMOUT: 2 MODEPRED: sec MODENET: 1st,unbal MODEJOB: mode_of_job MODEIN: win=5,loc=aa MODEOUT: KN * -------------------- * jct 1st layer: row=numhid (10F10.4), col=(numin+1) -0.1062 -0.1730 -0.1215 0.0183 0.0272 -0.0594 0.2978 -0.2372 0.0307 -0.2976 0.4821 -0.0199 -0.2829 -0.2962 -0.0849 0.0939 0.0224 -0.0330 -0.3774 0.3462 -0.8962 -0.9269 -0.3444 0.4362 -0.1330 -0.0019 0.0523 0.3678 1.2629 0.2208 1.5063 -0.4125 -0.4498 0.6515 -0.5584 -0.2273 -0.1961 -0.3973 -0.1687 -0.1869 0.0637 -0.2440 -0.1568 0.1122 -0.2296 -0.3118 0.1106 0.3208 0.6274 -0.1037 -0.6535 -0.3605 0.7365 0.4164 -0.1251 -0.3085 0.0601 -0.0386 0.4988 -0.3820 -0.1700 0.0308 -0.3212 -0.1797 0.0474 -0.3144 0.1810 -0.0189 0.3431 0.5379 -0.0093 -1.2845 0.0872 0.3399 -0.2385 0.3032 -0.0392 -0.2171 -0.0423 -0.0042 0.0078 -0.2551 0.4200 0.1910 3.0480 0.9606 -4.1121 -4.5419 -0.1061 2.6131 1.5210 0.1989 -7.2242 -0.5947 0.5968 2.9109 1.6561 0.0008 -1.4649 2.4247 2.2209 0.4016 -0.9223 0.5465 0.0854 -0.4194 0.0029 0.6384 0.1849 0.3191 0.1330 0.3332 0.0994 -1.0332 -0.1681 0.1562 0.4133 0.1634 -0.5543 -0.0713 -0.0350 -0.3945 0.6278 -0.1619 0.3053 -0.3061 0.2140 0.0874 -0.0641 -0.2743 0.1970 0.2195 0.4590 0.2919 -0.9522 -0.2076 0.2728 0.8719 -0.0829 0.2660 -0.4084 -0.2635 -0.2061 -0.0134 0.0107 0.6522 -0.7997 0.0568 -0.0070 0.4638 0.6971 -0.2659 0.1357 -0.0279 -0.0328 -0.0844 -0.0918 -0.0991 0.2795 0.2185 0.0693 0.2203 -0.2254 -0.4238 -0.2287 -0.0296 0.3413 -0.6421 0.1428 -0.3615 -0.0767 0.3191 -0.0347 0.1506 -0.1243 0.1669 -0.3279 0.1270 0.3822 -0.0428 -0.2669 0.3586 -0.4783 -0.2360 0.3394 0.0844 0.3824 0.3723 -0.4937 0.4058 0.6103 0.1255 0.3098 -0.0548 0.0742 0.4630 0.5845 -0.6771 0.2263 -0.0568 0.0556 0.0005 -1.6750 -0.4405 -1.7633 0.8012 0.3651 -0.6906 0.2929 -1.9233 0.4630 0.5845 -0.6771 0.2263 -0.0568 0.0556 0.0005 -1.6750 -0.4405 -1.7633 0.8012 0.3651 -0.6906 0.2929 -1.9233 0.6141 -0.0562 0.1011 0.2783 0.4245 -0.1258 0.0386 0.5755 0.3172 -0.3741 -0.3353 -0.4120 -0.3047 -0.3952 1.0850 -0.6974 -0.1332 -0.1285 -0.5017 0.6415 -0.0101 0.2206 -0.1931 -0.2017 0.7667 -0.2470 -0.4038 -0.0386 0.2228 -0.0149 0.4685 -0.5842 -0.2860 0.0285 -0.9705 -0.1467 -0.4759 -0.1016 0.0831 0.0596 -0.1753 0.6036 0.1657 0.2666 -0.0016 -0.2644 -0.1147 0.0559 -0.1181 -0.0053 -0.1371 0.3277 -0.1926 0.1524 -0.1658 0.1426 -0.4977 -0.1767 0.0759 -0.1717 -0.1098 -0.2248 0.1836 0.1280 -0.2844 -0.2275 0.1733 0.0961 0.0325 -0.1178 -0.4783 0.4925 0.0056 -0.5348 0.3136 -0.2990 -0.1248 -0.3601 -0.1912 -0.0188 0.5238 0.0238 0.1910 -0.0856 0.5671 -0.0190 -0.7265 -0.3701 -0.0756 0.0093 -0.3311 -0.4510 0.1938 0.1120 -0.1557 0.5968 -0.4158 -0.2529 0.1818 -0.2751 -0.3094 0.2859 -0.3315 0.2602 -0.1112 0.5355 -0.0513 -0.5549 -0.2822 -0.0345 0.1897 0.0870 -0.0855 0.1161 -0.0645 -0.6842 0.4187 -0.5549 -0.6622 0.0315 -0.3662 -0.1329 0.5562 -0.1950 0.4589 0.2047 0.2562 0.2450 -0.6697 -0.2277 0.4256 -0.0037 0.3691 -0.0459 -0.2560 0.0907 -0.2242 -0.0387 -0.3578 -1.0782 0.0817 -0.2818 -0.0104 0.2011 -0.1194 0.2531 0.1454 -0.1927 0.2203 -0.1429 0.4016 0.0778 -0.1900 -0.2624 0.1809 -0.5825 0.0528 -0.1768 -0.0207 -0.2056 -0.4061 0.1368 -0.4218 0.0285 0.1861 -0.1741 0.2393 -0.4406 -0.2709 0.1527 -0.1285 0.7425 0.0657 -0.5242 -1.8544 0.7563 0.1650 -2.4082 0.2463 1.3354 0.3129 0.4337 -0.8266 0.8332 -0.2139 0.0022 -0.4151 0.5664 -2.5998 0.3166 0.1539 -0.3301 0.2011 -0.4298 -1.5288 0.3129 0.4337 -0.8266 0.8332 -0.2139 0.0022 -0.4151 0.5664 -2.5998 0.3166 0.1539 -0.3301 0.2011 -0.4298 -1.5288 -0.0906 0.0591 0.2513 -0.0136 0.0393 -0.8243 0.6396 0.3002 -0.1939 -0.9799 0.6280 -0.1015 0.0568 0.3812 -0.6903 -0.2418 0.1367 -0.5038 -0.2087 0.2883 -0.3652 0.2543 -0.0764 -0.0553 0.3060 0.3920 -0.5855 0.4780 0.4345 0.6390 -0.5924 -0.0368 0.0289 -0.2506 0.1112 -0.3323 -0.1995 -0.1245 -0.4035 -0.6070 -0.4835 -0.0257 0.5385 -0.1470 0.2546 0.0563 0.1675 -0.2827 -0.3769 0.2440 -0.4199 -1.8036 -0.2564 -1.4017 0.2491 0.2687 1.4455 -0.2705 -0.0713 0.6373 0.4159 -0.1417 0.1624 -0.0229 0.2397 -0.0334 0.0754 0.2099 -0.1189 -0.0140 0.1836 -0.9362 2.0040 -0.7694 0.6750 0.1265 0.4429 -2.4161 0.3147 0.0020 -0.6516 0.2043 0.9083 -1.2347 0.3345 0.2729 -0.1165 0.1175 0.3354 -0.0349 0.6836 0.3244 -3.0520 -0.4395 -0.2895 0.1101 -0.3640 0.6790 1.3952 0.2633 0.2617 -0.0948 0.3217 0.1557 -0.2845 -0.0989 0.1981 -0.8093 0.0251 0.4300 -0.1230 0.4222 0.0530 -0.9158 -0.2185 0.1378 0.2555 -0.0682 0.4073 -0.3030 0.3064 0.2466 -0.2367 -0.8665 -0.1944 0.0063 0.3333 0.2854 0.0835 0.4269 -0.1521 -0.2605 0.4355 0.1166 -0.0641 -0.7388 0.3211 0.1865 0.1828 0.1677 -2.1055 0.2641 0.3502 -0.2090 -0.2373 -0.0686 -0.6259 0.4667 0.6866 0.1845 0.2881 0.4789 -0.7637 0.2493 0.2467 -0.8913 -0.5568 0.1009 0.1456 0.2783 0.3143 -0.8227 0.3049 0.0434 0.4183 -0.0403 -0.0096 0.2938 -0.2801 -0.1485 0.0427 0.0641 0.4508 -1.1107 -0.6295 0.4774 -0.1887 0.4915 -0.6894 -0.4805 -0.2239 -0.0609 -0.1784 -0.4904 0.0901 -0.3210 0.1245 0.1342 -0.3758 0.3347 0.0700 0.1988 -0.3137 -0.0225 0.0551 -0.2239 -0.0609 -0.1784 -0.4904 0.0901 -0.3210 0.1245 0.1342 -0.3758 0.3347 0.0700 0.1988 -0.3137 -0.0225 0.0551 0.0719 0.1163 0.0299 0.1202 -0.0574 -0.2587 0.5243 0.2336 -0.7011 -0.1952 0.1140 0.2918 -0.1039 -0.2092 -0.3673 -0.0702 -0.0854 0.0929 -0.0922 -0.0457 0.1853 0.0958 -0.1754 0.0786 0.0400 -0.0590 -0.0127 -0.0575 0.1316 -0.4589 -0.4001 0.2732 -0.2074 0.0818 0.0294 -0.1357 0.0898 -0.0310 -0.0432 -0.1531 -0.0375 0.4817 0.0049 -0.2046 0.2795 0.1649 0.1540 -0.1713 -0.3273 -0.1180 0.9991 0.5072 0.0154 -0.4269 0.0103 -0.0010 0.1941 -0.0877 -0.0092 -0.2077 -0.2935 0.1725 0.0649 -0.5659 -0.2616 -0.0506 0.0362 -0.0461 -0.1168 -0.2729 0.0487 0.0215 -0.1423 -0.0937 -0.7708 -0.0630 -0.0771 0.5777 0.0006 0.0881 -0.0376 -0.0048 0.0554 0.1481 0.0022 0.1403 0.0121 0.3826 0.0381 -0.0314 -0.1242 0.0884 -0.9846 0.0232 -0.0688 -0.0350 -0.0725 -0.0970 0.1500 0.3050 0.1166 -0.2483 0.2102 0.1347 0.3780 -0.1013 0.0519 0.1971 0.2550 -0.0763 -0.0912 0.2090 0.0638 0.4100 -0.1494 0.1752 -0.3110 0.2047 0.2371 -0.3390 0.4201 0.1532 -0.2604 -0.5967 -0.0188 0.0774 0.0503 -0.0768 0.1574 0.1472 0.1864 -0.0732 0.0568 0.0834 0.1982 -0.1397 0.1607 -0.5092 0.1584 0.2849 -0.2476 0.2390 0.0711 -0.1629 -0.0531 -0.2232 -0.0511 0.0270 0.1446 0.1197 0.0306 0.1177 -0.1722 0.2369 0.2365 -0.3537 -0.0877 0.1126 0.1682 0.0784 0.0043 -0.2798 -0.0235 0.1559 0.0060 0.0136 -0.1996 0.0410 0.0341 0.0316 0.0668 0.1452 0.2257 -0.4915 -0.2004 0.2614 -0.1191 0.1810 0.1316 -0.5667 -0.1180 0.0791 -0.2610 -0.2831 0.1132 -0.0087 0.0891 -0.0304 -0.0365 0.0604 0.1623 -0.1271 -0.0024 -0.0527 -1.7384 -0.1180 0.0791 -0.2610 -0.2831 0.1132 -0.0087 0.0891 -0.0304 -0.0365 0.0604 0.1623 -0.1271 -0.0024 -0.0527 -1.7384 -0.1525 -0.1506 0.1157 -0.0626 -0.0098 -0.2536 -0.2280 0.0899 -0.1064 -0.2455 0.0776 0.0328 -0.0278 0.1046 -0.1826 -0.0409 -0.0245 -0.1569 0.0596 -0.1428 -0.0810 -0.0952 0.0462 0.0277 0.0480 -0.0424 -0.0212 -0.0361 0.0666 -0.1440 -0.2833 0.0183 0.0181 0.0764 -0.0170 -0.0819 -0.1367 0.1172 -0.1057 -0.0373 -0.0504 -0.0290 -0.0264 -0.2322 0.0507 -0.0882 -0.0285 -0.0896 -0.1247 0.0579 -0.2020 -0.1531 0.1045 0.0869 0.0173 0.0769 -0.1650 0.0152 -0.0525 -0.1025 -0.0623 0.0073 -0.1283 -0.1367 -0.0655 0.1145 0.0693 -0.0264 -0.0243 -0.0133 0.1559 -0.1049 -0.2590 0.0197 -0.0180 0.1039 0.0426 -0.1521 -0.0951 0.0474 -0.0321 -0.0095 -0.0024 -0.0281 -0.1199 -0.1179 0.1792 0.1106 -0.0143 0.0667 -0.1432 0.1386 -0.2394 -0.1099 0.1019 -0.0600 -0.0257 0.1246 -0.1588 -0.1307 0.1015 -0.0064 -0.0172 -0.1457 0.0111 0.0060 0.0613 0.0423 -0.0524 -0.1100 -0.0161 0.0147 -0.0688 -0.1771 -0.1924 0.0269 -0.0230 -0.0781 0.0554 -0.1075 0.0444 0.0120 -0.0797 -0.0169 -0.0711 -0.1254 -0.1959 -0.0941 -0.0265 0.1551 -0.0717 -0.0620 -0.1516 0.1478 -0.1459 -0.2330 0.0351 -0.1003 0.1208 0.0700 -0.2541 -0.1239 0.0060 -0.1313 -0.0481 -0.0049 -0.0391 0.0371 -0.0959 0.0046 0.1069 0.0766 -0.1412 0.0768 0.0610 -0.0546 -0.1150 -0.1099 -0.1075 -0.0614 0.0379 -0.1628 -0.0482 0.0465 -0.0231 -0.1321 0.0304 -0.1365 0.0149 0.0624 0.1266 0.0695 -0.0598 -0.2762 -0.3047 -0.0535 -0.4134 -0.0802 -0.1731 -0.5599 -0.2312 -0.1384 -0.1092 -0.1683 -0.0991 -0.0306 -0.4914 -0.1766 0.1436 -0.4903 -0.4336 0.4067 0.1656 0.0440 -0.0066 -0.2312 -0.1384 -0.1092 -0.1683 -0.0991 -0.0306 -0.4914 -0.1766 0.1436 -0.4903 -0.4336 0.4067 0.1656 0.0440 -0.0066 0.2084 -0.1375 0.1465 0.2957 -0.5224 -0.0246 -0.2218 0.4168 0.1638 0.1136 -0.0770 -0.3158 -0.3035 0.0056 0.1092 0.2687 0.0171 -0.0696 0.3150 0.1211 -0.0328 -0.5059 -0.3241 0.1114 0.0319 -0.2240 -0.0476 0.0675 0.0916 0.3416 -0.9968 0.1659 -0.1325 -0.2141 0.1908 -0.5782 0.4171 0.2559 -0.5971 -0.0547 0.5027 -0.6300 0.0229 -0.0699 0.0567 0.0004 0.4747 0.0502 0.2407 0.1724 1.1213 -1.4734 0.2187 -0.1167 -0.4250 -0.1780 0.0476 0.5532 -0.0936 -0.2998 -0.2919 -0.1068 -0.1608 -0.1785 0.0952 0.2929 0.4487 -0.0966 0.0937 0.4835 0.3595 -1.5156 -0.2254 0.2010 0.3692 -0.2917 0.1611 0.2879 0.9507 -0.0808 -0.8138 -0.7857 0.0668 0.5668 -0.1481 -0.0357 0.3098 0.1100 0.2125 -0.0792 0.1579 0.3263 0.1525 -1.0080 0.5903 0.5750 0.2445 -0.0749 -1.5258 0.5259 -0.1335 -0.3722 -0.7524 0.5067 -0.3339 0.1256 0.2130 0.3711 0.5298 -0.0047 0.0172 0.2245 0.3498 -0.2708 0.8254 -0.0748 -0.1682 -0.1597 0.2438 -0.0862 -0.2318 0.2487 -0.2518 -0.9206 -0.0784 0.0064 -0.0974 0.2646 0.0653 0.3142 0.1680 -0.2264 -0.3830 0.1564 0.2655 -0.1569 -0.1164 -1.2884 0.1627 -0.3389 1.5718 -0.3993 0.3884 0.0368 -0.3218 0.4175 0.4933 -0.3549 -0.2177 0.1910 0.5061 -0.3269 -0.4798 0.1170 0.4023 0.2496 0.2702 -0.1937 -0.7456 -0.1245 -0.1993 -0.3969 -0.1063 0.2354 -0.0123 0.0521 0.4387 0.0241 0.2045 0.2822 -0.0851 0.3633 -0.2066 -0.7200 -0.0648 0.5562 -0.5430 0.6198 0.8773 -1.6091 -0.2516 -0.0888 -0.0012 0.0483 -0.2840 -0.3496 -0.0260 0.1113 0.0575 -0.2132 -0.1944 -0.1994 -0.0338 -0.0620 -1.5747 -0.2516 -0.0888 -0.0012 0.0483 -0.2840 -0.3496 -0.0260 0.1113 0.0575 -0.2132 -0.1944 -0.1994 -0.0338 -0.0620 -1.5747 -0.0786 0.0936 -0.1136 0.1926 0.0366 0.3222 0.0459 -0.1070 0.0134 0.2034 -0.1947 -0.1789 -0.1718 -0.2030 0.1549 -0.1951 -0.1536 0.0062 -0.0434 0.1509 -0.0299 -0.0298 -0.0633 -0.0380 -0.1720 -0.0030 0.2196 -0.0872 -0.1981 0.0860 0.0327 -0.1135 -0.1158 -0.1699 -0.0951 0.0315 -0.0258 0.0912 0.0139 -0.1558 -0.0718 -0.0594 -0.0273 -0.1651 -0.1518 -0.2472 0.1341 0.1912 0.0647 -0.1075 0.0057 0.0828 -0.0611 0.0237 -0.0640 0.0564 -0.0535 0.0966 -0.0066 0.0098 -0.1646 0.0743 -0.1109 0.1143 -0.0844 -0.0962 -0.0755 0.0324 0.1004 0.2681 -0.3199 0.2101 0.4096 -0.4824 -0.0053 -0.1677 -0.2138 0.1561 -0.1965 -0.1556 0.1288 -0.1044 0.2237 -0.0647 0.2076 0.2785 -0.4766 -0.3984 -0.1635 0.0695 0.0985 -0.2969 0.1556 0.2778 -0.1526 0.0198 -0.0607 -0.1433 0.1631 -0.1186 -0.0755 0.0616 -0.3143 0.0783 -0.1562 0.1547 -0.0471 -0.2903 -0.0073 -0.0833 0.1096 0.1148 -0.2157 0.1026 0.0424 -0.1397 0.0425 -0.2027 -0.2219 0.0868 0.0116 -0.1651 0.1060 0.0310 0.1428 -0.0555 -0.0638 0.1075 -0.1535 0.0514 -0.1707 0.0691 0.0081 -0.3484 -0.0011 -0.0471 -0.1148 0.0996 -0.2490 -0.0987 0.0802 0.0348 0.0166 0.1580 -0.0606 0.0515 -0.0620 0.0210 -0.0608 -0.0606 -0.1229 0.1156 0.0690 -0.0631 -0.1980 0.0242 0.0214 -0.2648 -0.1006 -0.1137 -0.1244 0.1120 -0.3277 -0.2386 0.0329 0.0130 0.2495 -0.2629 -0.0426 0.0753 -0.3399 -0.1316 0.0666 0.1570 -0.3488 -0.4701 0.0462 -0.4080 -0.3286 0.0809 -0.0250 0.0470 -0.0046 0.0463 -0.1318 -0.2258 -0.1191 -0.0753 0.0572 0.0193 -0.0837 -0.0555 -0.1209 -0.0041 -1.1271 -0.0250 0.0470 -0.0046 0.0463 -0.1318 -0.2258 -0.1191 -0.0753 0.0572 0.0193 -0.0837 -0.0555 -0.1209 -0.0041 -1.1271 -0.0082 -0.0187 -0.0200 -0.1104 0.0186 0.0624 0.0110 -0.1444 0.0493 0.0974 0.0140 0.0034 -0.1551 -0.1154 0.0643 -0.0049 0.0172 0.0904 -0.0040 0.0945 -0.0501 0.0471 -0.0008 -0.0670 0.0497 -0.1224 -0.0207 -0.0536 -0.0437 -0.0213 0.0104 -0.0468 -0.0004 -0.1269 -0.0976 -0.0089 -0.1010 -0.0732 -0.0231 0.0546 -0.0432 0.0183 0.0340 -0.0825 -0.0740 -0.0890 -0.0229 0.0842 0.0438 -0.1344 0.1028 0.0393 -0.1265 0.0062 -0.1506 -0.1119 0.0433 -0.0354 -0.0894 -0.1061 -0.0542 -0.0509 -0.0039 0.0207 0.0358 0.0149 -0.0526 -0.0515 0.0214 0.0701 -0.1886 0.0989 0.0608 -0.1145 -0.0110 -0.0737 -0.0662 0.0857 -0.1341 -0.1322 0.0793 0.0508 0.0433 -0.0282 -0.0176 -0.0170 -0.0637 -0.2209 0.0196 0.0283 -0.0100 -0.0949 0.0735 0.1284 -0.0679 0.0523 0.0009 -0.1186 0.0195 -0.1115 -0.1663 -0.0425 -0.0233 0.0632 -0.0846 -0.0176 -0.0402 -0.1244 -0.1216 -0.0176 -0.0222 -0.0503 0.0040 -0.0070 0.1012 -0.0855 -0.0217 -0.0323 -0.1333 0.0748 -0.1331 -0.1485 0.0333 0.0205 0.0340 -0.0961 -0.0140 0.0342 -0.0395 -0.0082 -0.0507 0.1151 -0.0947 -0.0328 0.0107 0.0202 0.0300 -0.0488 -0.0532 -0.0826 0.0108 -0.0603 -0.1285 0.0995 0.0637 0.0620 0.0164 -0.0262 0.0128 0.0236 -0.0673 -0.0466 0.0728 -0.0164 -0.0276 -0.0570 0.0046 -0.1330 -0.0318 -0.0802 -0.1046 0.0189 -0.0364 -0.1387 -0.0648 -0.0155 -0.0374 -0.0631 -0.0398 -0.0699 -0.0149 -0.1081 -0.1411 0.1102 -0.2677 -0.3243 -0.1945 -0.2764 -0.2166 -0.0335 -0.2654 0.0085 -0.0072 -0.2625 -0.0081 -0.1053 0.0445 -0.0444 -0.1468 -0.0924 -0.0178 -0.0794 -0.0316 0.0308 -1.4709 -0.2654 0.0085 -0.0072 -0.2625 -0.0081 -0.1053 0.0445 -0.0444 -0.1468 -0.0924 -0.0178 -0.0794 -0.0316 0.0308 -1.4709 -0.0255 -0.0870 -0.0210 -0.0924 -0.0770 -0.0856 -0.1366 0.1100 -0.0609 -0.1834 0.0507 0.0500 0.1166 -0.0002 -0.0955 -0.0710 0.0135 0.0715 -0.1137 -0.0994 0.0335 -0.0770 -0.0315 0.0153 -0.0659 -0.1092 -0.0866 -0.0280 0.0957 -0.0484 -0.1368 -0.0135 -0.0362 -0.0404 -0.0368 -0.0695 -0.0471 -0.0676 -0.0358 -0.0835 -0.0708 -0.0454 -0.0617 -0.1121 -0.0245 -0.0810 -0.0092 0.0372 -0.0736 -0.0261 -0.0056 -0.1298 0.1005 -0.0680 -0.0274 0.0444 -0.0258 -0.0210 0.0060 -0.0775 0.0437 0.0250 -0.0686 -0.0698 -0.0695 0.0233 -0.0684 -0.0290 -0.1167 -0.1994 0.0498 -0.0704 -0.0559 0.1187 -0.1757 0.0838 -0.0429 -0.2800 0.0711 -0.0154 -0.1256 0.0537 -0.1106 0.0365 -0.0615 -0.0187 0.0556 0.1074 0.0184 -0.0586 -0.0281 -0.0192 -0.0561 -0.1159 0.0169 -0.1442 -0.0494 -0.0076 -0.1311 -0.1736 0.0254 0.0082 0.0755 -0.0489 -0.1447 -0.0864 -0.1110 0.0440 -0.0085 -0.0329 -0.0157 -0.1197 -0.0504 -0.0294 -0.1161 -0.0055 -0.0667 0.0458 0.0543 -0.1782 -0.0946 -0.0354 0.0185 0.0465 -0.0715 -0.0391 0.0095 0.0557 0.0681 -0.0567 -0.0806 -0.0338 0.0129 0.1363 -0.0563 -0.0471 -0.0542 -0.0764 0.0188 -0.0647 -0.1878 -0.0083 -0.0141 0.0113 -0.0218 0.0477 0.0505 0.0147 -0.0573 0.0513 -0.0654 0.0722 -0.0608 -0.0602 -0.0078 -0.0105 -0.0559 -0.1047 -0.1483 -0.0040 -0.0068 -0.0331 -0.0169 -0.0142 -0.0295 -0.0551 -0.1256 -0.0689 -0.0949 -0.0923 0.1077 -0.0282 0.0190 -0.0796 -0.3094 -0.0746 -0.3998 -0.1274 -0.0567 -0.5347 -0.4404 0.2935 0.3916 -0.0871 -0.0579 -0.5518 -0.0426 -0.4452 0.4379 -0.0310 -0.2462 -0.0751 0.2476 0.6247 -0.3712 -0.4404 0.2935 0.3916 -0.0871 -0.0579 -0.5518 -0.0426 -0.4452 0.4379 -0.0310 -0.2462 -0.0751 0.2476 0.6247 -0.3712 -0.4982 -0.6154 -0.1216 -0.0715 -0.5888 -0.0727 0.2318 -0.2398 -0.0899 -0.2222 -0.0102 -0.4008 -0.2690 0.0336 0.0220 -0.2803 -0.2918 0.9060 0.5078 -0.0122 0.0745 -0.4010 -0.0571 0.0923 0.0119 -0.2720 -0.0612 -0.1931 -0.4554 -0.1793 -0.4899 0.1450 -0.6984 -0.0444 -0.4956 1.0720 0.1371 0.0029 0.9646 0.0375 0.1088 0.5335 -0.2088 -0.0969 -0.1338 0.1365 -0.3496 0.2181 0.7705 -0.0997 -1.6491 0.1337 0.1325 0.1243 -0.4052 0.1344 0.2424 0.3991 -0.3383 0.4208 0.7689 -0.5860 0.5680 -0.2294 -0.8524 0.2328 -0.0993 -0.3466 0.1026 0.1807 0.0425 -0.9912 -1.2767 0.9102 -0.6814 0.1138 0.4834 -0.3626 0.8209 0.1129 -0.7802 0.5957 0.1501 0.6727 -0.9530 -0.9111 0.9066 0.4100 0.4750 0.0868 0.3064 0.0226 0.3354 -1.7428 0.5028 0.1648 -0.4831 0.1746 1.2267 0.3547 -0.1215 -0.6632 -0.3172 -0.4211 0.2462 0.0700 -0.2368 0.1278 0.4173 0.0106 -0.0324 -0.3312 0.0645 0.1295 -0.7172 0.1227 -1.0459 -0.0336 -0.0269 1.8286 0.3145 0.1468 -0.6641 -0.0874 -0.6067 0.4570 -0.2819 0.0902 0.5196 0.2465 -0.2038 -0.2431 -0.0271 0.3302 -0.0098 -0.1646 -0.1822 0.3946 -0.0334 0.1261 -0.1755 0.1256 0.0023 -0.3345 -0.3724 -0.3218 -0.2790 -0.0008 0.1569 0.1951 0.1730 0.0786 -0.2165 -0.6795 -0.0985 0.1847 0.2590 -0.2790 0.3861 -0.0930 0.0897 0.8765 -0.0259 -0.1015 0.2924 -0.2954 -0.4098 -0.0835 -0.0264 -0.2183 0.1068 -0.0054 -0.1196 0.0759 -0.6944 -0.2572 0.7365 -0.6305 0.5686 -0.4042 -0.4238 -0.1910 -0.0893 0.1516 -0.2773 -0.3657 -0.1600 -0.4313 0.1338 0.1155 0.3753 -0.2168 -0.3658 -0.0780 -1.6769 -0.4238 -0.1910 -0.0893 0.1516 -0.2773 -0.3657 -0.1600 -0.4313 0.1338 0.1155 0.3753 -0.2168 -0.3658 -0.0780 -1.6769 -0.0558 -0.1166 -0.0037 0.3199 -0.0506 0.3936 -0.0856 0.0799 0.0126 0.2557 0.1458 0.0134 -0.2269 -0.2015 0.2132 -0.3084 -0.1138 0.0908 -0.0307 -0.0011 -0.0644 -0.1298 -0.0852 -0.0638 -0.0841 -0.1385 0.0827 -0.1136 -0.1284 0.0474 0.0897 0.0641 -0.1309 -0.1902 -0.0091 0.0731 0.0393 -0.1305 -0.0817 -0.1836 0.0459 -0.1567 0.0665 -0.2045 -0.1317 -0.2363 0.0050 0.1850 -0.0593 -0.1204 0.0678 0.1458 -0.0253 0.1825 -0.1214 -0.1360 -0.0461 0.1053 -0.0835 0.0425 -0.0384 0.0558 -0.1123 0.2595 -0.0093 -0.0359 -0.1524 -0.0389 0.1145 0.2416 -0.3359 0.1487 0.2518 -0.3335 0.1033 -0.0347 -0.2397 0.0838 0.0924 -0.0886 0.1740 -0.2095 0.2114 -0.2161 -0.0273 0.2100 -0.4838 -0.3863 -0.0426 0.0552 -0.0084 -0.1295 0.1345 0.3125 -0.2314 0.0121 -0.0465 -0.1482 0.1464 -0.3455 0.0336 0.0063 -0.2005 0.1007 -0.0512 0.2366 0.0325 -0.2670 0.0268 -0.2104 0.0193 0.3541 -0.1756 0.0408 0.0657 -0.2361 -0.0147 -0.1239 -0.3568 0.0924 0.0110 -0.1261 0.1311 -0.1021 -0.0029 0.0179 -0.1337 0.2070 -0.2922 -0.0365 -0.1542 -0.0245 0.0073 -0.2188 -0.0699 -0.1865 -0.1803 0.0934 -0.1047 -0.0764 0.0209 -0.1453 0.1370 0.1386 0.0386 0.0949 -0.1336 -0.0056 -0.1077 -0.0040 0.1795 -0.0422 -0.0125 0.0953 -0.1829 -0.1264 -0.0496 -0.0777 -0.0630 -0.1819 -0.0889 0.0479 -0.1326 -0.1139 0.0402 0.0479 0.0980 -0.2022 -0.2147 0.0634 -0.3222 0.1810 0.1009 0.1175 -0.5225 -0.8278 0.2654 -0.3702 -0.5942 0.2127 0.0274 0.0764 0.0636 -0.2613 -0.1334 -0.0198 0.0135 0.0124 -0.1285 -0.2836 0.0769 -0.1212 0.0859 -0.1590 -0.6574 0.0274 0.0764 0.0636 -0.2613 -0.1334 -0.0198 0.0135 0.0124 -0.1285 -0.2836 0.0769 -0.1212 0.0859 -0.1590 -0.6574 -0.0775 0.0353 -0.0792 -0.0620 -0.0255 -0.2115 -0.0830 -0.0508 -0.1690 -0.0963 0.0328 0.0287 0.1081 0.0818 -0.1133 -0.1145 0.1249 -0.0278 0.1230 -0.0136 -0.0220 -0.0375 -0.0581 0.0791 0.0288 0.0436 -0.0349 0.0529 0.0565 0.1327 -0.1413 -0.0494 -0.0126 0.1121 -0.0001 -0.2529 0.0327 0.0883 0.0231 -0.1087 -0.0289 -0.0916 0.0575 -0.0428 0.0169 0.0418 0.0654 -0.0946 -0.1318 0.0746 -0.2588 -0.2445 -0.0495 -0.0641 -0.0401 0.0002 0.1741 0.0216 -0.0291 0.0647 -0.0315 -0.1165 -0.0531 -0.0788 0.0352 0.0755 0.0305 -0.0349 0.0736 -0.1740 0.1247 -0.3335 -0.2903 0.1952 -0.0103 0.0867 -0.0653 -0.0296 0.0914 0.1070 -0.1114 0.1327 -0.2113 0.1275 -0.2028 -0.0570 0.1563 0.1781 -0.0486 0.0372 0.0922 0.0694 -0.3013 -0.1655 0.1167 0.1202 0.0469 0.0711 -0.2876 -0.0092 -0.0719 -0.1224 -0.0189 -0.1874 0.0179 0.0813 0.0052 0.1256 0.0193 0.0389 -0.0503 -0.0897 0.0188 -0.2025 -0.0325 -0.0604 -0.1843 0.0440 -0.0516 -0.0661 0.0181 -0.0332 0.0261 -0.0043 -0.0318 0.0923 0.0681 -0.0510 0.0103 -0.0630 0.0022 -0.0904 -0.0157 0.0443 -0.0788 -0.0474 -0.0435 0.0798 0.1023 -0.0851 -0.1269 -0.1357 0.0715 -0.0334 0.0992 -0.0419 -0.0379 -0.0367 -0.0252 -0.0548 -0.0201 -0.0258 -0.0153 0.0438 0.0606 -0.0493 -0.1706 -0.0059 0.1190 -0.0470 0.0844 -0.2246 0.0386 -0.0047 0.0317 -0.0602 -0.1593 0.0366 -0.0279 -0.0030 0.0512 -0.0728 -0.0765 -0.1503 -0.2182 0.0975 -0.1366 -0.0660 -0.0701 -0.2039 -0.2787 -0.0300 -0.0129 0.0734 -0.1601 -0.1521 -0.0728 -0.2216 0.1039 0.1947 -0.0986 -0.0271 -0.0273 0.0409 -1.6520 -0.2787 -0.0300 -0.0129 0.0734 -0.1601 -0.1521 -0.0728 -0.2216 0.1039 0.1947 -0.0986 -0.0271 -0.0273 0.0409 -1.6520 -0.0200 -0.0624 -0.1386 -0.2012 0.1485 0.2136 -0.0577 -0.2392 0.1213 0.3047 -0.1371 -0.1821 -0.2159 -0.1578 0.1490 -0.2181 0.0490 -0.0203 -0.1512 0.1167 -0.0710 0.1240 -0.0801 -0.0607 -0.1384 0.0013 0.0884 -0.0222 -0.1230 0.0022 -0.0436 -0.1873 -0.2359 -0.1212 -0.0576 -0.0149 -0.1533 0.0411 -0.0290 -0.1164 0.0115 -0.0555 -0.0404 -0.1917 -0.1324 -0.0827 0.2009 0.1740 0.0430 -0.0214 -0.0348 0.1138 0.0036 -0.0586 -0.0224 -0.1547 -0.0962 0.0092 0.0309 -0.0417 -0.0274 -0.0043 -0.0751 0.0515 0.0022 -0.2134 -0.0575 -0.0348 0.0464 0.0841 -0.1379 0.0363 0.1724 -0.2963 0.0692 -0.1032 -0.1691 0.0452 -0.2270 0.0313 0.0897 0.0412 0.0616 -0.1070 0.1049 0.0690 -0.3397 -0.2811 0.0712 0.0222 -0.0795 -0.1508 0.0891 0.1575 -0.1906 0.0940 0.0251 -0.1007 0.0129 -0.2276 -0.0074 0.0058 -0.2409 -0.0014 -0.2029 0.0811 -0.0532 -0.2591 -0.0870 0.0862 0.0214 0.0044 -0.1930 0.0020 -0.0222 -0.2300 -0.0853 -0.1747 -0.2333 -0.0518 -0.0040 0.0702 0.0257 -0.1061 0.0056 -0.0730 -0.0236 -0.1187 -0.1061 0.1566 0.0486 0.1917 0.0962 -0.2380 0.0973 -0.0153 -0.2225 0.0375 -0.1509 -0.1922 0.0094 -0.0221 -0.1345 -0.0357 -0.0026 0.0318 -0.1346 -0.0144 -0.0281 -0.1553 -0.1418 -0.0987 0.0799 -0.0645 -0.0636 0.0778 -0.0169 -0.0136 -0.1199 -0.0240 -0.0319 0.0105 -0.2183 -0.1384 -0.0266 -0.0450 0.1508 -0.0699 -0.0459 0.0643 -0.2617 -0.0988 0.1075 0.1620 -0.4064 -0.2574 -0.3915 -0.3677 -0.0972 -0.0685 -0.0407 -0.0799 -0.2774 -0.2313 -0.0790 -0.1162 0.1001 -0.0129 0.1923 -0.1635 0.0519 0.0279 0.0394 0.0970 -0.7872 -0.0407 -0.0799 -0.2774 -0.2313 -0.0790 -0.1162 0.1001 -0.0129 0.1923 -0.1635 0.0519 0.0279 0.0394 0.0970 -0.7872 -0.1353 -0.0126 0.0393 0.0154 -0.0962 -0.2655 0.2645 0.2063 -0.3271 -0.2312 -0.0703 0.1298 0.0597 -0.1523 -0.3343 -0.2193 0.0461 0.0802 0.0317 -0.0585 0.0230 0.0080 0.0603 0.0699 -0.0062 -0.0927 -0.1346 0.0101 0.1669 -0.3082 -0.4691 0.0081 0.1999 0.0093 -0.0356 0.3093 0.0358 0.0302 0.1522 0.0602 -0.2033 0.0167 -0.0436 -0.0049 0.0313 -0.0423 -0.0956 -0.0161 0.1477 0.0736 0.0201 -0.3848 -0.0298 -0.2457 -0.0748 0.0338 -0.0069 0.1399 0.0618 -0.0938 -0.0108 0.0076 0.1702 -0.2843 -0.2742 0.0376 0.0358 0.0270 -0.0889 -0.1563 0.1510 -0.2383 -0.2277 0.1013 -0.0129 0.1083 0.0579 -0.0906 0.3658 0.0928 -0.1153 -0.0366 -0.1554 0.1417 -0.2918 -0.3042 0.2645 0.2796 0.0563 0.0308 -0.3092 0.1308 -0.5995 -0.1862 0.0667 -0.4834 0.1281 -0.0069 -0.0185 0.3143 0.0902 0.1801 -0.1501 0.0037 0.4798 -0.2991 -0.0906 0.0754 0.2352 0.0141 0.0023 -0.1088 0.0229 0.5282 -0.4446 0.0300 -0.1147 0.1183 0.1371 -0.2027 0.2577 0.1057 0.0583 -0.1165 -0.1293 -0.2323 -0.0283 -0.2737 0.0444 0.1443 0.0804 -0.0732 -0.1490 0.0044 -0.2106 0.1229 0.1600 -0.3397 0.0153 -0.0990 -0.3790 0.0667 0.1842 0.0835 0.3080 -0.0997 0.0948 -0.2010 0.0993 0.1781 0.0413 -0.1056 -0.0695 -0.0166 0.0469 -0.0233 -0.0192 0.1157 0.0617 0.1521 -0.0376 0.0622 0.0332 0.1474 -0.1051 -0.0063 -0.2382 0.1015 -0.1338 -0.1134 0.0614 0.1047 0.0266 -0.2348 -0.2407 0.1554 -0.1824 -0.1038 0.2022 -0.4972 0.0690 0.0063 -0.1381 -0.1341 -0.0097 0.0387 -0.1231 -0.1371 -0.1244 -0.1457 -0.1042 0.0308 -0.0456 0.0970 -0.5442 0.0690 0.0063 -0.1381 -0.1341 -0.0097 0.0387 -0.1231 -0.1371 -0.1244 -0.1457 -0.1042 0.0308 -0.0456 0.0970 -0.5442 -0.0532 -0.0040 0.0260 -0.1017 0.0393 0.1735 0.0571 0.0114 0.0275 0.0672 -0.0528 -0.0203 -0.0993 -0.1081 0.0736 -0.1198 -0.0474 0.0538 -0.0692 -0.0526 -0.0021 -0.0184 0.0276 -0.0419 -0.0166 -0.1135 0.0212 0.0376 0.0520 -0.0374 0.0120 -0.0800 -0.0738 0.0574 -0.0523 0.1039 -0.0118 -0.0121 -0.0978 0.0917 0.0407 -0.0260 -0.0020 0.0065 -0.0847 -0.0973 -0.0294 0.0571 -0.1026 -0.0263 -0.0558 0.0476 -0.1195 -0.0148 -0.0760 -0.0844 0.1725 -0.0712 0.0271 -0.0946 0.0272 0.0669 -0.0670 0.0813 0.0649 -0.0500 -0.0950 -0.0687 0.1111 -0.0203 -0.1206 0.0275 0.0024 -0.0950 -0.1078 -0.0050 -0.1308 0.1529 -0.0356 -0.0984 0.0545 -0.0853 0.1422 -0.0744 0.0593 -0.0509 -0.0138 -0.1184 -0.0509 0.0922 -0.1009 -0.0991 -0.0688 -0.0235 0.0484 -0.0854 -0.1363 0.0236 0.0284 0.0534 0.0061 0.0330 -0.1012 0.1095 -0.0147 0.0850 -0.0128 0.0052 -0.0746 0.0210 -0.0275 -0.0522 -0.1165 -0.0229 0.0297 -0.0034 -0.0564 -0.0156 -0.1126 0.0560 -0.0927 -0.1001 0.0498 -0.0998 0.0957 -0.0340 -0.0744 -0.0886 -0.0023 -0.0382 0.0039 0.0883 -0.0413 0.0265 -0.0748 0.0388 -0.1239 0.0721 -0.0413 -0.0011 0.1775 -0.1097 -0.0205 0.0389 0.0853 -0.0171 -0.0356 -0.0398 -0.0246 -0.0083 -0.0490 -0.1343 0.1299 0.0060 -0.0096 -0.0402 -0.0222 0.0106 -0.0015 -0.1077 -0.1124 0.0839 -0.1003 0.0197 0.0618 -0.0677 0.0123 -0.1070 0.0202 0.0689 -0.0098 0.0138 -0.0373 0.1607 -0.0961 -0.1186 -0.1164 -0.2035 0.0327 0.0585 -0.3196 -0.0275 0.0632 0.2148 -0.1482 -0.4646 -0.1380 -0.0441 0.0936 -0.0733 -0.2769 -0.1996 0.0491 0.0823 -1.4694 -0.3196 -0.0275 0.0632 0.2148 -0.1482 -0.4646 -0.1380 -0.0441 0.0936 -0.0733 -0.2769 -0.1996 0.0491 0.0823 -1.4694 0.0600 0.0535 -0.1246 -0.1686 -0.0159 0.3241 0.0533 -0.2033 0.1987 0.3812 -0.1687 -0.1187 -0.2588 -0.1313 -0.2259 -0.1113 -0.1793 -0.0070 -0.1407 -0.0064 -0.1155 -0.0509 0.0634 -0.0498 -0.0875 -0.1560 0.1553 -0.2296 -0.1783 0.0105 -0.0539 -0.2058 -0.1166 -0.1310 0.1457 -0.0120 -0.0651 0.0113 -0.0814 -0.1291 0.0052 -0.0841 -0.0055 -0.2050 -0.0069 -0.2285 0.1874 0.1952 0.0487 -0.1149 -0.0120 0.1528 0.0586 0.0562 -0.0683 -0.1046 -0.0340 -0.0309 -0.1412 -0.0404 -0.0305 0.0654 -0.1011 0.0579 -0.0315 -0.1765 -0.1773 0.0840 0.0749 0.2033 -0.2586 0.1587 0.4079 -0.4240 0.1003 -0.0878 -0.1373 0.1813 -0.2693 -0.1543 0.1311 -0.0133 0.0979 -0.1402 0.1710 0.0493 -0.2720 -0.2845 0.0343 0.0623 -0.0736 -0.1832 0.0993 0.2077 -0.1134 0.0454 -0.0882 -0.1338 0.1170 -0.0995 -0.2232 0.0318 -0.2136 0.0187 -0.1622 0.1948 -0.0678 -0.1943 -0.0054 0.0282 0.0778 0.0311 -0.1477 0.0276 0.0438 -0.0723 0.0396 -0.1046 -0.0855 0.0675 -0.1406 -0.0518 0.0065 -0.0773 -0.0760 -0.0868 -0.0436 -0.0320 -0.1450 0.1611 -0.0165 0.0536 0.0217 -0.2885 0.1105 0.0150 -0.2620 0.1187 -0.1234 -0.1284 -0.0536 -0.1788 -0.0026 0.0561 -0.0484 -0.0062 -0.1740 0.1164 -0.0339 -0.2484 0.0609 -0.1219 0.1419 -0.1550 -0.1602 0.0719 -0.0296 -0.1523 -0.1008 -0.0884 -0.0739 0.1454 -0.0402 -0.1250 0.1036 -0.1391 0.0902 -0.2065 -0.0820 0.1197 -0.1886 -0.0284 0.0670 0.2412 -0.1624 -0.4823 -0.1267 -0.4443 -0.1721 -0.0429 -0.1163 0.1892 -0.8138 -0.3166 -0.4072 0.2067 -0.1604 -0.1571 0.8550 0.2091 -0.1725 0.0291 -0.1731 -0.0785 -0.2556 -0.1163 0.1892 -0.8138 -0.3166 -0.4072 0.2067 -0.1604 -0.1571 0.8550 0.2091 -0.1725 0.0291 -0.1731 -0.0785 -0.2556 0.1705 -0.0924 0.0137 -0.0917 -0.0371 -0.4751 -0.0383 0.0430 0.2101 0.1365 0.1728 0.4015 0.0984 -0.4462 0.1528 -0.1338 0.0071 -0.1758 -0.3409 0.1297 0.1470 -0.0033 -0.0577 0.0398 -0.1397 -0.2240 -0.1221 0.2523 0.1245 -0.2144 -0.0156 -0.1787 -0.0196 0.1008 -0.0873 0.0529 0.0459 0.0283 -0.2827 -0.5340 -0.0976 0.2241 0.0658 -0.0048 0.1068 -0.1389 0.0764 -0.1225 -0.2586 0.1565 -0.3191 -0.5556 0.0408 -0.4366 -0.0530 0.1516 0.9817 -0.1597 0.0270 -0.3668 -0.5726 0.1249 0.9253 -0.4340 -0.0179 0.2175 0.1537 0.2130 0.1128 -0.4296 0.1558 0.2560 -0.6744 0.1259 -0.4320 0.2503 0.1149 0.0167 0.3731 0.0582 0.2792 -0.4623 -0.5999 0.2511 -0.1941 0.2007 0.2552 0.4177 0.1119 -0.0669 -0.0109 0.1544 0.3826 -1.0202 0.1016 -0.6978 -0.0638 0.1408 -0.2263 0.3331 0.0515 0.2765 -0.0578 -0.3102 0.1715 0.0006 0.1221 0.1309 0.3904 0.0012 -0.1462 -0.2059 0.0990 -0.0674 -0.1937 -0.0346 -0.4190 0.0076 0.0575 0.4768 0.2221 0.2878 -0.4882 -0.1411 0.1276 0.1129 -0.2605 -0.2095 0.0620 0.4527 0.3098 -0.0740 0.1975 0.1556 -0.5103 -0.5444 -0.0451 0.1384 -0.0502 -0.0547 0.2523 0.3984 0.2185 0.0861 -0.4343 0.0298 0.0470 0.4478 -0.0513 -0.0090 0.2320 -0.1467 -0.1466 -0.2195 0.1748 -0.0237 0.1351 0.2254 -0.2510 -0.2662 0.3593 0.4239 0.2323 0.0890 0.0984 -0.2439 0.0237 0.0271 0.1031 -0.1232 -0.1041 0.2198 0.0262 -0.5368 0.2312 0.0998 -0.3313 0.7418 -0.0580 -0.7768 -0.2697 -0.0304 -0.0675 0.0226 -0.2288 -0.3773 -0.1839 -0.1370 -0.0445 0.0788 0.0868 -0.3457 -0.2688 0.0588 -1.9368 -0.2697 -0.0304 -0.0675 0.0226 -0.2288 -0.3773 -0.1839 -0.1370 -0.0445 0.0788 0.0868 -0.3457 -0.2688 0.0588 -1.9368 -0.1513 0.1112 0.0452 0.0940 -0.0204 0.1116 -0.0486 -0.0345 0.0154 0.1007 -0.2168 -0.1348 -0.1117 -0.3205 0.1320 -0.3193 -0.1145 -0.0139 -0.0441 0.0583 -0.0618 0.1748 -0.0422 -0.1656 -0.1274 -0.0483 0.0912 -0.0944 0.0106 -0.0099 0.0248 -0.2131 -0.0943 -0.0863 -0.0009 0.0427 0.0548 -0.0282 -0.0640 -0.2371 -0.0504 -0.0033 -0.0513 -0.0682 0.0006 0.0027 0.2054 0.0891 -0.0159 -0.1311 -0.0396 0.0323 -0.1550 -0.0930 0.0291 0.0706 -0.1113 -0.0913 -0.1703 -0.0265 -0.0416 -0.0474 -0.0250 0.0467 0.0391 -0.1121 -0.0335 -0.1169 0.0044 0.2179 -0.2674 0.0634 0.1717 -0.2847 0.0018 -0.1436 -0.2098 -0.0788 -0.2264 -0.0242 0.1130 -0.0874 0.0666 -0.1203 0.1194 0.0727 -0.2672 -0.3532 0.0895 0.0183 -0.0314 -0.1728 0.1394 0.1686 -0.2626 0.1174 -0.0492 -0.1189 0.0543 -0.1133 -0.1415 0.0379 -0.1611 0.0370 -0.1601 0.1836 -0.0845 -0.2794 -0.0544 -0.1474 0.0718 -0.0276 -0.2360 0.0393 -0.0080 -0.1620 0.0630 -0.0991 -0.2318 -0.0225 0.0141 -0.1898 0.0510 -0.0719 0.0567 -0.0540 -0.0492 -0.0416 -0.2735 -0.0457 0.0934 0.0243 0.1122 -0.2795 0.0261 0.0227 -0.2575 0.0564 -0.1082 -0.1225 0.0563 -0.2059 -0.1413 0.0870 -0.0737 -0.0015 -0.1574 0.0018 -0.0617 -0.2513 -0.0349 0.0860 0.1315 0.0962 -0.1689 0.0894 0.0999 -0.0901 -0.1122 -0.1392 -0.1679 -0.0255 -0.1769 -0.1830 -0.0076 -0.1105 0.0703 -0.1543 -0.1404 0.0650 -0.1402 -0.1098 0.1081 0.1888 -0.5364 -0.1563 -0.3953 -0.5588 -0.0230 -0.0572 0.0748 0.5287 0.3816 0.2673 -0.5182 -0.7019 -0.0066 -0.1719 0.0480 -1.0956 -0.5138 0.1890 0.2915 -0.0081 -1.8323 0.0748 0.5287 0.3816 0.2673 -0.5182 -0.7019 -0.0066 -0.1719 0.0480 -1.0956 -0.5138 0.1890 0.2915 -0.0081 -1.8323 0.3951 -0.0464 -0.2398 -0.1346 -0.2351 0.0812 0.0868 0.0385 0.0723 -0.1668 0.4560 -0.3584 -0.2358 -0.6031 0.0891 0.7194 0.2253 -0.1349 -0.3654 -0.0746 -0.2568 -0.3821 0.1687 -0.1140 -0.0350 -0.1299 -0.0830 -0.5689 -0.0356 -0.1139 -0.2722 -0.2222 -0.2463 0.2236 0.2555 -0.1788 -0.1906 0.2377 -0.1031 0.2431 -0.2731 -0.1264 0.2420 