profisis-1.0.11/0000755015075101507510000000000012012425016010436 500000000000000profisis-1.0.11/README0000644015075101507510000000000011777007366011251 00000000000000profisis-1.0.11/configure.ac0000644015075101507510000000030512012405604012643 00000000000000AC_INIT([profisis], [1.0.11], [https://rostlab.org/bugzilla3/enter_bug.cgi?product=profisis]) AC_CONFIG_SRCDIR([profisis]) AM_INIT_AUTOMAKE AC_CONFIG_FILES([Makefile examples/Makefile]) AC_OUTPUT profisis-1.0.11/aclocal.m40000644015075101507510000005326512012425007012231 00000000000000# generated automatically by aclocal 1.11.6 -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, # Inc. # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.69],, [m4_warning([this file was generated for autoconf 2.69. You have another version of autoconf. It may work, but is not guaranteed to. If you have problems, you may need to regenerate the build system entirely. To do so, use the procedure documented by the package, typically `autoreconf'.])]) # Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008, 2011 Free Software # Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. # (This private macro should not be called outside this file.) AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version='1.11' dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to dnl require some minimum version. Point them to the right macro. m4_if([$1], [1.11.6], [], [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl ]) # _AM_AUTOCONF_VERSION(VERSION) # ----------------------------- # aclocal traces this macro to find the Autoconf version. # This is a private macro too. Using m4_define simplifies # the logic in aclocal, which can simply ignore this definition. m4_define([_AM_AUTOCONF_VERSION], []) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. # This function is AC_REQUIREd by AM_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.11.6])dnl m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl _AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))]) # AM_AUX_DIR_EXPAND -*- Autoconf -*- # Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # Do all the work for Automake. -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2008, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 16 # This macro actually does too much. Some checks are only needed if # your package does certain things. But this isn't really a big deal. # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.62])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl # test to see if srcdir already configured if test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT. m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,, [m4_fatal([AC_INIT should be called with package and version arguments])])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AC_REQUIRE([AM_PROG_INSTALL_SH])dnl AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl AC_PROVIDE_IFELSE([AC_PROG_OBJC], [_AM_DEPENDENCIES(OBJC)], [define([AC_PROG_OBJC], defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl ]) _AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl dnl The `parallel-tests' driver may need to know about EXEEXT, so add the dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen. This macro dnl is hooked onto _AC_COMPILER_EXEEXT early, see below. AC_CONFIG_COMMANDS_PRE(dnl [m4_provide_if([_AM_COMPILER_EXEEXT], [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl ]) dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion. Do not dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further dnl mangled by Autoconf and run in a shell conditional statement. m4_define([_AC_COMPILER_EXEEXT], m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_arg=$1 _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count]) # Copyright (C) 2001, 2003, 2005, 2008, 2011 Free Software Foundation, # Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi AC_SUBST(install_sh)]) # Copyright (C) 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Fake the existence of programs that GNU maintainers use. -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 6 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl AC_REQUIRE_AUX_FILE([missing])dnl if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # Copyright (C) 2003, 2004, 2005, 2006, 2011 Free Software Foundation, # Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_MKDIR_P # --------------- # Check for `mkdir -p'. AC_DEFUN([AM_PROG_MKDIR_P], [AC_PREREQ([2.60])dnl AC_REQUIRE([AC_PROG_MKDIR_P])dnl dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P, dnl while keeping a definition of mkdir_p for backward compatibility. dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile. dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of dnl Makefile.ins that do not define MKDIR_P, so we do our own dnl adjustment using top_builddir (which is defined more often than dnl MKDIR_P). AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl case $mkdir_p in [[\\/$]]* | ?:[[\\/]]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac ]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2008, 2010 Free Software # Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # -------------------- # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ------------------------ # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # Check to make sure that the build environment is sane. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[[\\\"\#\$\&\'\`$am_lf]]*) AC_MSG_ERROR([unsafe absolute working directory name]);; esac case $srcdir in *[[\\\"\#\$\&\'\`$am_lf\ \ ]]*) AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 1 # AM_PROG_INSTALL_STRIP # --------------------- # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Copyright (C) 2006, 2008, 2010 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 3 # _AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in. # This macro is traced by Automake. AC_DEFUN([_AM_SUBST_NOTMAKE]) # AM_SUBST_NOTMAKE(VARIABLE) # -------------------------- # Public sister of _AM_SUBST_NOTMAKE. AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004, 2005, 2012 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. Yes, it's still used # in the wild :-( We should find a proper way to deprecate it ... AC_SUBST([AMTAR], ['$${TAR-tar}']) m4_if([$1], [v7], [am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR profisis-1.0.11/profisis0000755015075101507510000005062212012405432012147 00000000000000#!