0.2105 -0.1427 0.2080 -0.3119 -0.0166 0.1859 -0.0307 0.1232 0.2105 -0.1735 -0.0259 -0.1082 -0.0353 -0.1160 -0.3426 -0.1694 -0.0719 0.0505 0.1175 -0.2570 0.1325 -0.0417 -0.0795 -0.3340 0.1270 -0.1839 0.4011 0.0096 0.1083 0.2244 -0.3040 -0.4391 -0.1853 0.1035 0.1588 -0.3406 -0.1542 -0.1239 -0.0308 -0.1222 -0.2656 0.3364 0.0991 -0.3784 -0.3408 -0.2842 -0.0748 0.0288 0.0132 -0.0344 -0.2227 0.2652 -0.1874 -0.0164 -0.4987 -0.2881 0.7200 -0.2400 0.0765 -0.2681 -0.0590 -0.1884 0.0061 -0.1344 -0.0856 -0.0017 0.0470 0.0705 -0.0960 0.1407 -0.0488 -0.1538 -0.0647 -0.0092 -0.0536 -0.1246 -0.0583 -0.2822 0.0089 -0.0976 0.0790 -0.1126 0.0459 0.0152 0.0373 -0.1557 -0.0433 -0.2889 0.0138 -0.0869 0.1748 0.0681 0.1146 -0.0247 0.0290 -0.0409 -0.2361 -0.0301 -0.2824 -0.2019 0.2073 0.0114 -0.1050 -0.2215 0.0199 0.1493 -0.2219 -0.2124 -0.0441 -0.0080 -0.4151 0.0109 0.1754 -0.1883 0.0660 -0.1754 -0.0077 -0.2421 0.1986 0.0293 -0.1748 0.2605 -0.1076 -0.0194 0.0005 0.0538 0.0686 -0.0380 0.0153 -0.0588 -0.0827 -0.1722 -0.6111 -0.3252 -0.2469 -0.5560 -0.1578 0.0709 0.1565 -0.0997 0.2231 0.2695 -0.1729 0.3521 -0.2517 -0.5576 0.4298 0.1756 0.3221 -0.4765 0.3439 0.4092 0.0709 0.1565 -0.0997 0.2231 0.2695 -0.1729 0.3521 -0.2517 -0.5576 0.4298 0.1756 0.3221 -0.4765 0.3439 0.4092 -0.0256 0.2421 0.2243 0.2904 0.1216 -1.1731 -0.1740 1.2654 -0.8961 0.4379 0.0100 -0.1519 -0.1072 0.1139 0.5029 0.1471 0.5547 -0.0341 -1.4200 0.2335 -0.3392 0.1653 0.0683 -0.0777 0.1260 0.1723 -0.5680 0.1919 -0.0510 -0.9462 1.2937 0.1614 0.0161 0.3836 -0.2866 0.3059 0.2524 0.0561 0.3228 -0.6922 -0.1650 -0.4779 -0.2080 -0.2240 0.1286 0.3641 0.2125 -0.3484 0.5975 0.5051 -2.4698 1.1934 0.0386 1.0018 -0.1849 -0.1637 -1.3104 0.3632 0.4537 0.1599 -0.9799 -0.2018 -0.8786 0.3909 0.9063 0.4398 0.0420 0.4406 -0.0396 -0.1782 0.1241 0.9564 -0.2741 0.3948 -0.0450 0.5161 -0.1111 1.6638 0.2508 0.3271 -0.8557 -1.9117 0.1624 -0.2609 -0.5471 -0.3400 -0.1472 0.4667 0.0899 -0.0819 0.4827 0.7583 0.2409 -0.3762 -0.0431 -0.1963 0.0044 0.0861 -1.6689 0.3406 0.4592 0.0351 -0.6609 0.1012 -0.3620 0.2741 0.4710 -0.3045 0.0046 0.2704 -0.1403 -0.0367 0.8039 0.9278 -0.9483 -0.0228 -0.4525 0.2338 0.0165 -1.8047 0.4459 0.4556 -0.2139 -1.0876 0.7293 0.4767 0.1769 0.4100 -0.0003 0.1802 0.1032 -0.3955 0.5143 0.5634 0.2158 0.4196 -0.1198 0.0470 -0.0073 0.7329 -2.3965 0.1394 0.4908 -0.1246 -1.0320 0.9195 -0.1797 0.1506 0.1547 -0.0268 0.2971 0.3821 -0.5924 0.3307 0.3609 -0.0676 -0.2658 0.1033 -0.0364 0.7222 0.1793 -0.3452 0.3516 0.3604 -0.0508 -0.5975 0.4902 0.3564 -0.0586 0.1830 0.0324 0.2714 0.2165 -1.7078 0.1617 0.8086 0.2983 1.1801 -0.5468 -0.3137 0.5592 -2.0631 -0.2173 -0.0786 0.4901 0.2797 0.3803 -0.2910 -0.0249 0.3654 -0.4193 0.8348 0.5190 -0.0673 -3.0553 0.5592 -2.0631 -0.2173 -0.0786 0.4901 0.2797 0.3803 -0.2910 -0.0249 0.3654 -0.4193 0.8348 0.5190 -0.0673 -3.0553 -0.3605 -0.2605 0.0830 -0.4106 -0.0568 0.6034 0.0320 -1.1657 0.5163 0.1788 0.0612 0.2563 -0.2087 0.4026 0.0978 -0.0773 -0.0464 0.6120 0.0434 -0.2389 -0.2093 -0.0240 -1.1040 -0.1752 -0.4254 0.3686 -0.1619 0.4309 -0.3576 0.0206 0.0859 0.0580 -0.0964 0.0527 -0.3586 0.0987 0.0191 -0.2998 0.2939 0.2987 -0.2627 -0.0537 -0.0137 -0.7029 0.3201 -0.7162 0.2213 0.1999 0.4949 -0.4154 0.2209 0.1441 -0.3063 -0.0508 -0.0326 0.1867 -0.0250 0.1944 -0.9160 -0.0177 0.3064 0.0034 -0.0862 0.0468 -0.6019 0.4647 -0.5968 -0.0056 -0.0187 0.7676 -0.9739 0.3958 0.5991 -0.1834 0.1192 0.1017 -0.2809 0.3343 0.1325 -0.8838 0.3643 0.5393 0.0867 -0.2245 -0.4180 -0.2370 -0.1094 -1.5488 -0.4948 -0.0751 0.2369 -0.3394 0.0279 0.1384 -0.1020 0.1608 0.0811 -0.2040 -0.0546 -0.1809 -0.6089 -0.0854 0.3517 -0.1710 -0.1635 -0.3160 0.1140 0.1070 -0.5670 0.0779 -0.0758 -0.0817 0.0662 -0.1234 -0.0802 0.0383 0.3802 0.0313 -0.0538 -0.1644 -0.0936 0.0960 -0.1738 0.4954 -0.0936 -0.1410 -0.2208 -0.2574 0.0587 -0.8311 -0.3199 -0.0284 0.1321 -0.8077 -0.0423 0.0847 -0.2022 0.6013 -0.1561 0.0305 0.0531 -0.2776 -0.1443 0.0545 0.4430 0.3342 -0.2085 -0.2759 -0.3376 -0.1124 -0.4709 -0.1160 0.0017 0.0356 -1.0540 0.0432 0.1386 0.0726 0.1321 0.2379 -0.0637 0.0742 -0.3838 -0.6811 -0.0010 0.7177 0.3306 -0.2403 0.0468 -0.7809 -0.2251 -0.3371 -0.4807 1.0340 0.6263 -3.8501 1.5143 0.9936 -3.0373 0.6161 0.3073 0.4940 -0.7617 -0.1142 -0.0821 -0.1590 0.1720 -0.0740 -0.0291 0.0566 0.0781 -0.1426 0.1214 0.1379 -0.4857 0.3073 0.4940 -0.7617 -0.1142 -0.0821 -0.1590 0.1720 -0.0740 -0.0291 0.0566 0.0781 -0.1426 0.1214 0.1379 -0.4857 0.3290 0.0703 0.0605 -0.1978 -0.2239 -0.7573 0.1184 0.4817 0.0141 -0.5409 0.3563 0.5548 0.3756 -0.0165 -0.4998 -0.3080 0.2065 0.2308 -0.2714 -0.2900 -0.0302 0.0081 0.0866 0.2528 -0.0280 -0.2396 -0.7156 0.2781 0.1507 0.3108 -0.1064 -0.0534 -0.1762 -0.0970 0.2387 -1.4003 -0.0110 0.3699 0.0549 0.2567 -0.0680 0.0339 -0.2539 -0.2472 0.3954 0.0095 0.4069 -0.3023 0.4589 0.2194 0.0455 -0.4466 0.0735 0.6028 0.5529 0.0095 -1.5794 -0.0775 -0.2936 0.0412 -0.4082 -0.1030 -0.2167 0.5789 -0.3706 0.2544 0.0662 0.2194 -0.0296 -0.7556 0.0907 -0.3444 2.2366 0.4855 -0.4213 0.0061 0.2264 -1.1760 -0.2760 0.2879 0.2752 -0.4072 0.3007 0.5335 -1.1987 -1.0012 0.5488 0.7076 -0.2952 -0.0980 -0.6861 -0.1276 1.4990 1.1716 0.3165 -0.5813 0.1776 -0.0176 -0.6339 -0.0481 -0.0696 0.0874 0.4372 -0.2961 0.2355 -0.3854 -0.7960 -0.0501 -0.1091 0.0406 -0.0090 0.4566 -0.0373 -1.2409 -0.4379 0.0259 0.0046 0.2309 -0.1274 -0.8429 -0.1998 0.2947 0.5542 0.6243 -0.0412 -0.2190 0.7598 0.5115 0.0830 -0.1323 0.0502 -0.1575 0.0048 -0.2478 -1.0178 -0.3760 0.2751 -0.3075 0.3428 -0.2514 0.8548 0.1059 0.1994 -0.3067 0.8461 -0.3274 0.3301 -0.3298 0.0451 0.4353 -0.0977 -0.1591 -0.1727 0.6325 0.3180 0.3057 -0.9047 0.2423 0.2628 -0.1046 0.1461 -0.8096 0.0429 -0.2414 -0.1238 -0.0510 -0.4527 -0.1203 0.3277 -0.2503 0.3682 0.0023 0.0945 -0.2517 -0.0081 0.3406 -0.1456 -0.1727 -0.0194 0.0315 -0.0329 -0.1745 0.1618 0.0948 -0.2858 -0.5644 -0.1722 -0.1826 0.2428 0.2645 -0.2532 -0.1553 -0.2748 0.3206 -1.6444 -0.0329 -0.1745 0.1618 0.0948 -0.2858 -0.5644 -0.1722 -0.1826 0.2428 0.2645 -0.2532 -0.1553 -0.2748 0.3206 -1.6444 0.2170 -0.0518 0.0102 0.2306 -0.0825 0.2340 0.1658 -0.2103 0.0192 0.1190 -0.1514 -0.0542 -0.0824 -0.2726 0.1897 -0.2632 -0.1359 0.1845 0.0081 0.0578 0.0481 0.1846 0.0972 -0.1930 -0.1829 -0.1532 0.0572 0.0157 -0.1057 -0.0861 -0.0106 -0.0378 -0.2134 -0.1817 0.1889 -0.0030 0.2783 -0.0759 -0.2472 -0.2186 -0.0489 -0.1175 -0.1361 -0.3169 -0.1754 -0.1084 0.4025 0.0977 0.1994 -0.1682 -0.0087 0.1891 -0.1377 -0.2014 0.0189 -0.1421 -0.0638 -0.0104 -0.1830 0.0141 0.0779 -0.0073 -0.0178 0.2208 0.0973 -0.0945 -0.2136 -0.0138 0.0272 0.4627 -0.2670 0.1497 0.3280 -0.4544 0.0375 -0.1644 -0.2102 0.1564 -0.0430 -0.1492 0.2725 -0.2015 0.2201 -0.2000 0.0127 0.0997 -0.4406 -0.7011 0.0329 0.0592 0.2712 -0.1635 0.1494 0.2668 -0.4333 0.0192 -0.1075 -0.1559 0.2322 0.0062 -0.1536 0.1151 -0.2700 0.1887 0.0111 0.2600 -0.0435 -0.3953 -0.2159 -0.1596 0.1213 0.4473 -0.3421 0.0224 0.0368 -0.0442 -0.0044 -0.2390 -0.4105 0.0091 -0.0570 0.0494 0.0258 -0.0680 -0.0235 -0.0281 -0.0822 0.1037 -0.2443 -0.1717 -0.2010 0.1743 0.2179 -0.2265 -0.0285 -0.0799 -0.2793 0.0998 -0.1807 -0.1554 -0.0286 -0.0519 0.0183 0.0669 0.0851 0.0322 -0.1535 0.0334 0.0477 -0.1478 -0.0417 -0.1606 0.1004 0.0532 0.0125 0.0180 0.0182 -0.2685 -0.1105 -0.2098 -0.3843 0.1245 -0.2186 -0.3306 0.1040 0.0718 0.2035 -0.2585 -0.1497 0.2087 -0.3396 -0.0095 -0.1160 0.2789 -0.2281 -0.6135 -0.0356 -0.6103 -0.4680 0.3528 -0.0379 0.0190 0.0779 0.1534 -0.1417 -0.1217 -0.1257 0.0482 0.1620 -0.2095 0.0570 -0.0902 -0.1304 0.0683 -1.5628 -0.0379 0.0190 0.0779 0.1534 -0.1417 -0.1217 -0.1257 0.0482 0.1620 -0.2095 0.0570 -0.0902 -0.1304 0.0683 -1.5628 -0.0891 0.0613 0.0409 -0.1451 -0.2219 0.2499 -0.1984 -0.1697 0.0378 0.2416 -0.0090 -0.1652 -0.2125 -0.0138 0.0133 -0.0823 -0.1236 -0.0307 -0.0446 0.0161 -0.0051 0.0815 0.0440 -0.0957 -0.1066 0.0798 0.1355 0.0062 -0.0150 -0.0309 0.0368 -0.1161 -0.1725 -0.0581 0.0572 0.0430 0.0005 0.0953 -0.0628 -0.0716 0.0054 -0.0176 -0.1085 -0.0018 -0.0556 -0.0777 0.0373 0.0521 0.0684 -0.0490 -0.0129 0.1755 -0.2486 -0.0390 -0.0731 -0.0645 0.0000 -0.0836 -0.1065 -0.0331 -0.0802 -0.0053 -0.0615 0.1442 0.0049 -0.0490 -0.0274 0.1024 0.0852 0.1842 -0.1195 0.1263 0.2744 -0.1917 -0.0675 -0.1159 -0.1497 0.0944 -0.2292 -0.1222 0.1088 -0.0241 0.0594 -0.0978 0.1226 0.1283 -0.1454 -0.2637 -0.0474 -0.0492 -0.0573 -0.0068 0.0662 0.1054 0.0274 0.0058 -0.0440 -0.0613 0.0328 -0.0703 -0.1678 -0.0316 -0.1970 0.0265 -0.0963 0.0762 -0.0783 -0.2312 -0.0762 -0.0127 0.0414 0.0085 -0.0167 0.0585 -0.0012 -0.1233 0.1437 -0.0694 -0.0859 -0.0036 -0.1199 -0.0296 0.0783 -0.0185 -0.0503 -0.0499 -0.0055 0.0860 -0.0783 -0.1401 0.0055 0.0017 0.0741 -0.1293 0.0340 -0.0130 -0.2556 -0.0873 -0.2015 -0.0543 -0.0255 0.0189 -0.0427 0.1081 -0.0918 0.0873 -0.1699 -0.0278 -0.0573 -0.0746 -0.0359 0.0077 0.0612 0.0307 -0.1901 0.0232 0.1397 -0.1822 -0.0539 -0.1327 -0.0682 0.0933 -0.1990 -0.1368 0.0318 -0.0883 0.0304 -0.0918 0.0608 0.1205 -0.1519 -0.0676 -0.1627 0.1951 -0.2634 -0.2697 -0.2588 -0.4253 -0.2762 0.0144 0.1415 -0.0129 -0.2337 -0.2731 -0.0022 -0.1256 -0.0145 -0.0553 -0.0787 0.0024 -0.0526 -0.0222 0.0065 0.0384 -0.5715 0.1415 -0.0129 -0.2337 -0.2731 -0.0022 -0.1256 -0.0145 -0.0553 -0.0787 0.0024 -0.0526 -0.0222 0.0065 0.0384 -0.5715 0.0076 -0.0972 0.0879 -0.0690 0.0342 -0.0600 0.0278 0.0645 -0.1427 -0.2531 0.0840 -0.0477 -0.0252 0.0309 -0.2047 -0.0320 -0.0207 -0.0614 0.1281 -0.1501 0.1884 -0.0515 -0.0374 0.1124 -0.0284 -0.0450 -0.1294 -0.1227 0.0749 -0.0707 0.1193 0.0210 0.0668 -0.0449 0.0009 0.0720 0.0466 -0.1000 0.0424 0.1099 -0.0524 0.1138 -0.1671 -0.1510 0.1340 -0.1209 0.0465 -0.0697 -0.1871 0.0256 -0.1863 -0.0740 0.1062 -0.3320 -0.0149 -0.1224 -0.0364 0.1175 -0.0111 -0.0845 0.1197 0.1699 0.1527 -0.1677 0.0089 0.0383 0.1269 -0.0839 -0.0952 -0.2481 -0.0643 -0.2311 0.0982 0.1329 -0.1852 -0.0907 -0.0535 0.0331 -0.0932 0.0273 -0.2579 0.0452 -0.0330 0.2883 -0.0586 -0.2022 0.1780 0.1440 -0.1257 -0.0560 -0.0884 0.0637 0.0789 -0.1859 0.0682 -0.2487 0.0986 -0.0371 -0.2926 0.0355 0.1111 0.2214 0.0687 0.0138 0.1890 -0.0347 -0.0948 0.1636 -0.0942 -0.0478 0.0225 0.0531 -0.0478 -0.1445 -0.1162 0.1521 0.0251 0.0215 0.0771 -0.0408 -0.0127 0.0104 -0.0607 -0.0097 -0.0396 -0.0494 0.0613 0.0205 -0.0142 -0.0858 -0.0304 -0.0030 -0.0566 0.1298 0.0890 -0.0195 0.1280 -0.2187 -0.0293 0.0262 -0.1692 -0.0821 -0.0437 0.0581 0.0683 -0.0033 -0.1076 0.0306 -0.0191 0.1475 0.0665 0.0194 -0.0655 -0.0551 -0.0602 0.0450 -0.0260 0.0475 0.0225 -0.0114 -0.0160 0.0239 0.0183 0.0363 -0.1380 0.0211 -0.2116 0.1799 -0.0635 -0.1662 0.0098 -0.0509 0.1248 -0.1489 -0.3070 0.1223 -0.0581 -0.1730 0.1266 -0.0742 -0.2203 0.1187 -0.0629 0.0625 0.0924 -0.2621 -0.1211 0.0210 0.0366 -0.2196 0.1364 -0.1324 -0.1454 -0.0399 -1.5800 -0.2203 0.1187 -0.0629 0.0625 0.0924 -0.2621 -0.1211 0.0210 0.0366 -0.2196 0.1364 -0.1324 -0.1454 -0.0399 -1.5800 -0.0135 -0.1319 0.0230 0.0335 -0.0745 0.1895 -0.1391 -0.0447 -0.0095 0.0235 -0.1636 -0.1507 -0.0590 0.0043 0.0293 -0.0312 -0.1236 -0.0637 0.0131 0.1026 -0.1081 -0.0114 -0.1030 -0.1033 -0.0216 -0.0149 0.0603 -0.1722 -0.1363 0.0222 0.0608 0.0454 0.0124 -0.0921 -0.0906 -0.0130 0.0284 -0.1605 -0.0756 -0.0032 -0.0115 -0.0039 0.0201 -0.1394 0.0360 -0.1060 -0.0470 0.0799 -0.0051 -0.0928 -0.0189 0.0268 -0.0200 0.1414 -0.0059 0.0411 -0.0646 -0.0251 -0.0093 -0.0223 -0.0467 -0.0644 -0.0332 -0.0118 -0.0725 -0.0750 -0.0700 -0.0088 -0.0656 0.0511 -0.0374 0.1130 0.1162 -0.1559 -0.0385 -0.0688 -0.0955 0.0319 -0.0536 -0.0241 0.0073 -0.0800 0.0706 -0.1091 0.0395 0.0607 -0.2394 -0.2609 -0.0888 -0.0707 -0.0365 -0.1183 0.0227 0.1102 -0.1178 -0.0522 -0.1166 -0.0799 0.0108 -0.1843 -0.0429 -0.0085 -0.1458 -0.0011 -0.0937 0.0223 -0.0525 -0.0206 -0.0526 -0.1219 -0.0745 0.0257 -0.1209 -0.0855 -0.0353 0.0575 -0.0105 -0.0028 -0.0848 -0.0423 -0.2030 -0.1502 0.0047 -0.0427 -0.0688 -0.1658 -0.1491 -0.0299 -0.1450 -0.0851 -0.1872 0.0322 -0.1692 -0.0362 -0.0141 -0.1031 -0.0229 -0.0434 -0.0374 -0.0343 0.0197 -0.0650 0.0477 0.0544 -0.0280 -0.0916 -0.0518 0.0571 -0.0652 -0.1424 -0.0079 -0.0132 -0.0126 -0.0708 0.0367 -0.0480 -0.0251 -0.0863 -0.1205 -0.0868 -0.0320 -0.0318 -0.0694 -0.0560 -0.0406 -0.0479 0.0645 -0.0640 -0.0689 0.0206 -0.1537 0.1067 -0.1326 0.0593 -0.1892 -0.4944 -0.1398 -0.2944 -0.3512 -0.0908 0.0028 0.0374 -0.0354 0.0207 -0.1353 0.0378 -0.0063 -0.1542 -0.0920 -0.1321 0.0030 -0.1361 0.0080 -0.1069 -0.8893 0.0028 0.0374 -0.0354 0.0207 -0.1353 0.0378 -0.0063 -0.1542 -0.0920 -0.1321 0.0030 -0.1361 0.0080 -0.1069 -0.8893 -0.0445 0.0217 0.0116 -0.1177 -0.0238 0.0430 -0.1243 0.0022 0.0077 0.0602 0.0512 -0.0176 -0.0516 -0.1188 0.0317 0.0072 -0.0408 -0.0807 -0.0459 0.0864 -0.0038 0.0036 -0.1084 -0.0113 -0.0218 0.0201 0.0842 0.0209 -0.0990 -0.1040 0.0928 0.0385 -0.0882 -0.0915 0.0033 -0.0089 -0.1165 -0.0128 -0.0667 -0.1105 0.0766 -0.0340 0.0505 0.0399 -0.0063 0.0400 0.0207 0.0298 -0.1175 0.0604 0.0850 0.0938 0.0589 -0.1058 -0.0522 0.0451 -0.0450 0.0406 -0.1276 0.0217 -0.0311 0.0250 0.0465 -0.0039 -0.0108 0.0578 -0.0698 -0.0417 0.0220 -0.1464 -0.0706 0.0529 0.0399 -0.0777 -0.0386 -0.0426 0.0125 0.1488 -0.0374 -0.0953 -0.1168 0.0000 0.0407 -0.0661 -0.0037 -0.0190 -0.0566 -0.0748 -0.0773 0.0727 -0.0732 -0.0731 -0.0847 -0.0808 -0.0548 -0.1240 -0.0936 -0.0235 -0.0424 -0.0072 -0.1237 -0.0987 -0.0917 0.0374 -0.0574 -0.1061 -0.0993 0.0514 -0.0972 0.0252 0.0180 -0.1124 -0.0412 -0.0300 0.0300 0.0243 -0.0599 -0.0661 -0.0663 -0.0320 -0.0495 -0.1210 -0.0111 -0.0916 -0.0574 -0.0393 -0.1224 0.0581 -0.1049 -0.0726 -0.1056 0.0333 -0.1257 -0.1199 0.0151 -0.0794 0.0397 -0.0420 0.0713 -0.1233 -0.0406 -0.1351 -0.0403 -0.1107 -0.0570 -0.0201 -0.1140 -0.0851 0.0283 0.0358 -0.0038 -0.1070 0.1248 -0.0172 -0.0657 -0.0596 -0.0748 -0.0233 0.0332 0.0163 0.0340 -0.0449 -0.0186 0.0564 0.0253 0.0410 -0.0957 0.0035 0.0737 -0.0342 0.0126 -0.1253 -0.1370 -0.0287 -0.2061 -0.1101 -0.2051 -0.2719 -0.1440 -0.0581 -0.2024 0.0355 -0.0511 0.0490 -0.0580 -0.4662 -0.1106 0.1450 0.1248 0.0192 -0.2708 -0.3215 -0.0971 0.1919 -1.6089 -0.2024 0.0355 -0.0511 0.0490 -0.0580 -0.4662 -0.1106 0.1450 0.1248 0.0192 -0.2708 -0.3215 -0.0971 0.1919 -1.6089 -0.0651 0.0380 -0.0585 0.0605 0.0295 0.2441 0.1039 -0.2386 0.0490 0.2182 -0.2960 -0.0660 -0.0733 -0.0646 0.0594 -0.1109 -0.1755 0.0862 -0.0043 0.0204 0.0920 0.2216 0.0881 -0.1253 -0.1743 -0.0977 0.0140 -0.0987 -0.0089 -0.0529 -0.0369 -0.1154 -0.1004 -0.0935 0.1997 -0.0204 0.1050 -0.0772 -0.1422 -0.1806 -0.0771 -0.1191 -0.1973 -0.2666 -0.0330 -0.0544 0.1141 0.1709 0.1394 -0.2610 -0.0102 0.0902 -0.2157 -0.2073 -0.0124 0.0187 -0.0266 -0.0518 -0.1949 -0.0786 -0.0918 0.0433 0.0169 0.0185 0.1075 -0.2044 -0.1976 0.0664 0.0345 0.1600 -0.3366 0.1194 0.3747 -0.3352 -0.0680 -0.1316 -0.2823 0.1134 -0.2464 -0.0363 0.0641 -0.0396 0.0268 -0.1231 0.1126 0.0444 -0.3310 -0.3629 0.0940 0.0338 0.0314 -0.2295 0.0673 0.1556 -0.2229 0.0248 -0.0947 -0.0523 0.1613 -0.0007 -0.0637 0.0262 -0.2467 0.0877 -0.1986 0.1084 -0.1542 -0.2574 -0.1070 -0.1454 0.1708 -0.0107 -0.2562 0.0268 0.0547 0.0262 0.0417 -0.1836 -0.1950 0.0763 -0.0829 -0.1571 0.0460 0.0332 -0.0473 -0.1126 0.0227 0.0481 -0.0843 -0.1148 -0.0565 0.1021 0.0795 -0.3237 0.1043 0.0572 -0.2890 0.0637 -0.2039 0.0086 0.0778 -0.0281 0.0021 -0.0477 -0.0090 -0.0398 -0.1641 -0.0535 -0.0363 -0.1404 -0.1081 -0.0638 0.1246 -0.1216 -0.1246 0.0357 0.0532 -0.1454 -0.1122 -0.0611 -0.2277 0.0156 -0.2546 -0.1777 0.0248 -0.0975 0.1820 -0.2098 -0.0129 0.0558 -0.1682 -0.2341 -0.0487 0.3317 -0.1404 -0.3121 -0.4777 -0.3943 -0.1141 -0.0096 -0.2069 -0.4400 0.2438 0.1891 -0.4740 -0.4944 0.0793 -0.0792 0.5670 0.1087 -0.0019 -0.0256 -0.2132 0.0503 -1.1994 -0.2069 -0.4400 0.2438 0.1891 -0.4740 -0.4944 0.0793 -0.0792 0.5670 0.1087 -0.0019 -0.0256 -0.2132 0.0503 -1.1994 0.0221 0.0220 -0.0844 0.1794 -0.1657 0.2376 0.0669 -0.2607 -0.1166 0.4586 0.0029 -0.2172 -0.2298 -0.1504 0.2243 -0.0348 -0.3393 0.1788 -0.0236 0.1614 -0.1992 0.1763 -0.1950 -0.1755 -0.0656 -0.0462 -0.0236 0.1250 -0.0951 0.0233 0.1052 -0.1625 -0.3535 -0.2127 0.1138 0.0529 0.1322 -0.0396 -0.0946 -0.1631 -0.0941 -0.0050 -0.0290 -0.2616 -0.1278 -0.0379 0.0794 0.1887 0.2293 -0.0247 0.0120 0.1187 -0.0650 -0.1685 -0.1066 -0.1237 -0.0079 0.2769 -0.3435 -0.0537 0.0881 -0.0545 -0.0932 0.1437 0.0216 -0.2421 -0.1191 0.1259 0.0453 0.4705 -0.2429 0.1680 0.5046 -0.4742 -0.0366 -0.1068 -0.2613 0.3838 -0.0722 -0.1848 0.1652 -0.1085 0.2246 -0.0242 -0.0231 0.1057 -0.4547 -0.5040 0.0524 -0.0069 0.2295 -0.2550 0.2051 0.3082 -0.4183 0.0680 -0.0179 -0.2046 0.2045 0.0338 -0.0699 0.0699 -0.3108 0.1614 -0.1474 0.2495 -0.1066 -0.4443 -0.1849 -0.2162 0.1004 0.1484 -0.1602 -0.0057 -0.0002 -0.1963 0.0668 -0.1497 -0.2917 0.0321 0.3501 -0.1882 -0.0567 -0.0752 -0.0446 -0.1149 -0.1062 0.0414 -0.2389 -0.2664 -0.0641 0.2262 0.0929 -0.1603 0.0811 -0.0210 -0.1912 0.0616 -0.2113 -0.1713 0.1156 -0.0463 -0.2676 0.0945 0.1611 0.1669 -0.1104 0.0501 0.1881 -0.3002 -0.0890 -0.1830 0.2449 0.1349 -0.1291 0.0740 0.1743 -0.1049 -0.0699 -0.0305 -0.1680 0.1977 -0.2497 -0.1709 0.0910 0.1846 0.0992 -0.1640 -0.0880 0.0972 -0.2555 -0.1343 -0.0245 0.4521 0.0590 -0.7858 -0.1693 -0.2924 -0.7037 0.4085 -0.3159 0.0809 0.6366 -0.3928 -0.1327 -0.3489 -0.0683 -0.0333 -0.2006 -0.1950 -0.1550 -0.2330 0.2256 -0.0919 -1.0187 -0.3159 0.0809 0.6366 -0.3928 -0.1327 -0.3489 -0.0683 -0.0333 -0.2006 -0.1950 -0.1550 -0.2330 0.2256 -0.0919 -1.0187 -0.0601 -0.1834 -0.0616 0.1457 -0.1535 -0.2492 0.1576 0.2458 0.0239 -0.5533 0.0524 0.0856 0.1422 -0.1458 -0.1512 -0.1434 0.1137 -0.1179 0.2026 -0.1014 0.0565 -0.2213 -0.0496 0.1899 0.1116 -0.0936 -0.0425 -0.2006 0.3152 0.0511 -0.1128 0.0500 -0.1255 0.0220 0.1906 -0.5571 0.3273 0.0953 -0.0486 -0.3213 -0.1291 -0.1179 0.0092 -0.2060 0.1555 0.0625 0.2071 -0.1579 -0.1604 0.1308 0.6196 -0.1045 0.2563 -0.3488 -0.0038 0.1801 -0.2441 0.3090 -0.0871 0.1098 -0.6202 -0.1452 -0.2080 0.0629 -0.1235 0.0612 0.0994 0.1460 -0.1285 -0.0104 0.1530 -0.5492 -0.3295 0.3028 -0.2465 -0.2753 0.0766 0.2466 0.0441 -0.0710 0.0373 -0.5388 -0.0315 0.1133 0.0648 0.2435 0.1171 0.2322 0.1246 -0.0622 -0.2970 0.2021 -1.0826 0.0814 0.1597 0.0349 0.1478 -0.1768 0.6327 0.0465 -0.0349 -0.3616 -0.1907 -0.0940 0.5532 -0.2719 -0.1647 0.0483 0.1461 -0.0834 0.0122 0.3332 0.2628 -0.1892 0.2581 -0.0172 0.0648 -0.0555 0.0073 -0.7343 -0.0574 0.0210 -0.0098 -0.3920 0.1619 0.0995 -0.1827 0.0181 0.1310 0.0071 -0.0210 -0.1128 -0.0861 0.1460 0.1252 -0.4522 0.0832 -0.5278 0.0660 0.1478 -0.3382 -0.1891 0.1889 -0.1683 0.1345 0.1940 0.3589 -0.1079 0.0472 0.0670 0.0856 -0.2491 -0.1009 -0.0714 0.0303 0.0574 -0.3847 0.1119 -0.2768 0.1867 -0.0578 0.2238 -0.1996 0.1411 -0.1997 -0.0331 0.0804 -0.1115 -0.0178 0.0377 0.0255 0.2530 -0.0960 -0.4190 -0.1549 0.5576 -0.8715 0.4316 0.3932 -1.2478 -0.1429 0.0728 0.2240 -0.0778 -0.2586 -0.3739 -0.0016 0.1881 0.0955 0.1454 -0.2192 -0.4829 -0.0524 -0.0797 -0.4205 -0.1429 0.0728 0.2240 -0.0778 -0.2586 -0.3739 -0.0016 0.1881 0.0955 0.1454 -0.2192 -0.4829 -0.0524 -0.0797 -0.4205 -0.0155 0.0412 -0.1657 0.1924 0.0716 -0.3896 0.4292 0.0765 0.1427 -0.6080 0.3136 -0.0287 -0.0146 0.2308 -0.4949 -0.1180 0.0094 -0.2251 0.2413 -0.1546 -0.1055 -0.0824 -0.0355 0.1498 0.0026 0.2457 -0.2211 -0.0525 0.1076 -0.1276 -1.3590 0.2406 0.0606 0.0930 0.2361 -0.1304 0.2983 -0.0061 0.0469 -0.3153 -0.1964 -0.1753 0.3489 0.0722 0.3153 0.0909 0.1563 -0.1242 -0.0477 0.0587 -0.6827 1.2779 0.2835 0.3416 0.0447 0.1531 -1.2889 0.0278 0.0247 -0.2060 0.3975 0.2365 -0.4832 -0.2997 -0.1297 0.0538 0.1189 0.0685 -0.0715 -0.3529 -0.0970 0.0631 0.0596 0.2537 -0.5798 0.0872 0.4045 -0.7465 0.2725 -0.0343 -0.3215 0.6052 0.2464 -0.4113 -0.2476 -0.1482 -0.0103 0.1544 0.3753 -0.0532 -0.0654 0.0369 -1.7867 1.2826 -0.0922 0.8069 0.0893 -0.0638 -0.4490 -0.1635 0.0229 -0.1653 -0.0333 0.3397 -0.0618 0.3724 0.4514 -0.1927 -0.1470 0.0976 -0.1932 0.0275 0.0635 -0.2181 -0.5819 0.2311 0.2488 0.1948 -0.2596 0.4451 -0.5098 -0.0013 -0.2003 0.8984 -0.1655 -0.0120 -0.1075 0.1676 0.1787 -0.1502 -0.2497 -0.2070 0.5319 0.1784 -0.3409 -0.3526 0.2193 0.3714 -0.0412 -0.0026 -0.8196 -0.1837 0.0024 -0.2660 0.4841 0.0487 -0.2120 0.2442 0.2912 0.1845 -0.1150 -0.0139 -0.3848 -0.0814 0.0653 0.1625 0.0979 0.2303 -0.5300 0.1315 -0.2826 -0.1780 -0.1440 -0.0126 -0.0050 0.1454 -0.0331 0.1474 0.1818 0.1361 -0.0652 0.1094 0.1405 -0.4353 -0.1997 0.5330 -0.1385 0.1080 0.0556 -0.3928 -0.4106 0.1468 -0.0250 0.1007 -0.3484 -0.5130 -0.1470 0.4649 0.1834 0.4159 -0.0777 -0.3946 0.0073 -0.1461 -1.4743 -0.4106 0.1468 -0.0250 0.1007 -0.3484 -0.5130 -0.1470 0.4649 0.1834 0.4159 -0.0777 -0.3946 0.0073 -0.1461 -1.4743 -0.1179 0.0502 0.0200 0.1607 -0.1923 0.1634 -0.2657 -0.2743 -0.2260 0.3014 0.0838 -0.0438 -0.1335 -0.1144 0.0620 -0.3772 -0.0226 0.0456 -0.0903 -0.0421 -0.0383 -0.0795 0.0775 -0.1077 -0.1484 0.0356 0.1590 -0.1937 0.0131 0.0428 -0.0801 0.1110 0.1093 -0.2234 0.1664 -0.0385 -0.0725 0.2778 -0.0772 -0.2406 -0.1181 -0.1212 -0.1018 -0.1680 -0.0548 -0.0495 -0.0839 -0.0232 -0.1154 -0.1029 0.0096 0.0382 0.0176 0.0414 -0.0860 -0.1135 -0.1168 -0.1345 0.0540 0.0634 0.0761 0.0478 -0.1089 0.1767 0.1198 0.0422 -0.1589 -0.1113 -0.1332 0.1798 -0.1380 0.0282 0.0710 -0.1525 -0.0871 -0.0758 -0.1475 0.0443 -0.1300 -0.0729 0.0413 0.0648 -0.0043 -0.3018 0.0255 0.0397 -0.0997 -0.0736 -0.1784 -0.0033 -0.1760 0.1466 0.0221 0.0885 -0.1059 -0.0136 -0.0424 -0.0941 -0.0551 -0.1421 0.0151 -0.0414 0.0034 -0.0175 -0.1767 0.0743 -0.1710 -0.2343 0.0966 -0.1283 -0.0420 -0.0389 0.0347 0.0076 0.1037 0.1117 0.0210 -0.0007 -0.1964 -0.0226 0.0107 -0.1210 0.0376 0.0019 -0.2032 -0.1573 -0.1188 0.0523 -0.0043 -0.0555 -0.1726 -0.0304 -0.0035 -0.0559 0.0041 -0.0263 -0.2658 0.0080 -0.0840 -0.1900 0.0314 -0.1810 -0.0829 0.0652 -0.0677 -0.0287 -0.2005 0.0407 -0.0640 -0.1532 0.1444 0.0433 -0.0906 -0.0781 0.0361 0.0168 -0.0327 0.0581 0.0760 -0.1534 0.0507 -0.0540 -0.1162 -0.1883 -0.0527 -0.1076 0.1481 -0.1612 -0.2088 0.0847 -0.1347 -0.1334 0.1006 -0.0407 -0.1962 -0.3649 -0.0413 -0.2447 -0.3475 -0.0789 0.3473 -0.4213 0.2688 -0.1256 -0.0545 0.1641 0.2891 -0.6113 -0.0899 -0.4400 -0.0901 0.7050 -0.1246 -0.7008 -0.4523 0.3473 -0.4213 0.2688 -0.1256 -0.0545 0.1641 0.2891 -0.6113 -0.0899 -0.4400 -0.0901 0.7050 -0.1246 -0.7008 -0.4523 0.1087 -0.1031 -0.0759 -0.2068 0.1683 -0.8695 0.2886 0.1491 0.4144 0.1162 -0.5507 0.1991 -0.0255 0.8600 -0.7505 -0.8483 0.2099 0.7640 0.1795 -0.9251 0.2873 0.1985 -0.0133 -0.0612 -0.2346 -0.2542 -0.1390 0.0464 0.1205 -0.1335 0.4102 -0.3422 -0.3551 0.5091 0.4108 -1.0350 -0.3843 0.2185 -0.4672 0.9879 -0.1110 0.4386 -0.2029 -0.4679 0.2788 -0.5176 0.2141 0.2554 0.3823 0.2648 1.3746 -3.0948 0.2670 0.0128 0.1669 0.8581 -2.9396 -0.3249 0.1699 0.7648 0.6107 -0.1064 0.0831 0.6443 0.1628 0.1001 -0.0793 0.2290 -0.0032 -0.5651 -0.0341 3.3371 -1.9857 -0.0943 -1.2306 0.1363 0.5100 0.7138 0.1028 0.3268 -0.2289 -0.2699 -1.0821 0.8544 -0.7165 -0.4901 0.4552 0.1893 0.0836 0.0853 0.5072 0.1978 -1.1816 -2.1238 -0.1845 0.6747 0.9246 0.1568 -2.2737 0.1076 0.0107 0.7156 0.9575 0.0664 -0.4500 0.8752 0.2239 0.2803 -0.0395 0.3128 -0.2679 0.1192 0.0220 -0.1515 0.7489 0.1528 0.8950 -0.1340 0.0350 -1.3331 0.1893 -0.3894 0.4523 0.8388 -0.6963 -0.1358 -0.5085 -0.5289 0.4144 -0.0568 0.2611 -0.3525 0.1436 -0.3641 -0.4197 0.2015 0.0171 0.6028 0.0502 0.2785 -0.8235 -0.0199 0.0744 0.9525 0.1321 -0.7998 0.1215 -0.0879 0.1483 0.1390 0.2346 0.3924 -0.6159 0.2575 -0.3532 0.2881 -0.1338 0.2622 0.2061 0.2137 0.0191 -0.0252 -0.1328 0.2598 -0.0522 0.6717 -0.2826 0.0298 0.0201 -0.1418 -0.1478 0.0571 0.0547 -0.8129 -0.3693 0.1627 0.4449 -0.1070 -0.2518 0.0672 0.1414 -0.1309 -0.1513 0.3471 0.4742 0.0083 -0.1574 -0.8787 -0.0837 0.8136 -0.2107 -0.4538 0.3452 0.2780 -1.5052 0.1414 -0.1309 -0.1513 0.3471 0.4742 0.0083 -0.1574 -0.8787 -0.0837 0.8136 -0.2107 -0.4538 0.3452 0.2780 -1.5052 0.1332 0.3058 0.0451 -0.7761 0.0704 0.1064 0.1788 -0.7301 0.0136 0.2107 -0.1009 0.2365 -0.3143 -0.6933 0.2514 -0.3905 -0.0106 -0.0985 -0.2139 0.2040 0.1310 0.2466 0.2645 -0.0509 -0.6605 0.2607 0.0984 -0.1747 -0.4187 0.1218 0.1133 -0.6657 -0.0518 0.0272 -0.2035 0.1248 -0.2601 0.0158 0.0264 0.0475 0.0392 0.0551 -0.0760 0.1085 -0.1354 -0.2348 0.7706 0.0501 0.3524 -0.4701 -0.0338 0.5588 -0.6214 -0.1792 -0.0936 0.0096 -0.1448 -0.5248 -0.0786 0.2081 -0.1273 -0.0590 0.1425 0.1823 -0.0710 -0.3647 -0.1969 0.5411 -0.0490 0.5436 -0.3417 0.1318 0.3860 -0.6760 0.2282 -0.2551 -0.2266 -0.1383 -0.3394 0.0569 0.2155 -0.1002 -0.0021 0.0350 0.1849 0.0436 -0.4780 -0.4557 0.5791 -0.0682 -0.0351 -0.5934 0.1935 0.3232 -0.4803 0.2505 -0.1357 -0.2768 0.0653 -0.0559 -0.1117 0.0968 -0.2739 0.0347 0.0310 0.4496 -0.2586 -0.3991 -0.0696 0.4587 0.2287 0.1631 -0.5244 0.1161 0.1634 -0.4944 0.0546 -0.4851 -0.3512 0.1857 0.0057 0.1638 0.2991 -0.0009 0.0182 0.0660 0.0713 -0.1980 -0.4491 0.0531 0.3612 0.3705 0.4615 -0.6269 0.3738 0.2384 -0.4733 -0.0020 -0.4041 -0.5741 0.0489 0.0317 0.1341 -0.0563 -0.0804 0.1552 -0.1738 0.1577 -0.2018 -0.1664 -0.0536 0.5609 0.2367 0.3364 -0.5576 0.3100 0.1230 -0.1246 0.1208 -0.3186 -0.6524 0.0167 0.1797 -0.0143 -0.1005 -0.2650 0.0653 -0.1256 -0.0818 0.0910 -0.2708 0.0051 0.5304 -0.1911 -0.7702 0.5453 -0.3500 -1.1934 0.7800 0.2219 -0.0766 -0.1773 0.0115 0.0144 -0.0301 -0.1451 -0.0315 -0.1370 0.0803 -0.0550 -0.0654 -0.1228 -0.0016 -0.0028 -1.5122 -0.0766 -0.1773 0.0115 0.0144 -0.0301 -0.1451 -0.0315 -0.1370 0.0803 -0.0550 -0.0654 -0.1228 -0.0016 -0.0028 -1.5122 -0.0598 -0.0537 -0.1025 -0.0680 -0.0141 0.1735 -0.0556 -0.1637 0.0523 0.0713 -0.0388 -0.1596 -0.0414 -0.1228 -0.0550 -0.0776 -0.1283 -0.0973 -0.1078 -0.0058 0.0089 0.0637 0.0700 -0.0541 -0.1248 0.0579 -0.0282 0.0383 -0.1571 0.0400 -0.0285 -0.0118 -0.1476 -0.1150 0.0709 -0.0159 -0.0779 -0.0072 -0.0214 -0.0159 0.0010 -0.0642 -0.0176 -0.0364 0.0401 -0.0753 -0.1421 0.1348 -0.0947 0.0255 -0.0680 0.0200 -0.0368 -0.1065 -0.1349 0.0428 0.0053 0.0068 -0.1039 -0.0955 -0.1277 -0.0440 -0.1173 -0.0148 -0.0097 -0.0910 -0.1072 -0.1012 -0.0189 -0.0133 0.0027 0.0984 0.1538 -0.1521 -0.0514 -0.0996 -0.1437 0.0823 -0.0837 -0.1170 0.0546 -0.0076 -0.0115 -0.1066 0.0966 -0.0308 -0.2246 -0.1464 0.0132 -0.0365 0.0173 -0.0427 0.0600 0.1309 -0.1201 0.0338 -0.0586 -0.0834 0.0147 -0.0350 -0.0509 0.0437 -0.1512 -0.0337 -0.1372 -0.0235 -0.0204 -0.0490 -0.1542 -0.1193 0.0846 -0.0917 -0.0857 0.0563 0.0447 0.0180 -0.0166 -0.1363 -0.0092 -0.0028 0.0330 -0.1064 -0.0015 -0.0560 -0.0604 -0.0283 0.0116 -0.0005 -0.0637 -0.0135 -0.0065 0.1065 0.0556 -0.0663 -0.0121 0.0000 -0.0745 -0.0830 -0.0163 -0.1125 0.0159 -0.0656 0.0397 -0.0829 -0.1113 -0.0878 -0.0463 0.0036 -0.1123 -0.0907 -0.1103 -0.0085 0.0702 -0.0953 -0.0874 0.0548 0.0668 -0.1357 -0.0485 -0.1254 -0.1299 0.0537 -0.1816 -0.1545 -0.0766 -0.0793 0.0595 -0.0165 0.0254 0.0334 -0.0005 -0.1019 -0.0917 0.0118 -0.2742 -0.2990 -0.3349 -0.3900 -0.1683 -0.1224 -0.0287 0.0118 -0.0297 0.0214 0.0389 -0.0984 -0.0983 0.0056 0.0823 -0.0768 -0.1295 -0.0172 0.0154 0.0858 -0.7291 * -------------------- * jct 2nd layer: row=numhid+1 (10F10.4), col=numout -1.4092 1.4396 2.1204 -2.2233 -1.0483 1.0642 -0.8054 0.9081 0.2410 -0.6851 -1.0695 1.0997 0.8967 -0.9042 0.1455 0.0089 0.1957 -0.1284 -1.3252 1.3580 0.8377 -1.0134 -0.3142 0.0981 0.4193 -1.0912 -0.4840 0.3969 0.0644 0.4382 0.6716 -0.1765 -0.9218 0.9197 0.9836 -1.8645 1.2674 -1.5329 -1.1994 1.2083 1.7819 -1.8585 -1.4814 1.5092 1.2137 -1.8649 0.4926 -0.4138 -0.3654 0.4821 0.4026 -0.5857 -0.0464 0.0041 0.6368 -1.2777 1.0734 -0.5856 -0.5844 0.5566 -1.1719 1.2170 0.9386 -1.3018 -1.3285 1.3470 1.5799 -1.5218 0.1499 -0.2665 0.9931 -0.9826 // profbval-1.0.22/nn_files/Makefile.am0000644015075101507510000000020011777007103014170 00000000000000pkgdatannfdir = $(pkgdatadir)/nn_files dist_pkgdatannf_DATA = $(srcdir)/jct.in dist-hook: rm -rf `find $(distdir) -name .svn` profbval-1.0.22/nn_files/Makefile.in0000644015075101507510000002664112012433130014204 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = nn_files DIST_COMMON = $(dist_pkgdatannf_DATA) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = SOURCES = DIST_SOURCES = am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(pkgdatannfdir)" DATA = $(dist_pkgdatannf_DATA) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ pkgdatannfdir = $(pkgdatadir)/nn_files dist_pkgdatannf_DATA = $(srcdir)/jct.in all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu nn_files/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu nn_files/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): install-dist_pkgdatannfDATA: $(dist_pkgdatannf_DATA) @$(NORMAL_INSTALL) @list='$(dist_pkgdatannf_DATA)'; test -n "$(pkgdatannfdir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(pkgdatannfdir)'"; \ $(MKDIR_P) "$(DESTDIR)$(pkgdatannfdir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; \ done | $(am__base_list) | \ while read files; do \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(pkgdatannfdir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(pkgdatannfdir)" || exit $$?; \ done uninstall-dist_pkgdatannfDATA: @$(NORMAL_UNINSTALL) @list='$(dist_pkgdatannf_DATA)'; test -n "$(pkgdatannfdir)" || list=; \ files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \ dir='$(DESTDIR)$(pkgdatannfdir)'; $(am__uninstall_files_from_dir) tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile $(DATA) installdirs: for dir in "$(DESTDIR)$(pkgdatannfdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dist_pkgdatannfDATA install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-dist_pkgdatannfDATA .