/usr/bin/perl -w use warnings; use File::Temp; use Getopt::Long; use POSIX qw||; our $config; my $pkgdatadir; BEGIN { use Config::IniFiles; my ( $defaultconfig, $etcconfig ); if( -e "__pkgdatadir__/profisisrc.default" ) { $defaultconfig = Config::IniFiles->new( -file => "__pkgdatadir__/profisisrc.default" ); } if( -e "__sysconfdir__/profisisrc" ) { $etcconfig = Config::IniFiles->new( -file => "__sysconfdir__/profisisrc", -import => $defaultconfig ); } else { $etcconfig = $defaultconfig; } if( ( $ENV{PROFISISCONF} && -e "$ENV{PROFISISCONF}" ) || -e "$ENV{HOME}/.profisisrc" ) { $config = Config::IniFiles->new( -file => $ENV{PROFISISCONF} || "$ENV{HOME}/.profisisrc", -import => $etcconfig ); } else { $config = $etcconfig; } $pkgdatadir = glob( $config->val('profisis', 'pkgdatadir') ); } # popularity contest if( system('pp_popcon_cnt', '-p', 'profisis') == -1 ){ warn("The Rost Lab recommends you install the pp-popularity-contest package that provides pp_popcon_cnt:\n\nsudo apt-get install pp-popularity-contest\n"); } my $debug = 0; #$Fil=""; # lkajan: this was empty string was used like this: $hssp="$out.hssp$Fil" or $hssp="hssp/$sfile.hssp$Fil" # lkajan: $out however is not initialized and $struct is hard-coded to 'n' #$lsl="yes"; #$workdir=`pwd`; #chomp $workdir; #sub inKey{ # my $key=""; # while ($key eq ""){ # if ($BSD_STYLE) {system "stty cbreak /dev/tty 2>&1"} # else{system "stty", "-icanon", "eol", "\001"} # $key = getc; # if ($BSD_STYLE) {system "stty -cbreak /dev/tty 2>&1"} # else{system "stty", "icanon", "eol", "^@"} # ASCII NUL # print "\n"; # if ($key eq "y"){$r="yes"} # elsif($key eq "n"){$r="no"} # elsif ($key eq "q"){$r="q"} # else{print "only y/n\n";$key=""} # } # return $r; #} my %opt = ( help => 0, debug => \$debug, gap => 20, stretch => 5, crd => 7, fastafile => undef, hsspfile => undef, rdbproffile => undef, outfile => undef, outformat => 'pp', 'crd-restriction' => 1 , succinct =>undef ); if( !Getopt::Long::GetOptions(\%opt, 'help!', 'debug!', 'gap=i', 'stretch=i', 'crd=i', 'fastafile=s', 'hsspfile=s', 'rdbproffile=s', 'outfile=s', 'outformat=s', 'crd-restriction!' ,'succinct!' ) ) { print_help(); exit(1); } if( $opt{help} ) { print_help(); exit(0); } if( !$opt{fastafile} || !-e $opt{fastafile} ){ die( "--fastafile missing" ); } if( !$opt{hsspfile} || !-e $opt{hsspfile} ){ die( "--hsspfile missing" ); } if( !$opt{rdbproffile} || !-e $opt{rdbproffile} ){ die( "--rdbproffile missing" ); } if( !$opt{outfile} ){ die( "--outfile missing" ); } my $workdir = File::Temp::tempdir( CLEANUP => !$debug ); $g = $opt{gap}; #diff between output nodes $sch = $opt{stretch}; #half stretch $cr = $opt{crd}; #crowd $crgs=1;#crowd of gs $topgap=101;#maximal difference between outputnodes $sfile = $opt{fastafile}; $nitr = $opt{iterations} || 0; # lkajan: not used # lkajan: the following looks dangerous, commenting out #if ($sfile=~/\.f$/o){$tmp=$sfile;chop $sfile;chop $sfile; { my @cmd = ( 'cp', $tmp, $sfile ); system( @cmd ) && die( "@cmd failed: ".($?>>8) ); } } if( $debug ) { warn( "file=$sfile strech=$sch crowd_predictions=$cr crowd_gs=$crgs gap=$g top_gap=$topgap itr=$nitr\n" ); } ############################################################# open( I1, ">$workdir/tin_forTest") || die( "failed to open >$workdir/tin_forTest: $!" ); # lkajan: I1S is not opened anywhere in the original version. I put this open here and comment out all uses - is that logical? #open( I1S, ">$workdir/i1s") || die( "failed to open >$workdir/i1s: $!" ); open( O1, ">$workdir/tout_forTest") || die( "failed to open >$workdir/tout_forTest: $!" );; open( MAP, ">$workdir/map_forTest") || die( "failed to open >$workdir/map_forTest: $!" );; open( OUT, ">", $opt{outfile} ) || die( "failed to open >$opt{outfile}: $!" );; $empty="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 "; open( FASTA, '<', $sfile ) || die( "failed to open <$sfile: $!" ); while( my $l = ){ if( $l =~ /^>/o ){ chomp $l; if( $opt{outformat} eq 'pp' ){ print OUT $l; } last; } } close( FASTA ); my $seq = ''; my $ss = ''; my $acc = ''; if( $opt{outformat} eq 'pp' ){ print OUT ": strech=$sch crowd_predictions=$cr gap=$g itr=$nitr\n"; } #$struct ="n"; #if ($struct eq "n"){ # $yesh=""; # if ($lsl eq "yes"){$yesh=`ls $sfile.hssp`} # print "yesh=$yesh\n"; #if ($yesh eq ""){system "/home/rost/pub/maxhom/scr/maxhom.pl $sfile"} #$yesh=""; # if ($lsl eq "yes"){$yesh=`ls $sfile.rdbProf`} #if ($yesh eq ""){system "/home/rost/pub/prof/prof $sfile.hssp both"} open( PROFRDB, '<', $opt{rdbproffile} ) || die( "failed to open <$opt{rdbproffile}: $!" ); while( my $l = ) { if ($l=~/^No\s+AA/){ @tit=split(/\s+/,$l); for ($i=0;$i ) { if ($l=~/^\sSeqNo\sPDBNo/){$read="y";next} if (($l=~/^\#\# INSERTION LIST/) or ($l=~/^\/\//)){last} if ($l=~/^\#\# ALIGNMENTS/){$readseq++;next} if ($l=~/SeqNo PDBNo AA STRUCTURE/){next} if ($read eq "y"){ $prf=substr ($l,13,79); $prf=~s/^\s+//; @tt=split (/\s+/,$prf); if (scalar @tt!=20){warn( "AHHHHHHHHHHHHH ".scalar(@tt) );} $seqh .= "$prf,"; $w=substr ($l,124,6); #print "$l w=$w\n"; $w=-(-$w); $wgt .= "$w,"; $sl++; } } close( HSSP ); if (length $seq!=$sl){die "seq=$seq sl=$sl not same length\n"} $sam1=1; $st1=1; ########################################################### if( $debug ) { warn( "seq=$seq" ); } @{$a{hs}}=split (//,$seq); @{$a{ss}}=split (/,/,$ss); @{$a{acc}}=split (/,/,$acc); @{$a{wgt}}=split (/,/,$wgt); @{$a{prof}}=split (/,/,$seqh); $c=0; for ($i=0;$i=scalar @{$a{hs}}){$prf=$prf."$empty";$seq=$seq."Z"} else{ $seq=$seq."$a{hs}[$i+$j]"; $prf=$prf."$a{prof}[$i+$j] "; } #print "i=$i j=$j i+j=",$i+$j," prf=$prf\n"; } $list{seq}[$c]=$seq; $list{ss}[$c]=$a{ss}[$i]; $list{acc}[$c]=$a{acc}[$i]; $list{wgt}[$c]=$a{wgt}[$i]; $list{prof}[$c]=$prf;#print "list{prof}[$c]=$list{prof}[$c] prf=$prf\n"; $list{pos}[$c]=$i; $c++; } ########################################################### for ($i=0;$i0) and ($list{acc}[$i-1] ne "X")){$ACC[0]=int ($list{acc}[$i-1]/3)} if ($list{acc}[$i] ne "X"){$ACC[1]=int ($list{acc}[$i]/3)} if (($i< ( scalar( @{$list{acc}} ) - 1 )) && ($list{acc}[$i+1] ne "X")){ $ACC[2]=int ($list{acc}[$i+1]/3); if ($ACC[2]==0){$ACC[2]="0"} } push (@sam,@ACC); @WGT=("0","0","0"); if (($i>0) and ($list{wgt}[$i-1] ne "X")){$WGT[0]=int (50*$list{wgt}[$i-1])} if ($list{wgt}[$i] ne "X"){$WGT[1]=int (50*$list{wgt}[$i])} if ( $i < scalar( @{$list{wgt}} )-1 && $list{wgt}[$i+1] ne "X" ) { # lkajan: the original uses int here but that is not recommended: it leads to differences between maple and jobtest runs #$WGT[2]=int (50*$list{wgt}[$i+1]); $WGT[2]=POSIX::floor(50*$list{wgt}[$i+1]); if ($WGT[2]==0){$WGT[2]="0"} } push (@sam,@WGT); ################################################################################################ printf I1 "%6s %8d\n","ITSAM: ",$st1; # printf I1S "%6s %8d\n","ITSAM: ",$st1; printf O1 "%8d ", $st1; print MAP "$st1 $list{pos}[$i] $list{seq}[$i] $list{ss}[$i] "; print MAP @ACC; print MAP @WGT; # lkajan: $list{pp} #print MAP $list{pp}[$i]; print MAP "\n"; $aa=substr ($list{seq}[$i],4,1); $byP[$st1]="$aa"; $check="$sam1 $list{pos}[$i] $list{seq}[$i] $list{ss}[$i] "; $check=$check."@ACC @WGT"; @ck=split(/\s+/, $check); if (scalar @ck!=12){die "scalar ck!=15 ck=@ck\nACC=@ACC\nWGT=@WGT"} $sam1++;$st1++; $d125=1;$d1s25=1; if (scalar @sam!=189){die "i=$i seq=$seq scalar @sam=",scalar @sam} foreach $a (@sam){ if ($d125==26){print I1 "\n";$d125=1} printf I1 "%6s",$a; $d125++; } foreach $a (@samseq){ if ($d1s25==26){ # print I1S "\n"; $d1s25=1; } # printf I1S "%6s",$a; $d1s25++; } @pp=(100,0); print I1 "\n"; # print I1S "\n"; foreach $o (@out){printf O1 "%6s",$o} print O1 "\n"; } ################################################################################################ print I1 "//\n"; close (I1); close (O1); $st1--; open( I1, ">$workdir/in_forTest" ) || die( "failed to open >$workdir/in_forTest: $!" ); print I1 "* overall: (A,T25,I8)\n"; print I1 "NUMIN : 189\n"; printf I1 "%23s %8d\n","NUMSAMFILE :",$st1; print I1 "*\n"; print I1 "* samples: count (A8,I8) NEWLINE 1..NUMIN (25I6)\n"; open( TIN, '<', "$workdir/tin_forTest" ) || die( $! ); while (){print I1 $_} close( TIN ); unlink( "$workdir/tin_forTest" ); close (I1); ################################################################################################ open (O1, ">$workdir/out_forTest") || die( "failed to open >$workdir/out_forTest: $!" ); print O1 "* overall: (A,T25,I8)\n"; print O1 "NUMOUT : 2\n"; printf O1 "%23s %8d\n","NUMSAMFILE :",$st1; print O1 "*\n"; print O1 "* samples: count (I8) SPACE 1..NUMOUT (25I6)\n"; open( TOUT, '<', "$workdir/tout_forTest" ) || die( $! ); while (){print O1 $_} close( TOUT ); unlink( "$workdir/tout_forTest" ); close (O1); ################################################################################################ open( TES, ">$workdir/parTest" ) || die( "failed to open >$workdir/parTest: $!" ); print TES "* I8 NUMIN : 189 NUMHID : 50 NUMOUT : 2 NUMLAYERS : 2 NUMSAM :"; printf TES "%9d\n",$st1; print TES "NUMFILEIN_IN : 1 NUMFILEIN_OUT : 1 NUMFILEOUT_OUT : 1 NUMFILEOUT_JCT : 1 STPSWPMAX : 0 STPMAX : 0 STPINF : 1 ERRBINSTOP : 0 BITACC : 100 DICESEED : 100025 DICESEED_ADDJCT : 0 LOGI_RDPARWRT : 1 LOGI_RDINWRT : 0 LOGI_RDOUTWRT : 0 LOGI_RDJCTWRT : 0 * -------------------- * F15.6 EPSILON : 0.010000 ALPHA : 0.300000 TEMPERATURE : 1.000000 ERRSTOP : 0.000000 ERRBIAS : 0.000000 ERRBINACC : 0.200000 THRESHOUT : 0.500000 DICEITRVL : 0.100000 * -------------------- * A132 TRNTYPE : ONLINE TRGTYPE : SIG ERRTYPE : DELTASQ MODEPRED : sec MODENET : 1st,unbal MODEIN : win=5,loc=aa MODEOUT : KN MODEJOB : mode_of_job FILEIN_IN : $workdir/in_forTest FILEIN_OUT : $workdir/out_forTest FILEIN_JCT : $pkgdatadir/jctAuto9newHssp990-51 FILEOUT_OUT : $workdir/outresultsTest990 FILEOUT_JCT : $workdir/jct_crap FILEOUT_ERR : $workdir/NNo_tst_err.dat FILEOUT_YEAH : $workdir/NNo-yeah1637.tmp //\n"; close (TES); { # lkajan: silence over talkative neural net: if( !$debug ) { open( OLDOUT, '>&', \*STDOUT ) || die; open( STDOUT, '>/dev/null' ) || die; } my @cmd = ( "profnet_isis", "$workdir/parTest" ); system( @cmd ) && die( "@cmd failed: ".($?>>8) ); if( !$debug ) { open( STDOUT, '>&', \*OLDOUT ) || die; } } ###################################################################### ################# RECORD PREDICTIED ################### $out_res="$workdir/outresultsTest990"; #$ct=0; if( $debug ) { $have=`ls $workdir/outresultsTest990`; warn( "in ISIS found $out_res $have\n" ); } my @pr = (); open( NETOUT, '<', $out_res ) || die( "failed to open <$out_res: $!" ); while( my $l = ) { if ($l=~/^\s+\d/){ chop $l; @a=split(/\s+/, $l); $pos=$a[1]; $prval[$pos]=$a[3]-$a[2]; $aa=$byP[$a[1]]; if ((($a[3]-$a[2])>$g) and (($a[3]-$a[2])<$topgap)){ $pr[$pos]="pp"; if ($a[3]-$a[2]>25){$pr[$pos]="PP"} $pp++; } else{$pr[$pos]="notpp";$np++} $s[$pos]=$aa; } } close( NETOUT ); if( $debug ) { warn( "pred pp=$pp np=$np scalar s=".scalar(@s)."\n" ); } ######################################################### # lkajan: $i is a residue index, residue indices start from 1 for ($i=1;$i-1) and (($i+$j)= $g ){ $stval[$i] = ( $stval[$i] || 0 ) + $prval[$i+$j]; } } } $prp[$i] //= 0; # lkajan: set to 0 if not defined $sprp[$i] //= 0; # lkajan: set to 0 if not defined # lkajan: note the $crd multiplier on the following original line: $crd is never set. Probably $cr was meant. However perhaps we should preserve the original buggy behaviour? #if (($pr[$i] eq "pp")and (($prp[$i]>$cr-1) or ($sprp[$i]>2.88571*$crd*10))) if( $pr[$i] eq "pp" && ( $prp[$i] > $cr-1 || $sprp[$i] > 2.88571* ( $opt{'crd-restriction'} ? 0 : $cr ) *10 ) ) #if( $pr[$i] eq "pp" && ( $prp[$i] > $cr-1 || $sprp[$i] > 2.88571*$cr*10 ) ) { $out{pp}[$i]="P"; $cpp++; } elsif ($prp[$i]<$cr){$out{pp}[$i]="-"} else{$out{pp}[$i]="-"} if ($pr[$i] eq "PP"){$out{pp}[$i]="P";$cpp++} } $blk=0;$seq="";$pp=""; if( $debug ){ warn( " 1 2 3 4\n" ); } if( $debug ){ warn( "1234567890123456789012345678901234567890\n" ); } for ($i=1;$i3A1P:A\|PDBID\|CHAIN\|SEQUENCE: strech=5 crowd_predictions=7 gap=20 itr=0 MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGW PPP-P-----P-P----P-------P--PPPP-PPP---P 1 M 25 ... 40 W 34 prval 'resn resi predicted_value', e.g. '1 M 25' each residue on a line --debug --nodebug --succinct succinct output (no confidence values) Parameters controlling post processing: --gap=int default=20 --stretch=int default=5 --crd=int default=7 --crd-restriction use original (\$crd = undef) code - this is the default --nocrd-restriction use new (\$cr) code |; } =pod =head1 NAME profisis - protein-protein interaction sites identified from sequence =head1 SYNOPSIS profisis [OPTION] =head1 DESCRIPTION profisis (ISIS) is a machine learning-based method that identifies interacting residues from sequence alone. Although the method is developed using transient protein-protein interfaces from complexes of experimentally known 3D structures, it never explicitly uses 3D infor- mation. Instead, we combine predicted structural features with evolutionary information. The strongest predictions of the method reached over 90% accuracy in a cross-validation experiment. Our results suggest that despite the significant diversity in the nature of protein-protein interactions, they all share common basic principles and that these principles are identifiable from sequence alone. =head2 Conversion of PSI-BLAST alignment to HSSP format The most up-to-date procedure can be found at L. =over =item 1. Convert BLAST output to a Single Alignment Format (SAF): __datadir__/librg-utils-perl/blast2saf.pl fasta= maxAli=3000 eSaf=1 \ saf= =item 2. Convert SAF format to HSSP: __datadir__/librg-utils-perl/copf.pl formatIn=saf formatOut=hssp \ fileOut= exeConvertSeq=convert_seq =item 3. Filter results to 80% redundancy: __datadir__/librg-utils-perl/hssp_filter.pl red=80 fileOut= =back =head2 Output format See description of B<--outformat> option. =head1 REFERENCES =over =item Ofran, Y. and Rost, B. (2007). ISIS: interaction sites identified from sequence. Bioinformatics, 23(2), e13-6. =back =head1 OPTIONS Required parameters =over =item --fastafile file that contains your sequence in fasta format =item --hsspfile file with hssp data for sequence in --fastafile =item --rdbproffile file with prof output for sequence in --fastafile =item --outfile output file =back Optional parameters =over =item --outformat output format [pp|prval], default=pp =over =item pp PredictProtein format: Output ::= Header_Line Binary_Out Raw_Out Header_Line ::= '>' Header_String '\n' Binary_Out ::= ( Horiz_Sequence '\n' Bin_Pred '\n\n' )+ Horiz_Sequence ::= Amino_Acid_One_Letter_Code{,40} Bin_Pred ::= [P-]{,40} 'P' marks binding residue. Raw_Out ::= ( Amino_Acid_Number ' ' Amino_Acid_One_Letter_Code ' ' Prediction_Score '\n' )+ Prediction_Score ::= Integer_Value See example outputs in F<__docdir__/examples>. =item prval ( 'resn resi predicted_value' )+, e.g. '1 M 25' '2 R 36' ... =back =item --debug =item --nodebug Default: --nodebug =item --succinct Succinct output (print no confidence values). =back Parameters controlling post processing - these parameters affect only the top part of the 'pp' output format =over =item --gap=int default=20 =item --stretch=int default=5 =item --crd=int default=7 =item --crd-restriction =item --nocrd-restriction Default: --crd-restriction. Use original ($crd = undef) code (--crd-restriction) or use new ($cr) code (--nocrd-restriction). =back =head1 EXAMPLES profisis --fastafile __docdir__/examples/3A1P_A.fasta --hsspfile __docdir__/examples/3A1P_A.hssp --rdbproffile __docdir__/examples/3A1P_A.rdbProf --outfile /tmp/3A1P_A.profisis =head1 ENVIRONMENT =over =item PROFISISCONF Location of configuration file to use, overriding other configuration files =back =head1 FILES =over =item F<__pkgdatadir__/profisisrc.default> Default configuration file. See this file for a description of the parameters. =item F<__sysconfdir__/profisisrc> System configuration file overriding values in F<__pkgdatadir__/profisisrc.default> =item F<~/.profisisrc> User configuration file overriding values in F<__sysconfdir__/profisisrc> =item F<$PROFISISCONF> If this environment variable is set F<~/.profisisrc> is disregarded and the value of the variable is read for configuration options overriding F<__sysconfdir__/profisisrc> =back =head1 AUTHOR Yanay Ofran and Burkhard Rost =head1 SEE ALSO prof(1) =cut # vim:ts=2:ai:et: profisis-1.0.11/jctAuto9newHssp990-510000644015075101507510000030022211777007366014064 00000000000000* NNout_jct file from FORTRAN NN.f (junctions) * * ------------------------------- * Output from neural network (NN) * ------------------------------- * * author: Burkhard Rost, Columbia Univ NYC / LION Heidelberg * fax: +1-212-305-7932 * email: rost@columbia.edu * www: http://cubic.bioc.columbia.edu/ * * All rights reserved. * * date: * * * MODEPRED sec * MODENET 1st,unbal * MODEIN win=5,loc=aa * MODEJOB mode_of_job * TRN-, TRG-, ERRTYPE ONLINE, SIG, DELTASQ * NUMIN, -HID, -OUT 189, 50, 2 * NUMSAM 201392 * STPSWPMAX, -MAX, -INF 200, 102000, 102000 * ERRBINSTOP, -STOP 0, 0.0000 * EPSILON, ALPHA, TEMP 0.0100, 0.1000, 1.0000 * * -------------------- * overall: (A,T25,I8) NUMIN: 189 NUMHID: 50 NUMOUT: 2 MODEPRED: sec MODENET: 1st,unbal MODEJOB: mode_of_job MODEIN: win=5,loc=aa MODEOUT: KN * -------------------- * jct 1st layer: row=numhid (10F10.4), col=(numin+1) 0.0087 -0.1135 -0.0993 -0.1100 0.0269 -0.1325 -0.0537 -0.1098 -0.0816 -0.0505 -0.0380 0.0257 -0.0728 0.0263 -0.1268 0.0396 -0.0069 0.0062 -0.0700 0.0352 -0.0160 -0.0331 0.0598 -0.1548 0.0065 0.0074 -0.0741 -0.0181 0.0534 -0.1954 -0.0060 -0.1206 -0.0499 -0.1375 0.0263 -0.1018 0.0462 0.0581 0.0623 -0.0424 -0.0463 0.0257 0.0736 -0.1483 -0.0278 -0.0676 -0.0713 -0.1121 -0.0742 -0.1473 0.0137 -0.0645 -0.1301 -0.0642 0.0226 -0.1177 -0.1120 -0.2320 0.0651 -0.0876 0.0563 -0.0970 0.0196 -0.1147 0.0308 0.1388 -0.1476 -0.1407 -0.0156 0.0869 -0.1151 0.0859 0.0200 -0.1273 -0.0667 0.0133 -0.0404 -0.0738 -0.0400 -0.0458 -0.2165 -0.2674 -0.1563 -0.1203 -0.1185 -0.0277 -0.2834 -0.1134 -0.0486 0.0477 0.0424 0.1118 -0.0564 -0.0999 0.0805 0.1015 0.0929 0.0734 0.0324 0.1028 0.0313 -0.0139 0.0562 -0.1465 0.0915 -0.0110 -0.0064 -0.0654 -0.1473 0.0499 -0.0486 -0.1721 -0.0336 -0.0604 0.0352 -0.1042 -0.0465 -0.0244 -0.0510 -0.0855 -0.0636 -0.0816 0.0683 -0.1048 -0.0871 -0.0444 0.0566 -0.0148 -0.0840 -0.1026 0.0856 0.0570 -0.0469 -0.1298 -0.1589 -0.0789 -0.0627 0.0940 -0.1133 0.0080 -0.0653 -0.1812 -0.1609 -0.0656 -0.0401 0.0330 -0.0705 -0.0168 -0.1449 -0.0182 -0.1228 -0.1357 -0.0411 -0.0094 -0.0616 0.1222 -0.0763 -0.0397 -0.0611 0.1180 -0.1033 -0.2151 -0.0846 -0.2131 -0.0895 -0.0487 -0.0128 -0.1248 -0.0800 0.0442 0.0661 -0.1234 -0.1462 -0.1091 -0.0623 0.0548 -0.0751 0.0340 0.0398 0.0281 0.0241 -0.1826 -0.5347 -0.2390 -0.1477 -0.4732 -0.3148 -0.3469 -0.3770 -0.6020 -0.6232 -0.0954 -0.3742 0.2213 -0.3026 -0.0285 -0.7313 -0.0040 0.0383 0.1608 0.1310 -0.8701 -0.2337 -0.6273 0.2817 -0.5216 -0.6182 -0.1049 -0.3851 -0.3498 -0.0478 -0.0449 -0.0636 -0.3914 -0.4540 -0.7085 -0.1136 0.1382 -0.3083 -0.0724 0.7429 -0.7890 0.0798 -0.1711 0.4709 -0.9644 -0.5049 -0.2204 0.2129 -0.5562 -0.7938 -0.6174 -0.2996 -0.1035 -0.5900 0.0209 -0.5402 0.1460 -0.2594 0.3488 0.8541 -0.4035 0.1996 -0.3578 0.6730 -0.3704 -0.7861 0.5158 -0.0164 -0.1715 -0.0216 -0.3837 0.2169 -0.3008 -0.6836 -0.0455 0.4878 0.5074 -0.3558 -0.2210 0.5688 0.0543 0.2192 -0.6359 -0.1677 -0.4833 -0.6200 0.6417 0.0259 -0.4432 -0.3193 -0.2715 -0.3715 -0.4810 -0.8768 -0.2651 -0.8049 0.5307 -0.3098 0.1303 0.4674 0.7080 0.1618 0.2026 0.1064 -0.0157 -0.0287 0.1296 -0.0976 -0.1720 0.0486 -0.2140 -0.0827 0.3994 -0.6619 -0.7794 0.0456 0.0002 -0.7237 0.1889 -0.0049 0.7456 0.2391 0.3996 -0.2405 0.4237 -0.2835 -0.0736 -0.3062 -0.4820 0.2069 -0.3048 -0.1489 -0.0706 0.2579 -1.1148 -0.8757 0.1973 -0.7829 -0.5583 0.5919 -0.1191 -0.0460 -0.1414 -0.0934 0.6299 0.0631 0.5374 0.1717 -0.1548 -0.1386 -0.3427 -0.0216 0.2584 -0.3677 0.6903 -1.1094 0.1684 -0.6986 -0.6702 0.0418 0.6005 -0.5271 0.7988 -0.1253 -0.3527 0.1688 0.1505 0.0354 -0.0029 -0.2151 -0.0302 -0.2432 -0.1231 -0.3398 0.4096 -1.1456 0.0836 -0.5439 -0.5259 0.4478 -0.1110 -0.2212 -0.1543 -0.0866 -0.0181 0.4687 0.1903 0.4234 0.2526 -1.4528 1.6929 -1.3045 0.3350 -1.0058 -0.3751 -0.5764 -0.5935 -0.4394 -0.9965 -0.1664 -0.0889 -0.0662 -0.0085 -0.0381 0.0308 0.0138 -0.0566 -0.0576 -0.0368 -0.0761 -0.0143 0.0889 -0.0598 -0.0773 -0.0639 -0.0276 -0.0808 -0.1376 -0.0554 -0.0054 0.0601 -0.1384 0.1841 -0.0205 0.0425 -0.0140 0.0954 -0.0060 -0.0995 0.0255 -0.0508 0.0855 0.1437 0.1406 -0.0736 -0.1392 -0.0824 -0.0268 0.0027 0.0911 -0.0472 0.0315 0.2040 -0.0269 -0.0126 0.1427 -0.1748 -0.1126 -0.0719 -0.0440 0.0703 0.0548 0.0267 0.1200 0.0619 -0.0992 0.0783 -0.0217 0.0422 0.0478 -0.0272 0.0080 0.1745 0.1615 0.0166 0.0380 0.0443 -0.0902 -0.0411 -0.0848 0.0389 0.0503 0.0878 -0.0461 -0.3364 0.0202 -0.2165 -0.1305 -0.1176 -0.0543 -0.0384 0.1532 0.0619 0.1036 0.0599 0.2020 0.0525 -0.0989 -0.0952 -0.0622 -0.1313 0.1242 -0.0578 -0.0617 -0.3186 -0.0570 -0.1497 -0.2019 -0.2613 0.0176 -0.0343 0.0288 0.0793 0.0859 -0.0257 -0.0822 -0.0135 -0.0607 -0.0068 -0.1639 0.0131 0.0599 0.0424 -0.0075 -0.1113 0.0089 -0.2641 -0.1583 -0.1480 -0.0277 -0.0282 -0.0473 0.0402 0.0081 0.1267 0.0408 0.0221 0.0983 -0.0047 -0.0956 -0.0168 0.0257 0.1120 0.1498 0.0023 0.1269 -0.0421 -0.1196 0.0026 -0.0533 0.0999 0.0767 0.2257 0.0306 0.2519 -0.0057 -0.0047 -0.0378 -0.1425 -0.0553 -0.0407 0.0481 0.1258 0.0336 -0.0289 -0.0605 0.0093 -0.1391 -0.1709 -0.1529 0.0043 0.0245 0.1919 0.0893 0.1887 0.1208 0.0366 -0.0132 0.0249 -0.0827 0.0007 -0.0133 0.1583 0.0883 0.0230 -0.0041 -0.0143 -0.0532 0.0432 -0.3185 -0.1284 -0.2664 0.3109 0.0582 0.1601 -0.3064 -0.3740 -0.4264 -0.8487 0.0365 -0.0360 -0.0563 -0.1008 -0.0534 0.0073 -0.2333 -0.0296 -0.0045 -0.0518 -0.1463 -0.2047 -0.1128 -0.0909 -0.2066 0.0362 -0.1276 0.0982 -0.1303 -0.0393 0.0448 -0.0400 -0.0575 -0.0758 -0.1362 -0.1648 -0.2049 -0.1653 -0.1034 -0.1746 -0.0568 -0.0047 -0.0092 -0.1103 -0.1706 -0.0370 0.0144 -0.0065 -0.0461 -0.1246 0.0336 -0.1294 0.0229 -0.1801 -0.0792 -0.0170 -0.1346 -0.1007 -0.1408 -0.0762 -0.0447 -0.0353 -0.0269 -0.0156 -0.0758 0.1196 0.0626 0.1177 0.0468 -0.1749 -0.0274 -0.1754 -0.1354 -0.2261 -0.1696 -0.0943 -0.1311 -0.0822 -0.0849 0.0534 0.0569 0.0118 -0.1639 -0.1435 0.0299 0.1729 -0.0346 0.1572 -0.0236 0.0762 -0.0062 -0.0603 -0.0344 -0.2146 -0.0976 -0.1803 -0.3113 -0.0833 -0.0264 -0.0523 0.0596 -0.1095 -0.0915 -0.0655 -0.0918 0.3024 -0.0132 0.1436 -0.0504 -0.0111 -0.1733 -0.0320 -0.1051 -0.1855 -0.1825 -0.0770 -0.0405 -0.1378 -0.0412 0.0499 -0.0657 -0.0472 -0.2229 0.0194 -0.0223 0.1641 0.1444 0.1423 -0.0473 0.0801 -0.0963 -0.1384 -0.1319 -0.0777 -0.1667 -0.0499 -0.0767 -0.1420 -0.0935 -0.0955 0.0388 -0.0417 -0.1106 -0.1018 -0.2215 -0.0177 -0.0034 -0.0286 -0.1031 -0.0903 -0.0253 -0.1423 0.0378 -0.2760 -0.1378 -0.1300 -0.0400 -0.1834 -0.0184 -0.1054 -0.0476 -0.0020 -0.0350 0.0256 -0.2108 0.0215 0.0286 -0.0226 -0.0447 -0.0549 -0.0423 -0.1755 -0.0728 -0.0474 -0.1084 -0.2108 -0.1319 -0.3020 -0.1071 -0.0473 0.0359 -0.1349 0.0104 -0.1917 -0.0543 -0.0043 -0.1035 0.0570 -0.0031 -0.1356 -0.2506 -0.0977 -0.1155 -0.4059 -0.6820 -0.5113 -0.2742 -0.3784 -0.1990 -0.5199 0.0724 -0.1395 0.1029 0.0934 0.1065 0.1201 0.2519 -0.0365 -0.1271 0.1958 -0.1075 0.2571 0.3046 -0.0167 0.2045 -0.0226 0.3039 -0.2772 -0.0937 0.1269 0.0607 -0.1354 -0.0982 0.3575 0.2086 0.1165 0.2082 0.1059 0.0427 -0.0488 0.0118 0.1524 0.0548 0.2357 0.1774 -0.2615 -0.0500 -0.2211 -0.0293 0.0755 -0.0069 0.0086 0.0408 0.2941 0.2408 0.1413 0.3217 -0.0001 -0.0155 0.1658 -0.0305 0.3001 0.0563 -0.0045 0.1079 -0.2140 -0.1465 -0.0684 -0.2723 0.0145 0.1245 0.0446 0.2181 0.2676 0.2543 0.0249 0.2758 0.0560 0.0736 -0.0406 -0.1911 0.1483 0.0666 0.0862 -0.1867 -0.6808 -0.1789 -0.5958 -0.2621 -0.3336 -0.0053 -0.0102 0.0158 0.2495 0.2639 0.3248 0.4026 0.2149 -0.0308 0.1957 -0.1011 -0.0648 0.5525 0.0402 0.0275 -1.0050 -0.2649 -0.5370 -0.4563 -0.2643 -0.0282 0.1034 0.1305 0.3098 0.0209 0.0362 0.0880 0.2484 0.0990 0.2057 -0.0902 -0.1088 0.3793 0.0800 -0.3041 -0.5121 -0.1668 -0.6097 -0.4967 -0.1496 -0.0392 0.0029 -0.0055 0.2186 0.1242 0.3517 0.1425 0.1919 0.0863 0.0220 -0.0414 -0.1977 0.2066 0.0966 0.2476 -0.3342 -0.0166 -0.1591 -0.3610 0.1851 -0.0423 0.1411 -0.1503 0.2602 0.1712 0.4636 0.2451 0.1417 0.2027 -0.0554 0.1698 -0.1216 0.2015 0.0367 -0.1835 0.0609 -0.0379 -0.0670 -0.3236 -0.0059 0.0903 0.0388 -0.0383 0.2289 0.2384 0.3690 0.1491 0.1500 0.0606 0.0494 0.0384 -0.0082 0.1984 -0.0105 -0.0460 0.0933 0.1185 0.1088 0.0171 0.2243 -1.0993 0.0347 0.0436 0.2327 -0.0706 0.1518 -0.3373 -0.6467 -0.4747 -1.0305 -0.2592 -0.1160 -0.0409 0.1049 -0.0512 0.1214 0.1993 0.0427 -0.0178 0.0401 0.2327 0.2806 -0.0865 0.1897 0.0820 0.0872 0.2264 -0.5826 0.1101 0.0657 -0.3426 -0.0768 -0.2153 0.0916 0.1753 0.4848 0.2537 0.2956 -0.1336 -0.1273 0.0305 -0.0237 0.0070 0.1458 0.0225 0.0914 0.1985 -0.5176 -0.0438 -0.3362 -0.0396 0.1852 -0.1150 0.1259 0.0060 0.0355 0.4008 -0.2359 0.0831 -0.0507 0.0844 -0.1769 0.1229 0.0124 -0.4207 0.2028 0.3257 -0.0964 -0.1117 -0.0593 0.0428 -0.3671 -0.3070 -0.0010 -0.3218 0.0457 -0.0417 -0.1294 0.1227 -0.0199 -0.1807 -0.1904 -0.1820 0.0735 0.2654 0.3197 0.5633 -0.3629 -0.1240 -0.0048 0.0831 0.0662 0.0497 0.0129 -0.0660 0.2041 0.3538 -0.2181 -0.1493 -0.3266 -0.2181 -0.1071 0.0207 -0.1363 -0.2705 0.1761 0.4408 -0.4525 0.0279 -0.6008 -0.1008 -0.0469 -0.1306 -0.0847 -0.0500 0.2353 -0.1235 -0.2325 -0.0725 -0.3456 0.0452 0.1191 -0.0603 -0.1633 0.1390 0.3505 0.0485 -0.0515 -0.0796 -0.2204 -0.0514 -0.0586 -0.0534 0.0190 -0.0118 0.1899 0.2496 -0.1046 0.2761 0.1396 -0.0509 -0.0514 -0.2328 0.0386 0.0712 -0.3025 0.4941 -0.2240 -0.4008 -0.3348 0.0903 0.0369 0.0342 0.0262 -0.2731 -0.1142 0.4263 0.0404 -0.0714 -0.1479 -0.0047 0.0877 0.0663 -0.1929 0.2381 0.1854 0.0476 -0.1075 -0.1563 -0.5457 -0.0456 -0.1235 -0.0353 0.1145 -0.0585 -0.0170 0.0593 -0.2671 -0.2174 0.3366 -0.2341 0.0063 0.1085 0.2089 0.1289 0.0991 0.3288 -0.0162 0.0339 0.0804 -0.4388 0.4653 -1.1245 -0.5482 -0.4490 -0.5014 -0.4927 -0.5926 -0.3851 -1.1043 -0.1028 -0.0535 0.1182 0.1642 0.0431 -0.0108 0.1743 0.1039 0.1443 0.1129 -0.1089 -0.0561 0.0212 -0.0688 -0.0892 -0.2402 0.1000 -0.1327 -0.1282 -0.1248 0.0329 0.0583 0.0253 0.1214 -0.0998 -0.0658 0.0080 -0.0844 -0.0025 -0.0520 -0.1289 0.0240 0.1575 0.1904 0.1494 0.0347 -0.1645 -0.0212 -0.0685 0.0186 0.0292 -0.1015 -0.0060 0.1150 0.0517 0.1113 0.1514 0.0586 -0.0379 -0.0415 -0.0668 0.1107 0.1478 0.0490 0.0982 -0.1093 -0.1612 0.0104 0.0079 -0.0079 0.0781 0.0058 0.1537 0.0634 0.0987 0.1195 0.0169 0.0861 -0.1106 -0.0782 -0.0731 -0.1284 0.0411 -0.1346 -0.0341 -0.3697 -0.1984 -0.2483 -0.1712 -0.0712 -0.0698 -0.1195 -0.0065 0.0298 -0.0566 0.0192 -0.0212 0.0632 -0.0289 -0.1237 -0.0618 0.0109 0.1963 -0.0311 -0.0135 -0.1161 -0.3329 -0.1309 -0.2343 -0.1851 -0.0743 -0.0757 0.1156 0.2289 0.0259 -0.0390 0.0523 0.1945 -0.1508 -0.0461 -0.0899 -0.0006 0.2202 0.0917 0.0579 -0.3667 -0.1668 -0.1207 -0.2562 -0.1813 -0.0597 -0.0472 0.0276 0.1759 0.0421 0.1332 -0.0162 0.0898 -0.1650 -0.0785 -0.0926 -0.0113 0.1008 -0.0055 0.0849 -0.1143 0.0537 -0.1007 0.0448 0.0204 -0.1054 0.0974 0.0163 0.2168 0.0439 0.1177 -0.0165 0.0646 -0.0046 -0.0155 -0.1690 -0.1091 -0.0691 0.2353 0.0085 -0.0074 -0.1493 -0.0019 -0.0065 -0.0905 -0.0873 0.0556 -0.0856 0.0266 -0.0213 0.1214 -0.0073 0.0770 0.0309 0.1175 0.0112 -0.0128 0.1121 0.1213 -0.0873 -0.0541 0.0339 -0.0395 -0.0420 -0.1734 -0.5615 -0.4026 -0.0317 0.2315 -0.0895 0.1848 -0.4720 -0.3554 -0.3693 -0.8849 0.2854 0.3444 0.0362 -0.0643 0.0003 -0.0478 -0.3267 -0.3979 -0.0909 -0.4801 -0.1123 0.4241 -0.3166 -0.1293 -0.2077 0.1361 0.0964 0.0341 -0.1208 -0.2648 0.0794 0.3987 -0.0232 -0.1999 -0.5331 -0.2364 -0.5909 0.1029 0.0989 -0.3469 0.1477 0.0233 0.0311 -0.0723 -0.0235 -0.0691 0.1946 -0.0827 -0.2097 0.0024 0.2787 0.2540 -0.3793 -0.1722 -0.3524 -0.0761 -0.6384 -0.7218 -0.2299 -0.1732 0.3529 0.1518 -0.2616 0.0038 -0.0785 0.3101 0.4394 0.1753 -0.0034 -0.4089 0.2483 -0.3973 -0.2057 -0.2139 -0.1567 -0.0918 -0.3837 0.0085 -0.0686 0.0921 0.0726 0.1935 -0.3172 -0.0720 -0.0755 0.3764 0.3892 -0.0151 -0.1826 0.3348 0.1752 0.2084 -0.2297 -0.2164 0.0157 -0.2695 -0.5270 0.0381 0.4625 0.2636 0.2509 0.0223 -0.1458 -0.2393 -0.0404 0.1971 0.2990 -0.0576 -0.1837 -0.3171 -0.5612 -0.2909 -0.2166 -0.1103 -0.1591 0.1375 -0.2058 0.4046 0.1919 0.2159 0.2368 -0.1935 -0.5705 -0.1511 -0.3562 0.2540 -0.1177 0.0130 -0.2270 0.0567 0.1206 0.1007 -0.2804 -0.3201 -0.1750 0.1546 -0.3358 -0.0130 0.3159 -0.2442 0.1836 -0.1443 -0.4280 -0.4412 -0.3960 0.0405 -0.1096 0.1585 -0.5148 0.0644 0.0221 -0.0678 -0.0818 -0.5318 -0.0017 -0.3325 -0.0176 0.1296 0.1900 0.1929 0.1315 0.0086 -0.4597 -0.4698 -0.5582 0.1200 -0.0781 -0.0359 -0.5679 -0.1409 0.0838 -0.0464 -0.2044 -0.1262 -0.1167 -0.3789 0.0605 -0.5496 -0.1401 -0.2147 0.2412 0.0339 -0.1056 -0.2350 -0.4188 0.0421 -0.1293 -0.1281 -0.2018 0.0043 -0.4540 -0.5666 0.3697 -0.3765 -1.8736 -0.3591 -0.2819 -0.1604 -0.5402 -0.5077 -0.1027 -0.1422 -0.0768 0.0009 0.0608 -0.0585 0.0800 -0.0033 -0.1471 -0.0543 -0.0826 -0.0152 0.0183 0.0550 -0.0815 0.0430 -0.0563 -0.1033 0.0480 -0.1338 -0.1196 -0.0278 -0.0567 -0.0169 -0.1221 -0.0664 -0.0878 0.0372 -0.0351 -0.0214 0.0346 -0.0109 -0.0417 -0.0259 -0.0028 -0.1422 0.0069 -0.1523 0.0040 -0.0985 -0.0545 -0.0143 -0.0146 -0.0798 -0.0897 0.0854 0.0859 -0.1195 -0.0370 -0.1221 -0.0857 0.0785 -0.1073 0.0656 0.0077 -0.0646 -0.0276 -0.0018 0.0385 -0.0336 -0.0245 0.0209 -0.0788 -0.0124 -0.0657 -0.0927 -0.0622 0.0224 -0.0577 -0.0590 -0.1105 -0.0471 -0.0248 -0.0757 -0.0284 -0.1289 -0.0710 -0.0228 -0.0788 0.0158 -0.0650 -0.1611 -0.0157 -0.0347 0.0541 -0.0649 -0.0808 -0.0168 -0.0231 -0.0113 -0.1028 -0.0337 0.0805 0.0290 0.0330 -0.0971 0.0237 -0.1486 -0.0150 -0.0870 -0.0567 0.0408 -0.1304 0.0145 -0.0189 -0.0414 0.0144 -0.0963 0.0515 0.0706 -0.0173 0.0441 0.0011 0.0650 0.0406 -0.0738 -0.0323 -0.1026 -0.0156 -0.0316 -0.1392 -0.0497 -0.1233 0.0237 -0.0546 -0.0094 -0.0182 -0.0160 -0.1161 -0.1166 -0.0947 -0.1286 0.0070 -0.0149 -0.0882 -0.0076 -0.0719 -0.1453 -0.0831 -0.0912 -0.0741 -0.1425 -0.0043 -0.0026 -0.0795 0.0112 -0.0193 -0.0751 0.0080 -0.0413 -0.1039 -0.0442 -0.0240 -0.0020 0.0460 -0.0897 0.0287 -0.0379 0.0344 -0.1181 -0.1363 -0.0610 0.0376 -0.0774 -0.0050 -0.0014 0.0145 -0.0125 -0.1052 0.0164 -0.0597 -0.0554 -0.0013 0.0653 0.0524 -0.0130 -0.0647 -0.0975 -0.1289 -0.0545 -0.2246 -0.1897 -0.2688 -0.0383 -0.1169 -0.0349 -0.2949 -0.2628 -0.3670 -0.6756 0.1009 -0.0651 -0.0241 -0.1334 -0.1162 0.0030 -0.3220 -0.1271 -0.0171 -0.1234 -0.1651 -0.0948 -0.0598 0.0601 -0.0566 0.0478 -0.1704 0.1138 -0.0885 -0.1010 0.0882 0.1051 -0.1451 -0.2141 -0.1516 -0.1098 -0.2475 -0.2388 -0.0225 -0.3255 -0.1313 0.1805 -0.0373 -0.1647 -0.1483 0.1398 0.0736 0.1406 -0.1349 -0.0055 0.0837 -0.0378 -0.0361 -0.1605 -0.1239 -0.0332 -0.1466 -0.0850 -0.1374 -0.0202 0.0105 -0.1273 -0.1657 -0.0241 -0.1916 0.0088 0.1809 -0.0394 0.0387 -0.1432 0.0311 -0.1171 -0.1982 -0.0926 -0.0614 -0.0353 -0.0463 -0.4304 0.0459 0.0021 0.0617 0.0999 -0.0558 0.0518 -0.1084 0.2524 0.0420 0.1109 0.0034 0.1031 -0.2693 -0.3851 -0.2710 -0.1645 -0.3053 -0.2012 -0.3587 0.1400 0.1740 0.1236 0.1838 0.0217 -0.1645 -0.1232 -0.0202 0.2316 0.0757 0.0298 0.2113 0.1046 0.0355 0.1102 -0.0252 -0.1063 -0.0588 -0.0748 -0.1130 0.0259 0.0966 -0.0985 -0.0201 -0.0851 -0.0224 -0.0499 -0.2320 0.0681 0.1236 0.0558 0.0182 0.0388 -0.0746 -0.2788 -0.0376 -0.2405 -0.1476 -0.1623 -0.0057 -0.0721 0.1193 -0.0102 0.1908 0.0698 -0.1057 -0.2294 -0.1260 -0.0202 0.0400 0.0748 -0.1275 0.0408 0.1259 -0.0383 -0.1671 -0.3637 -0.0053 -0.2215 0.0789 -0.0812 -0.0274 0.0003 -0.0507 -0.1628 -0.1296 -0.2129 -0.3555 0.1783 -0.0708 -0.0549 -0.0454 -0.0204 0.0259 -0.2598 0.0776 -0.1383 -0.1248 -0.2068 -0.1016 -0.2495 -0.0430 -0.1456 0.1334 -0.0379 -0.0813 -0.1460 -0.2051 0.0078 -0.1364 -0.1354 -0.2315 -0.0731 -0.1219 -0.1865 -0.2027 -0.2706 -0.4235 -0.7548 -0.2240 -0.2489 -0.3186 -0.6107 -0.0589 0.0606 -0.0713 -0.1570 -0.1074 -0.0819 -0.2767 -0.2004 -0.0146 -0.1295 -0.0257 -0.0427 -0.1372 0.0816 -0.0927 0.1204 -0.0540 -0.0129 0.0698 -0.0040 -0.1155 0.0586 0.0555 -0.0724 -0.1664 -0.1773 -0.1838 -0.1739 -0.1030 -0.0929 -0.1438 -0.1600 -0.0183 -0.0595 -0.0335 -0.0919 -0.0360 -0.0706 -0.0367 0.1266 0.0099 -0.0182 0.0597 -0.0959 -0.0115 -0.1340 -0.0679 -0.2050 -0.0328 -0.1575 0.0574 -0.0732 -0.0849 0.0604 0.0647 -0.1126 -0.0234 -0.1263 0.0098 -0.0485 -0.1535 -0.0930 0.0562 -0.1742 0.0735 0.1210 -0.1439 -0.0645 0.0429 -0.1061 -0.0154 -0.1643 -0.1552 -0.1344 -0.1325 0.1040 0.0543 -0.0171 -0.0745 -0.0102 -0.0493 -0.2373 -0.2418 -0.1212 -0.0108 -0.2151 -0.1675 0.0584 0.0484 0.1396 0.0551 0.1772 -0.0211 -0.0121 0.0581 0.0490 -0.0239 0.0852 0.1308 0.0122 -0.1054 -0.0371 -0.0908 -0.0580 0.0936 0.0048 -0.1125 0.0464 0.0556 0.0201 -0.0777 -0.1671 0.0011 0.0281 -0.0421 0.0317 -0.0964 0.0499 -0.0885 0.0091 -0.0262 -0.1745 -0.0289 -0.1023 0.0390 -0.0433 -0.1305 -0.1101 -0.0531 -0.1452 0.0843 -0.1393 -0.0137 -0.1196 -0.1152 -0.0614 -0.0827 -0.0075 0.0426 0.0993 -0.0583 -0.0748 0.0162 -0.1513 -0.0290 -0.1603 0.0148 -0.0737 -0.1304 -0.1150 -0.0728 -0.1232 -0.1077 -0.1376 -0.0862 -0.0900 -0.1291 -0.0965 -0.1486 0.0205 0.0593 -0.1954 -0.0821 -0.0683 -0.1344 -0.0922 0.0031 -0.1562 0.0091 -0.1698 -0.0912 -0.0297 -0.1940 -0.0549 -0.1223 0.0213 0.0127 0.0100 -0.0314 -0.0048 -0.1661 -0.0458 -0.4186 -0.2680 -0.2701 -0.4739 -0.3795 -0.2647 -0.2282 -0.6874 -0.0629 -0.1477 -0.1455 0.0477 -0.0107 -0.0618 -0.1673 -0.1591 -0.1480 -0.0843 -0.0246 -0.1069 -0.1974 -0.0478 -0.0767 0.0019 -0.0918 0.0257 -0.1020 -0.1797 0.0361 -0.1200 -0.0605 -0.2236 -0.0179 -0.0612 -0.2181 -0.0855 -0.0007 -0.0879 0.0437 