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic dist-hook \ distclean distclean-generic distdir dvi dvi-am html html-am \ info info-am install install-am install-data install-data-am \ install-dist_pkgdatannfDATA install-dvi install-dvi-am \ install-exec install-exec-am install-html install-html-am \ install-info install-info-am install-man install-pdf \ install-pdf-am install-ps install-ps-am install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am uninstall uninstall-am \ uninstall-dist_pkgdatannfDATA dist-hook: rm -rf `find $(distdir) -name .svn` # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: profbval-1.0.22/scr/0000755015075101507510000000000012012433132011202 500000000000000profbval-1.0.22/scr/createDataFile.pl0000755015075101507510000001750011777007101014334 00000000000000#!/usr/bin/perl -w use Cwd; use File::Copy; use Carp; if (@ARGV<3) { # 0 1 2 3 4 5 6 die "\nUsage: $0 [fasta] [rdbprof] [hssp] [profbval_dir] [target_name] [temp_dir] [debug]\n"; } $file=$ARGV[0]; #fasta $file1 = $ARGV[1]; #rdbProf $hsspfil=$ARGV[2]; #hssp $bvaldir=$ARGV[3]; $fileroot=$ARGV[4]; $temp_dir=$ARGV[5]; my $dbg = $ARGV[6]; if( $dbg){ warn "fileroot=$fileroot"; } #print "### Blasting\n"; #system ("/home2/pub/molbio/blast/blastpgp -i $fasta -j 3 -d /data/blast/big -o $blastpgp "); #print "### Converting to SAF format\n"; #system ("perl /home2/pub/molbio/perl/blast2saf.pl $blastpgp maxAli=3000 eSaf=1"); #system ("mv *.saf saf/"); #print "### Converting to HSSP format\n"; #system ("/home2/rost/pub/prof/scr/copf.pl $saf hssp"); #system ("mv *.hssp hssp/"); #print "### Filtering HSSP file\n"; #system ("/home2/rost/pub/prof/scr/hssp_filter.pl $hssp red=80"); #system ("mv *.hssp hssp/"); #print "### Running PROF\n"; #system ("/home2/rost/pub/prof/prof $hsspfil"); if( $dbg ){ warn( "### DONE work on $fileroot?!" ); } $dataFile= $fileroot . ".data"; if( $dbg ){ warn "$temp_dir/$dataFile"; } open (FOUT, ">$temp_dir/$dataFile") || confess( "Line 36: can't open file $temp_dir/$dataFile $!" ); undef @res;undef @res;undef $end;undef@PREL; undef @PACC, undef @otL; undef @otE; undef @otH;undef @RI_A;$exp=0;$s=0;$v=0;$expCont=0;undef @RI_A2;undef @RI_S; undef @secC; $secC=$Helix=$Beta=$Loop=0; $lengthA=$lengthB=$lengthC=0;undef @resNum; undef @A;undef @C;undef @D;undef @E;undef @F;undef @G;undef @H;undef @I;undef @K;undef @L; undef @M;undef @N;undef @P;undef @Q;undef @R;undef @S;undef @T;undef @V;undef @W;undef @Y;undef @meida; if( $dbg ){ warn( "\ndir=$bvaldir" ); } if (!open(FILE, "$file1")) { die "cant open $file1"; } while ($line=) {####################change this loop see file arath_fr13110############## if ($line=~/^No\tAA/o){ last; } } #find the right columns @meida= split(/\t/o,$line); for ($o=0; $o) { undef @info; $line=~ s/\n//; @info=split (/\t/,$line); $resNum=$info[$NoM]; $res=$info[$AAM];$secC=$info[$PHELM];$otH=$info[$otHM]; $otE=$info[$otEM]; $otL=$info[$otLM]; $RI_S=$info[$RI_SM]; $PACC=$info[$PACCM];$RI_A=$info[$RI_AM]; $PREL=$info[$PRELM]; if ($secC eq 'E') { $Beta++;} elsif ($secC eq 'H') {$Helix++;} else {$Loop++;} if ($PREL>=5) {$exp++;} if (($resNum=~/[a-z]|A-Z]/ ) ||($otH=~/[a-z]|A-Z]/ )||($otE=~/[a-z]|A-Z]/ )||($otL=~/[a-z]|A-Z]/ )||($RI_S=~/[a-z]|A-Z]/ )||($PACC=~/[a-z]|A-Z]/ )||($RI_A=~/[a-z]|A-Z]/ )||($PREL=~/[a-z]|A-Z]/ )){ if( $dbg ){ warn( "\n*******@info\t$file*******" ); } } push (@res,$res); push (@otH,$otH); push (@otE,$otE); push (@secC,$secC); push (@otL,$otL); push (@PACC,$PACC/3);push (@RI_S,$RI_S); push (@PREL,$PREL);$RI_A2=$RI_A; push (@RI_A2,$RI_A2); $RI_A=$RI_A/9*100;push (@resNum,$resNum); use integer; $RI_A=$RI_A*1; push (@RI_A,$RI_A); no integer; } close (FILE); if( $dbg ){ for (@res) { warn( "line ".__LINE__.": $_\n" ); } } if (scalar@res<11) { die "sequence is too short"; } $exp=$exp/(scalar@PREL)*100; use integer; $expCont=$exp*1; no integer; $win=1; if (scalar@res<60) {$lengthA=100;$lengthB=0;$lengthC=0;} elsif ((scalar@res>=60) &&(scalar@res<90)) {$lengthA=50;$lengthB=50;$lengthC=0;} elsif ((scalar@res>=90) &&(scalar@res<180)) {$lengthA=0;$lengthB=100;$lengthC=0;} elsif ((scalar@res>=180) &&(scalar@res<240)) {$lengthA=0;$lengthB=50;$lengthC=50;} else {$lengthA=0;$lengthB=0;$lengthC=100;} $end=(scalar@res)-($win-1)/2; close (FILE); if (!open(FILE, "$hsspfil")) { die "nein lustig, cant open $hsspfil $!"; } loop155:while ($line=) { if ($line=~ /^## SEQUENCE PROFILE AND ENTROPY/) { last loop155; } } ; while ($line=) { if ($line=~ /^\/\/\n/) {last;} $V[$s]=substr($line, 12,4);$V[$s]=~ s/\s//g; $L[$s]=substr($line, 16,4);$L[$s]=~ s/\s//g; $I[$s]=substr($line, 20,4);$I[$s]=~ s/\s//g; $M[$s]=substr($line, 24,4);$M[$s]=~ s/\s//g; $F[$s]=substr($line, 28,4);$F[$s]=~ s/\s//g; $W[$s]=substr($line, 32,4);$W[$s]=~ s/\s//g; $Y[$s]=substr($line, 36,4);$Y[$s]=~ s/\s//g; $G[$s]=substr($line, 40,4);$G[$s]=~ s/\s//g; $A[$s]=substr($line, 44,4);$A[$s]=~ s/\s//g; $P[$s]=substr($line, 48,4);$P[$s]=~ s/\s//g; $S[$s]=substr($line, 52,4);$S[$s]=~ s/\s//g; $T[$s]=substr($line, 56,4);$T[$s]=~ s/\s//g; $C[$s]=substr($line, 60,4);$C[$s]=~ s/\s//g; $H[$s]=substr($line, 64,4);$H[$s]=~ s/\s//g; $R[$s]=substr($line, 68,4);$R[$s]=~ s/\s//g; $K[$s]=substr($line, 72,4);$K[$s]=~ s/\s//g; $Q[$s]=substr($line, 76,4);$Q[$s]=~ s/\s//g; $E[$s]=substr($line, 80,4);$E[$s]=~ s/\s//g; $N[$s]=substr($line, 84,4);$N[$s]=~ s/\s//g; $D[$s]=substr($line, 88,4);$D[$s]=~ s/\s//g; $s++; } close (FILE); $v=scalar@V; $r=scalar@res; if (scalar(@V)!=scalar@res) { die "\n$file *************** $v $r\n"; } for ($i=0;$i$end)) { undef @residue; @residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100); push (@array, @residue); } else { undef @residue; @residue=($A[$j],$C[$j],$D[$j],$E[$j],$F[$j],$G[$j],$H[$j],$I[$j],$K[$j],$L[$j],$M[$j],$N[$j],$P[$j],$Q[$j],$R[$j],$S[$j],$T[$j],$W[$j],$Y[$j],$V[$j],0); push (@array, @residue); } } return @array; } #secondary structure prediction information sub secondary { my $lower=shift; my $higher=shift; my $end= shift; my @secon; my @array; for ($j=$lower; $j<=$higher; $j++) { if (($j<0) ||($j>$end)) { undef @secon; @secon=(100,100,100); push (@array, @secon); } else { undef @secon; @secon=($otH[$j],$otE[$j],$otL[$j],); push (@array, @secon); } } return @array; } #function for solvent accessibility prediction information sub acc { my $lower=shift; my $higher=shift; my $end= shift; my @PRE; my @array; for ($j=$lower; $j<=$higher; $j++) { if (($j<0) ||($j>$end)) { undef @PRE; @PRE=(100,100); push (@array, @PRE); } else { undef @PRE; @PRE=($PREL[$j],$RI_A[$j]); push (@array, @PRE); } } return @array; } profbval-1.0.22/scr/PROFbval.pl0000755015075101507510000003672211777007101013121 00000000000000#!/usr/bin/perl -w #create the first in_test. the nodes' correspond to the amino acids in the following order: #1-A,2-C,3-D,4-E,5-f,6-g,7-h,8-i,9-k,10-l,11-M,12-n,13-p,14-q,15-r,16-s,17-t,18-w,19-y,20-v,21-z #the nodes of secondary structure are: #1-G,2-H,3-I,4-E,5-B,6-T,7-S,8-L #non strict /home/schles/work/palm-share/antigenicity/scr/jct48-R4-N35HN-209-len-expC-RI_A-term00303-ON2 (-4) #strict /home/schles/work/palm-share/antigenicity/scr/jct62-R4-N35HN-209-len-expC-RI_A-term00303-ON2 (24) # # use Cwd; use File::Copy; if (@ARGV<4) { # 0 1 2 3 4 5 6 7 die "\nUsage: $0 [fasta] [outfile] [output-window] [mode] [target_id] [profbval_homedir] [temp_dir] [debug]\n"; } undef @order; $tmp_file=$ARGV[0]; my $fout_list=$ARGV[1]; # lkajan: we now allow multiple files here separated by ',' my $mode_list=$ARGV[3]; # lkajan: we now allow multiple modes here separated by ',' $target_name=$ARGV[4]; $dir=$ARGV[5]; @arrTmp= split(/\//, $tmp_file); $file= pop @arrTmp; $win=9; $jct ="$dir/nn_files/jct.in"; $resultsdir=$ARGV[6]; $debug = $ARGV[7] || 0; #$thre=$ARGV[4]; $ON= 2;$sampIn=0; $IN=209; $all=' '; $id=$target_name; $datafile=$target_name. ".data"; if( $dbg ){ warn( "\n########counting samples #######" ); } open (F, "$ARGV[0]") || die "siyut ahhh: $!"; ; while ($line=) { $all .= $line; } $all =~ s/\s//go; my @raw_all = split (//o, $all); my @seqerrors = (); for( my $i = 0; $i < @raw_all; ++$i ) { if( $raw_all[$i] =~ /[^ABCDEFGHIJKLMNOPQRSTUVWXYZ]/o ) { push @seqerrors, "invalid amino acid code '$raw_all[$i]' at position ".( $i+1 ); } } if( @seqerrors ) { die( "Invalid input sequence: ".join( ', ', @seqerrors ) ); } $all=~s/[^ABCDEFGHIJKLMNOPQRSTUVWXYZ]//gi; @all= split (//o, $all); $sampIn= @all; # lkajan: we should complain about non-conforming characters: #die( "$all:$sampIn" ); close (F); if( $dbg ){ warn( "\n####working on $id" ); } if( $dbg ){ warn( "$sampIn samples" ); } if ($sampIn==0) {die "sequence has 0 residues??!"