0.1548 -0.0608 -0.0439 -0.0424 0.0660 0.1487 0.0258 -0.0714 -0.0118 -0.1416 -0.1365 -0.1465 -0.0277 -0.1853 -0.0313 -0.3386 -0.1184 -0.0333 0.1028 -0.0261 -0.0725 -0.0223 -0.1111 -0.1419 0.0060 0.1043 -0.0667 0.0417 -0.0301 -0.0201 -0.0353 -0.1304 -0.0788 -0.1256 0.0975 -0.2070 -0.1543 -0.1066 -0.0763 -0.0200 -0.0390 -0.1296 -0.0431 0.0026 0.1544 0.0205 0.0516 0.0946 0.0618 -0.1550 -0.1504 -0.1117 0.0014 -0.0201 -0.1397 -0.1625 -0.0155 0.1396 0.1545 0.1852 0.0922 -0.0979 -0.0107 -0.0533 0.0455 0.1835 0.0016 0.0793 -0.0118 0.0515 -0.1229 -0.0698 -0.0841 -0.0325 -0.1142 -0.0907 -0.1875 -0.0997 -0.0304 0.1135 -0.1487 -0.0499 -0.0587 0.0212 0.1539 0.0312 0.1548 0.0531 0.0696 -0.0567 -0.0823 -0.1096 -0.3045 -0.1551 -0.0152 0.0332 -0.1877 -0.0324 -0.0763 0.0318 0.1146 -0.0588 -0.0896 -0.1160 -0.0322 -0.0056 -0.0352 0.0122 0.1640 -0.0129 -0.0483 -0.0452 -0.2819 -0.0728 -0.0946 -0.0549 -0.0023 -0.1461 -0.0622 0.0100 0.1004 0.0497 -0.2459 -0.2563 -0.0165 -0.1066 -0.1093 -0.0514 -0.1077 -0.0338 -0.1990 0.0181 -0.0231 -0.0285 -0.2064 0.0515 -0.1288 -0.0161 -0.0134 0.1271 -0.0853 -0.0889 -0.1757 -0.0458 -0.0020 -0.0493 -0.1441 -0.0163 -0.1160 -0.2401 -0.2906 -0.2377 -0.2927 -0.3067 -0.1823 -0.3008 -0.2427 -0.2736 -0.6215 0.4724 -0.0974 0.2307 0.0087 -0.0361 -0.0314 0.2816 -0.2092 -0.3391 -0.1287 -0.2895 0.3052 0.4739 0.1101 0.2885 -0.2450 -0.0580 0.3205 -0.2362 0.0343 0.0946 0.2474 -0.0560 0.2356 0.0202 0.3819 -0.1926 -0.0197 -0.1291 0.1149 -0.0710 0.2706 0.1591 -0.2686 -0.0770 -0.2579 0.1176 0.4973 -0.1557 0.0132 0.4000 -0.1617 0.3713 0.2563 0.1325 -0.0424 0.1667 0.1976 -0.1332 -0.0367 -0.3703 0.1276 -0.2002 -0.1409 0.2947 -0.0765 -0.0162 0.2425 -0.0262 -0.1143 0.0891 -0.4163 0.2386 0.1821 0.3685 -0.1169 0.0673 -0.2725 0.0032 0.3125 -0.1594 -0.1707 0.5034 0.0398 0.1215 -0.7073 -0.0022 -0.2868 -0.2148 0.2301 -0.3354 -0.0533 -0.0752 0.2627 0.0915 0.0611 -0.0324 -0.2700 0.0811 0.5835 -0.0054 -0.1433 0.1666 -0.3001 -0.1518 -1.1087 -0.4369 0.2502 -0.3973 0.1655 -0.0695 0.2055 0.4024 0.4299 0.2459 -0.0716 -0.0097 -0.2227 0.0394 0.4475 0.1012 0.2809 -0.0378 -0.0315 -0.3699 -0.4972 -0.6086 -0.7512 -0.2124 -0.0173 0.1326 0.0338 0.1740 0.1263 0.4224 0.0825 0.1161 0.0896 -0.2761 -0.1697 0.1418 -0.6248 0.2327 0.2786 0.1688 -0.1576 -0.3042 -0.3351 -0.1085 0.7079 -0.2205 -0.0130 -0.1064 0.1454 0.0418 0.4151 -0.0887 0.9901 -0.2872 0.4342 -0.0779 -0.5393 0.4252 0.3007 -0.4768 -0.6936 -0.2630 -0.0680 -0.3235 0.5997 -0.3448 -0.4446 -0.0030 -0.0519 0.2367 -0.0643 -0.0026 0.4496 0.2966 0.1283 0.1631 -0.1457 0.1074 -0.1277 -0.2875 0.2464 -0.3626 0.0089 -0.2321 0.2618 -1.2859 0.0518 -0.1455 0.1684 -0.1539 0.5665 -0.3979 -0.7356 -0.5357 -1.4190 -0.0530 -0.0422 -0.0511 -0.0822 -0.1493 -0.0503 -0.1191 -0.0600 -0.0419 -0.0332 -0.0520 -0.1858 -0.1257 0.0095 -0.1616 0.0982 -0.2020 0.0395 -0.0870 -0.0262 -0.0679 -0.0454 0.0250 -0.1451 -0.0291 -0.1162 -0.2235 -0.1827 -0.0943 -0.1026 -0.0007 -0.0802 -0.1194 -0.0553 -0.0326 -0.0490 0.0330 -0.0725 -0.1020 -0.1151 -0.0328 -0.0869 0.0611 -0.1540 -0.0734 -0.1387 -0.2225 -0.0994 -0.1109 -0.0111 0.0600 -0.0393 0.0187 0.0142 -0.1005 0.1480 -0.0298 -0.0594 -0.0304 0.0241 -0.1074 0.0089 -0.0445 -0.1371 -0.2076 -0.0778 -0.2242 -0.2489 -0.1015 0.0318 0.0626 -0.0066 -0.1964 -0.0487 0.0919 0.1916 -0.0601 0.0317 0.0202 0.1731 -0.0443 0.0536 -0.0372 -0.1425 0.0253 -0.1194 -0.1726 -0.1854 0.0483 0.0139 0.0264 -0.0097 -0.0649 -0.1156 -0.1126 0.1589 -0.0769 -0.0294 0.0244 -0.0877 -0.0844 -0.1929 -0.0589 -0.0646 -0.0931 -0.0313 -0.1287 -0.0881 -0.1334 -0.1264 -0.0099 0.0245 -0.0824 0.0610 0.0422 0.0466 0.0851 0.1860 0.1157 0.0257 -0.1482 -0.0578 -0.0270 -0.0290 -0.0754 -0.0709 -0.0883 -0.0620 -0.0202 -0.0616 -0.0691 -0.0563 -0.0753 -0.0349 -0.1289 0.0951 -0.1461 -0.0043 -0.0444 0.0376 -0.0903 -0.1096 0.0816 -0.1574 -0.0349 -0.2336 -0.0372 -0.1733 -0.0642 0.0558 -0.0619 -0.0795 -0.0810 -0.0546 -0.0781 -0.0185 0.0188 -0.0514 -0.0092 -0.0693 0.0218 -0.0563 -0.0424 -0.1657 -0.1380 -0.0563 -0.0425 -0.2220 -0.1600 -0.1469 -0.1208 0.0026 -0.0994 -0.1407 -0.0052 -0.0899 -0.0590 -0.1028 -0.0453 -0.0801 -0.2941 -0.2404 -0.1615 -0.5122 -0.6928 -0.4270 -0.2059 -0.2747 -0.3316 -0.5430 0.0223 -0.0269 -0.1197 0.0591 0.0522 0.0452 0.0285 -0.0812 -0.0935 0.0338 -0.1181 -0.0659 -0.0733 -0.0085 -0.1159 0.0185 0.0291 -0.1166 -0.1169 -0.0241 -0.0128 -0.0695 -0.0840 -0.0419 -0.0737 -0.1142 -0.1114 -0.0857 -0.1281 -0.0068 0.0051 0.0000 0.0251 -0.0426 0.0225 0.0231 -0.1195 -0.1080 -0.0506 -0.0641 -0.0916 0.0058 -0.0222 0.0202 -0.0036 -0.1294 -0.0549 -0.0488 -0.0023 -0.1223 -0.1178 -0.0801 0.0553 -0.0401 0.0236 -0.0823 -0.0565 0.0143 0.0507 0.0644 -0.1258 0.0058 -0.0590 -0.0191 -0.0570 -0.1032 -0.0189 -0.1469 -0.1556 -0.0443 0.0552 -0.0227 -0.0202 -0.0390 0.0260 0.0993 0.0176 -0.0869 0.0143 -0.0219 0.0085 -0.0147 -0.0480 0.0381 -0.0257 -0.0979 -0.0075 -0.0280 -0.1017 -0.0387 -0.0587 0.0105 -0.0138 -0.1036 -0.0016 -0.0716 -0.0490 -0.0781 -0.0556 -0.0978 -0.1316 -0.0652 -0.0325 0.0622 -0.0639 -0.0583 -0.0041 0.0349 -0.0619 0.0242 -0.0601 -0.0643 0.0454 0.0806 -0.0884 -0.0824 -0.0338 0.0549 -0.0478 -0.0107 0.0522 -0.0086 -0.0125 0.0148 0.0082 -0.0849 -0.1056 -0.1081 0.0159 -0.1313 0.0111 -0.0809 0.0405 0.0609 -0.0677 -0.0326 -0.0674 -0.1283 -0.0862 -0.0692 -0.0601 -0.0451 -0.0114 0.0046 -0.0692 -0.0245 -0.0151 0.0314 -0.1266 -0.1223 -0.0606 -0.0542 -0.0301 -0.0968 -0.0843 0.0181 0.0179 -0.0285 -0.0316 0.0478 0.0073 -0.1461 -0.0292 0.0394 0.0481 -0.0091 0.0323 -0.0562 -0.0074 -0.0813 -0.0917 0.0312 -0.0274 -0.0576 -0.0247 -0.0920 0.0012 -0.1277 -0.0295 -0.0890 -0.2814 -0.0940 -0.3449 -0.2834 -0.2340 -0.1514 -0.3098 -0.3807 -0.3199 -0.5834 -0.0754 -0.0563 -0.1038 0.0984 -0.0117 0.0522 -0.0336 0.0010 0.0480 -0.0888 -0.1086 -0.0126 0.0598 0.0379 -0.0072 0.0242 -0.0092 -0.0169 0.0124 -0.0673 -0.1457 -0.0405 -0.1113 -0.0017 0.0259 0.1082 0.0408 -0.0070 -0.0699 -0.0248 0.0157 -0.0006 -0.0531 -0.0766 -0.1028 -0.1542 0.0155 0.0228 0.0271 0.0477 -0.0061 -0.0442 -0.1148 -0.0025 0.0717 -0.0517 -0.0098 -0.0187 -0.0220 0.0400 0.0019 0.0314 0.0309 0.0322 0.0648 -0.1239 0.0090 0.0221 -0.0007 -0.0591 0.0125 -0.1340 -0.0348 -0.0526 0.0296 0.0098 0.0092 0.0140 -0.0634 -0.0708 -0.0314 -0.0117 -0.0132 0.0903 -0.0108 -0.1528 -0.0104 0.0043 -0.0534 -0.1180 0.0361 -0.0723 0.0466 -0.0733 -0.0748 -0.0538 -0.0566 -0.0484 -0.0421 -0.0768 0.0059 -0.0219 -0.0183 -0.0924 0.0046 -0.0532 -0.1322 -0.1383 -0.0974 -0.1398 -0.1044 -0.0080 -0.0821 0.1122 0.0456 -0.0548 -0.0024 0.0487 -0.1295 0.0700 -0.0038 0.0082 0.0768 -0.0079 -0.0359 -0.1518 -0.0794 -0.1835 -0.0963 0.0252 -0.1148 -0.0434 -0.0215 -0.0544 -0.0859 0.0747 0.0206 0.0217 -0.0651 -0.0132 -0.1305 -0.0804 0.0447 0.0776 -0.0743 -0.0659 -0.0535 -0.1232 0.0489 -0.0357 0.0237 0.0197 0.0072 -0.0324 0.0547 0.0771 0.0036 -0.0065 -0.0497 -0.0692 -0.1263 -0.0666 0.0031 -0.0615 0.0130 -0.1298 0.0260 -0.1303 0.0205 -0.0584 -0.0902 -0.0130 -0.0818 0.1070 -0.0694 0.0703 0.0300 -0.0750 0.0480 0.0124 -0.0597 -0.0988 -0.0659 0.0724 -0.0072 -0.1079 -0.0027 -0.1138 -0.0416 -0.1092 -0.2235 -0.1915 -0.2943 -0.0089 -0.1327 0.0314 -0.4201 -0.2697 -0.4715 -0.6441 -0.0401 -0.0187 -0.1070 0.0322 0.1058 -0.0574 0.0360 -0.0710 -0.0627 0.1035 -0.1359 -0.0353 0.1560 -0.0406 0.0984 -0.0162 0.0691 -0.2231 0.0293 -0.0502 0.0551 -0.0201 -0.0213 0.0859 0.0343 0.0507 0.0780 -0.0658 -0.1408 -0.0518 -0.0004 -0.0426 0.0942 0.0148 0.0637 -0.1305 -0.1159 -0.1118 -0.1168 0.0468 -0.0127 -0.0869 -0.1035 0.1212 0.1048 0.1318 0.1789 -0.0497 0.0085 -0.1360 -0.0733 -0.0471 0.0855 -0.0144 0.1390 0.0400 -0.0998 -0.0240 -0.0584 -0.0185 -0.0038 -0.0296 0.0084 0.1344 0.0691 -0.0014 -0.0145 0.0473 0.0267 -0.0559 -0.1342 -0.0460 0.1369 -0.0146 -0.1496 -0.2791 -0.0043 -0.2410 -0.0372 -0.0523 -0.0954 -0.0420 -0.0311 0.1362 0.1725 0.1296 0.1821 -0.0189 -0.0222 0.0402 -0.1605 -0.1557 0.1729 0.0609 0.0247 -0.2682 -0.0531 -0.1524 -0.1608 -0.1252 -0.1181 -0.1049 -0.0734 0.1338 0.0659 0.0554 -0.0410 0.0709 -0.0606 -0.0653 -0.0600 -0.0191 0.1792 0.0529 -0.1892 -0.2769 -0.0911 -0.2019 -0.1056 -0.0950 -0.1164 -0.0492 0.0015 0.0873 0.1269 0.0917 0.1016 -0.0346 -0.1061 -0.0134 -0.0391 0.0605 -0.0658 -0.0133 0.0655 -0.1910 -0.1162 -0.1849 -0.0360 -0.0345 -0.0369 -0.0686 -0.1217 0.0267 -0.0214 0.2185 0.0781 0.1692 0.0208 0.0149 -0.1147 -0.0321 -0.0767 -0.0442 -0.0888 -0.1594 -0.1026 -0.0982 -0.1243 -0.0116 -0.0378 -0.1119 -0.0759 0.0441 0.0420 0.0781 0.0842 0.0896 -0.1039 0.1047 -0.1191 -0.0253 0.1094 0.0702 0.0234 -0.0516 0.1217 0.0790 -0.0026 0.0069 -0.5402 -0.0189 -0.1666 0.0766 0.0598 0.0526 -0.2509 -0.3701 -0.4080 -0.7865 0.0196 -0.0441 -0.0240 -0.0013 0.0570 0.0032 -0.1900 -0.1310 -0.2072 0.0498 -0.2569 0.0428 0.0529 -0.1223 -0.1214 0.2605 0.0390 0.0641 -0.3036 -0.0960 -0.0007 0.2989 0.1168 -0.1953 -0.0544 -0.2384 -0.2709 -0.2183 0.2095 -0.4018 -0.3260 0.1064 -0.1643 -0.1984 -0.1554 0.1372 0.2041 0.1460 -0.3344 0.2158 0.3160 0.0717 0.0305 -0.0580 -0.1613 -0.0806 -0.5932 -0.4706 -0.2644 -0.2066 -0.0732 0.4407 -0.3199 0.1408 0.1772 0.0524 0.2909 -0.0404 -0.1691 -0.1343 0.5638 0.6370 0.2952 -0.0605 0.3145 0.3232 -0.1954 -0.8475 -0.0332 -0.1709 -0.4373 -0.0525 -0.2438 0.0446 -0.2256 0.0086 0.2461 -0.2168 -0.3723 -0.0880 -0.1135 -0.2932 -0.1825 0.0184 -0.3515 -0.3226 -0.7708 -0.1596 0.1460 0.3907 0.3347 0.4036 -0.2904 -0.1311 0.0400 0.4759 0.3245 0.0852 0.0769 0.0173 -0.2865 -0.1759 -0.1878 -0.0644 0.1246 0.1937 -0.1406 0.1099 0.3217 0.2519 -0.3927 -0.3119 -0.1824 0.0170 -0.2407 0.1167 0.1312 0.1478 -0.0230 0.0693 -0.4956 -0.4235 -0.2625 -0.3341 -0.1425 -0.2085 -0.0709 0.2502 0.3175 0.1346 0.2007 0.1701 -0.3294 -0.4292 -0.1056 -0.0155 -0.1232 0.1320 0.0533 0.1347 -0.1259 0.2739 -0.1550 -0.3538 0.1580 0.0961 0.0771 0.1949 -0.1642 -0.2124 -0.4292 -0.5232 0.0341 -0.3477 -0.6106 0.0928 -0.1616 0.0853 -0.2631 -0.1451 -0.1018 -0.2426 -0.1850 -0.3370 0.0801 -0.4919 -0.0909 -0.2235 0.1218 -0.0685 0.1423 0.0275 -0.2434 -0.3061 -0.3879 0.1348 -0.0704 0.0235 -0.1709 -0.0102 0.0753 -0.2109 -0.4566 -1.7274 -0.4835 -0.5875 -0.1069 -0.2511 -0.2866 -0.5293 -0.1279 0.0228 -0.1243 -0.0524 0.0254 -0.1124 -0.2023 -0.0790 -0.1353 -0.0910 0.0565 -0.1365 -0.1556 0.0455 -0.1248 -0.0987 -0.0153 0.1347 -0.1134 -0.0391 0.1154 0.1481 0.0561 -0.0161 -0.1822 -0.0297 -0.0501 -0.2163 -0.0237 -0.0545 -0.0004 0.1092 -0.0819 -0.0373 -0.0227 0.0403 -0.0321 -0.0923 -0.0414 -0.0264 0.0671 -0.1754 -0.0654 -0.0905 -0.1514 -0.0646 -0.2098 -0.1337 -0.1054 0.0155 -0.0598 -0.0604 -0.0319 -0.1179 -0.0756 0.0502 0.0936 -0.0154 -0.0898 -0.0280 -0.0467 -0.0774 -0.0430 -0.0709 -0.1357 -0.0508 -0.1842 -0.2927 -0.0284 -0.0688 0.0553 -0.0338 -0.0384 -0.0058 0.0648 0.0932 0.0718 0.0049 0.0309 0.0910 -0.1592 -0.0640 -0.1570 -0.0701 -0.0562 -0.0220 -0.1518 0.0123 0.0278 0.0710 -0.0354 0.0624 -0.0750 -0.0508 -0.1180 0.1027 0.0854 0.0674 0.0418 0.0244 0.0677 -0.0575 0.0445 -0.0876 0.0439 -0.0352 0.0915 0.0497 -0.1654 -0.0793 -0.0544 -0.0213 -0.0146 -0.0739 -0.1846 0.0644 0.1195 -0.0214 -0.0826 0.0402 -0.0306 0.0009 -0.0167 -0.0970 0.0401 -0.1109 0.0583 -0.0304 0.0550 -0.1580 0.0154 0.0335 -0.0115 -0.1252 -0.0671 -0.0683 -0.0756 -0.1032 -0.1498 -0.0629 0.1067 -0.0133 -0.1320 -0.1112 -0.1296 -0.0645 -0.0622 -0.1450 -0.1232 0.0097 -0.0938 -0.0741 -0.0116 -0.1116 -0.1742 0.0070 -0.0849 -0.1106 -0.1309 -0.0029 0.0506 -0.2304 -0.0112 -0.1064 -0.0682 -0.2092 -0.0324 -0.1404 0.0322 -0.1292 -0.0522 -0.0615 -0.0270 -0.0575 -0.1749 -0.0914 -0.1089 0.0028 -0.1694 -0.1011 -0.1854 -0.2149 -0.2392 -0.1199 -0.4620 -0.4925 -0.2133 -0.2926 -0.4108 -0.6110 -0.0817 0.0144 -0.0907 0.0806 -0.0371 -0.0407 -0.0486 -0.0132 -0.0002 0.0303 0.0112 -0.0406 -0.0222 0.0197 -0.1020 -0.0367 -0.0027 -0.0001 -0.0041 0.0498 0.0458 0.0146 -0.0089 0.0188 -0.0320 -0.0408 -0.0313 -0.0034 -0.0582 0.0564 0.0466 -0.0584 -0.0153 -0.0560 0.0475 -0.0974 -0.0274 -0.0940 -0.1082 -0.0038 0.0129 0.0219 -0.1145 -0.0054 0.0429 -0.0425 -0.0109 0.0353 0.0149 -0.1218 -0.0968 -0.0029 -0.0081 -0.0868 -0.0335 -0.0533 -0.0679 0.0295 -0.0968 -0.0238 -0.1052 -0.0357 -0.1150 0.0847 0.0031 -0.0558 0.0055 -0.0612 0.0056 -0.0635 0.0081 -0.0087 -0.0098 -0.0037 -0.0231 -0.1400 -0.0303 0.0018 -0.0811 -0.0325 0.0207 -0.0476 -0.0282 0.0155 -0.0570 0.0124 -0.0077 -0.1175 -0.1184 -0.1058 -0.0811 0.0455 0.1063 -0.0063 -0.0393 -0.1053 -0.1095 -0.2029 0.0170 -0.0228 0.0352 -0.0640 -0.0912 -0.0548 -0.0028 0.0865 -0.1063 0.0056 -0.1161 -0.0267 0.0058 -0.0806 0.0519 0.0584 0.0089 -0.0185 -0.1270 -0.1670 -0.0060 -0.0207 -0.0707 -0.1112 -0.0887 -0.0126 -0.0979 0.0268 0.0474 0.0239 0.0425 -0.0394 -0.0647 0.0349 0.0336 -0.0263 -0.0536 -0.1023 -0.0655 -0.0621 -0.0702 -0.1145 -0.0895 -0.0545 -0.0074 -0.0447 0.0406 0.0466 -0.0416 0.0602 0.0210 -0.0702 -0.1082 -0.0122 0.0796 0.0759 0.0312 -0.0367 0.0504 0.0489 -0.0050 0.0075 -0.0651 -0.0866 -0.0425 -0.0639 -0.0049 0.0909 -0.0022 0.0280 -0.0218 0.0645 0.0424 -0.0650 -0.0938 0.0568 -0.0108 -0.0888 0.0405 -0.0811 0.0627 0.0675 -0.2783 -0.2049 -0.3023 -0.1277 0.0520 -0.0717 -0.3015 -0.3990 -0.3336 -0.7273 -0.1437 0.0055 0.0862 0.0365 -0.0632 -0.0371 0.0793 -0.0249 -0.0992 0.0541 0.0137 0.0254 0.1157 -0.0494 -0.0683 -0.0966 -0.0282 -0.0730 -0.0725 -0.1013 -0.1247 -0.0697 -0.0513 0.0851 -0.0202 -0.0134 0.0229 -0.0281 0.0232 0.0587 -0.1068 -0.1236 0.0663 -0.0404 -0.0110 -0.1051 0.0016 -0.0674 -0.1444 -0.1349 0.0605 -0.0320 0.0378 0.0946 0.0307 0.1117 0.1498 -0.1291 -0.0097 -0.0363 0.0186 -0.0642 0.0812 -0.0903 -0.0355 -0.0387 -0.0398 -0.0725 -0.1089 -0.0856