} $inTest="$resultsdir/$id-in_test"; $inOutTest="$resultsdir/$id-in-out-test"; if ($id=~/help/) { $idtemp=$id; $idtemp=~s/help//; $partest="$resultsdir/$idtemp-partest"; } else { $partest="$resultsdir/$id-partest"; } $testOutFile= "$resultsdir/$id-test-out"; ## name change 3/24,2008 open (FOUT, ">$inTest") || die "error0"; printf FOUT "* overall: (A,T25,I8)\nNUMIN : %3d\nNUMSAMFILE : %6d\n*",$IN,$sampIn; print FOUT "\n* samples: count (A8,I8) NEWLINE 1..NUMIN (25I6)\n"; if( $dbg ){ warn( "#####collecting all samples#######" ); } $h=1; undef @res;undef $end;undef@PREL; undef @otL; undef @otE; undef @otH;undef @RI_A;$expCon1=$expCon2=0;undef @RI_S;undef @outPut; undef @secC; $lengthA=$lengthB=$lengthC=0;undef @access; undef @A;undef @C;undef @D;undef @E;undef @F;undef @G;undef @H;undef @I;undef @K;undef @L; undef @M;undef @N;undef @P;undef @Q;undef @R;undef @S;undef @T;undef @V;undef @W;undef @Y;undef @GS;undef @RI_s;undef @RI_ns; chomp($id);undef @RI_S;undef @yes; open (FILE, "$resultsdir/$datafile") || die "tinofet $resultsdir/$datafile $!"; while ($line=) { @stuff=split(' ', $line); # $resNum=$stuff[0];\ $A=$stuff[1];$C=$stuff[2];$D=$stuff[3];$E=$stuff[4];$F=$stuff[5];$G=$stuff[6];$H=$stuff[7];$I=$stuff[8]; $K=$stuff[9];$L=$stuff[10];$M=$stuff[11];$N=$stuff[12];$P=$stuff[13];$Q=$stuff[14];$R=$stuff[15];$S=$stuff[16]; $T=$stuff[17];$W=$stuff[18];$Y=$stuff[19];$V=$stuff[20]; $otH=$stuff[22];$otE=$stuff[23];$otL=$stuff[24];$PREL=$stuff[25];$RI_A=$stuff[26]; $expCon1=$stuff[27];$expCon2=$stuff[28];$lengthA=$stuff[29];$lengthB=$stuff[30];$lengthC=$stuff[31];$outPut=$stuff[32];$res=$stuff[33]; push (@res,$res); if ($PREL>=16) {push (@access, "e");} else {push(@access, "b");} push (@A,$A) ;push (@C,$C);push (@D,$D);push (@E,$E);push (@F,$F);push(@G,$G);push(@H,$H);push(@I,$I);push(@K,$K);push(@L,$L); push (@M,$M);push(@N,$N);push(@P,$P);push(@Q,$Q);push(@R,$R);push(@S,$S);push(@T,$T);push(@V,$V);push(@W,$W);push(@Y,$Y); push (@otH,$otH);push (@outPut,$outPut); push (@otE,$otE); push (@secC,$secC); push (@otL,$otL); push (@RI_A,$RI_A); push (@Bnew,$Bnew); push (@PREL,$PREL);;$end=scalar@PREL-1; } loop4:for ($i=0;$i$inOutTest") || die "cant open file $!"; printf FOUT "* overall: (A,T25,I8)\nNUMOUT : $ON\nNUMSAMFILE :%9d\n*",$sampIn; print FOUT "\n* samples: count (I8) SPACE 1..NUMOUT (25I6)\n"; for ($i=0; $i", $partest ) || die "can't open file $!"; print FOUT "* I8\n"; printf FOUT "NUMIN : %3d\n",$IN; print FOUT "NUMHID : 35\n"; print FOUT "NUMOUT : $ON\n"; print FOUT "NUMLAYERS : 2\n"; printf FOUT "NUMSAM :%9d\n",$sampIn; print FOUT "NUMFILEIN_IN : 1\n"; print FOUT "NUMFILEIN_OUT : 1\n"; print FOUT "NUMFILEOUT_OUT : 1\n"; print FOUT "NUMFILEOUT_JCT : 1\n"; print FOUT "STPSWPMAX : 0\n"; print FOUT "STPMAX : 0\n"; print FOUT "STPINF : 1\n"; print FOUT "ERRBINSTOP : 0\n"; print FOUT "BITACC : 100\n"; print FOUT "DICESEED : 100025\n"; print FOUT "DICESEED_ADDJCT : 0\n"; print FOUT "LOGI_RDPARWRT : 1\n"; print FOUT "LOGI_RDINWRT : 0\n"; print FOUT "LOGI_RDOUTWRT : 0\n"; print FOUT "LOGI_RDJCTWRT : 0\n"; print FOUT "* --------------------\n"; print FOUT "* F15.6\n"; print FOUT "EPSILON : 0.030000\n"; print FOUT "ALPHA : 0.300000\n"; print FOUT "TEMPERATURE : 1.000000\n"; print FOUT "ERRSTOP : 0.000000\n"; print FOUT "ERRBIAS : 0.000000\n"; print FOUT "ERRBINACC : 0.200000\n"; print FOUT "THRESHOUT : 0.500000\n"; print FOUT "DICEITRVL : 0.100000\n"; print FOUT "* --------------------\n"; print FOUT "* A132\n"; print FOUT "TRNTYPE : ONLINE\n"; print FOUT "TRGTYPE : SIG\n"; print FOUT "ERRTYPE : DELTASQ\n"; print FOUT "MODEPRED : sec\n"; print FOUT "MODENET : 1st,unbal\n"; print FOUT "MODEIN : win=5,loc=aa\n"; print FOUT "MODEOUT : KN\n"; print FOUT "MODEJOB : mode_of_job\n"; print FOUT "FILEIN_IN : $inTest\n"; print FOUT "FILEIN_OUT : $inOutTest\n"; print FOUT "FILEIN_JCT : $jct\n"; print FOUT "FILEOUT_OUT : $testOutFile\n"; print FOUT "FILEOUT_JCT : $resultsdir/$id-jct_crap\n"; print FOUT "FILEOUT_ERR : $resultsdir/$id-err.dat\n"; print FOUT "FILEOUT_YEAH : $resultsdir/$id.tmp\n"; print FOUT "//\n"; close FOUT; { if( !$dbg ){ open( OLDOUT, '>&', \*STDOUT ) || confess( $! ); open( STDOUT, '>', '/dev/null' ) || confess( $! ); } my @cmd = ( "profnet_bval", $partest ); if( $debug ){ warn( "@cmd" ); } my $res = system( @cmd ); if( !$dbg ){ open( STDOUT, '>&', \*OLDOUT ) || confess( $! ); } if( $res ){ die( "@cmd failed: ".( $? >> 8 ) ) }; } ############ normalizing output ###################### $totalDiff=$sum=0; undef@preds;undef@predns; open (F, $testOutFile ) || die " test file doesnt exist"; for ($r=0; $r<43; $r++) { ; } while ($line=) { if ($line=~ /^(.{8})(.{5})(.{4})/) { $result2=$3; $result1=$2; $result2=~ s/\s//g;$result1=~ s/\s//g; $diff=$result1-$result2; $totalDiff=$totalDiff+$diff; push (@diff,$diff); $casp_diff=$result1/($result1+$result2); if ($casp_diff>=0.85) {push (@order,'D');} else {push (@order,'O');} push (@casp_diff,$casp_diff); if ($diff>=22) { push (@preds,'F'); } else { push (@preds,'-'); } if ($diff>=-7) { push (@predns,'F'); } else { push (@predns,'-'); } ##### added in june 2005 reliability index output if ($diff>=-7) { ######## normalize every prtediction to a 0-9 scale the higher is the number the the stronger is the prediction $RI_ns= ($diff+7)/1.07/10; } else { $RI_ns= -($diff+7)/.93/10; } push (@RI_ns,$RI_ns); if ($diff>=22) { $RI_s= ($diff-22)/.78/10; } else { if ($diff<0) { $RI_s= -($diff-22)/1.22/10; } else { $RI_s= ($diff)/1.22/10; } } push (@RI_s,$RI_s); } } close (F); $l=scalar@diff; $avgDiff= $totalDiff/$l; foreach $diff (@diff) { #calculation of sigma $sum= $sum + ($diff- $avgDiff)*($diff- $avgDiff); } $sigma= sqrt($sum/($l-1)); for ($i=0;$i$#diff-$del)) { $tempwin=$tempwin-2; $del=($tempwin-1)/2; } $tempsum=0; $a=$i-$del; $b=$i+$del; for ($j=$a;$j<=$b;$j++) { $tempsum=$tempsum+$diffNew[$j]; } $diffNew2[$i]=$tempsum/$tempwin; if (($diffNew2[$i]<=-1) && ($access[$i] eq 'e')) { push (@yes, 'y'); } else { push (@yes, 'n'); } } # create each output file according to the mode given, no default mode my @fouts = split(/,/o, $fout_list ); my @modes = split(/,/o, $mode_list ); for( my $idx = 0; $idx < @fouts; ++$idx ) { my $fout = $fouts[$idx]; my $mode = defined($modes[$idx]) ? $modes[$idx] : ''; open (FOUT,">", $fout ) || confess( "cant create output file $fout: $!" ); if ($mode eq '-1') { printf FOUT "PFRMAT DR\n"; printf FOUT "TARGET %s\n",$target_name; printf FOUT "AUTHOR 3828-5533-3482\n"; printf FOUT "REMARK The method was optimized to predict normalized B-values and not disorder\n"; printf FOUT "REMARK We did not plan on submitting a 2-state disorder prediction\n"; printf FOUT "REMARK However, because we have to, we just used a cutoff of p>=0.85 for predicting a residue to be disordered\n"; printf FOUT "METHOD PROFbval: predicting normalized B-values from sequence\n"; printf FOUT "MODEL 1\n"; for ($i=0;$i$end)) { ##i know its wrong, but this is the way i trained it undef @residue; @residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100); push (@array, @residue); } else { undef @residue; @residue=($A[$j],$C[$j],$D[$j],$E[$j],$F[$j],$G[$j],$H[$j],$I[$j],$K[$j],$L[$j],$M[$j],$N[$j],$P[$j],$Q[$j],$R[$j],$S[$j],$T[$j],$W[$j],$Y[$j],$V[$j],0); push (@array, @residue); } } return @array; } #secondary structure prediction information sub secondary { my $lower=shift; my $higher=shift; my $end= shift; my @secon; my @array; for ($j=$lower; $j<=$higher; $j++) { if (($j<0) ||($j>$end)) { undef @secon; @secon=(0,0,0); push (@array, @secon); } else { undef @secon; @secon=($otH[$j],$otE[$j],$otL[$j],); push (@array, @secon); } } return @array; } #function for solvent accessibility prediction information sub acc { my $lower=shift; my $higher=shift; my $end= shift; my @PRE; my @array; for ($j=$lower; $j<=$higher; $j++) { if (($j<0) ||($j>$end)) { undef @PRE; @PRE=(100); push (@array, @PRE); } else { undef @PRE; @PRE=($PREL[$j]); push (@array, @PRE); } } return @array; } # vim:ai: profbval-1.0.22/scr/Makefile.am0000644015075101507510000000017411777007101013172 00000000000000pkgdatascrdir = $(pkgdatadir)/scr dist_pkgdatascr_SCRIPTS = $(srcdir)/*.pl dist-hook: rm -rf `find $(distdir) -name .svn` profbval-1.0.22/scr/Makefile.in0000644015075101507510000003012412012433130013165 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = scr DIST_COMMON = $(dist_pkgdatascr_SCRIPTS) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(pkgdatascrdir)" SCRIPTS = $(dist_pkgdatascr_SCRIPTS) SOURCES = DIST_SOURCES = am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ pkgdatascrdir = $(pkgdatadir)/scr dist_pkgdatascr_SCRIPTS = $(srcdir)/*.pl all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu scr/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu scr/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): install-dist_pkgdatascrSCRIPTS: $(dist_pkgdatascr_SCRIPTS) @$(NORMAL_INSTALL) @list='$(dist_pkgdatascr_SCRIPTS)'; test -n "$(pkgdatascrdir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(pkgdatascrdir)'"; \ $(MKDIR_P) "$(DESTDIR)$(pkgdatascrdir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; echo "$$p"; else :; fi; \ done | \ sed -e 'p;s,.*/,,;n' \ -e 'h;s|.*|.|' \ -e 'p;x;s,.*/,,;$(transform)' | sed 'N;N;N;s,\n, ,g' | \ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1; } \ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \ if ($$2 == $$4) { files[d] = files[d] " " $$1; \ if (++n[d] == $(am__install_max)) { \ print "f", d, files[d]; n[d] = 0; files[d] = "" } } \ else { print "f", d "/" $$4, $$1 } } \ END { for (d in files) print "f", d, files[d] }' | \ while read type dir files; do \ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \ test -z "$$files" || { \ echo " $(INSTALL_SCRIPT) $$files '$(DESTDIR)$(pkgdatascrdir)$$dir'"; \ $(INSTALL_SCRIPT) $$files "$(DESTDIR)$(pkgdatascrdir)$$dir" || exit $$?; \ } \ ; done uninstall-dist_pkgdatascrSCRIPTS: @$(NORMAL_UNINSTALL) @list='$(dist_pkgdatascr_SCRIPTS)'; test -n "$(pkgdatascrdir)" || exit 0; \ files=`for p in $$list; do echo "$$p"; done | \ sed -e 's,.*/,,;$(transform)'`; \ dir='$(DESTDIR)$(pkgdatascrdir)'; $(am__uninstall_files_from_dir) tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile $(SCRIPTS) installdirs: for dir in "$(DESTDIR)$(pkgdatascrdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dist_pkgdatascrSCRIPTS install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-dist_pkgdatascrSCRIPTS .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic dist-hook \ distclean distclean-generic distdir dvi dvi-am html html-am \ info info-am install install-am install-data install-data-am \ install-dist_pkgdatascrSCRIPTS install-dvi install-dvi-am \ install-exec install-exec-am install-html install-html-am \ install-info install-info-am install-man install-pdf \ install-pdf-am install-ps install-ps-am install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am uninstall uninstall-am \ uninstall-dist_pkgdatascrSCRIPTS dist-hook: rm -rf `find $(distdir) -name .svn` # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: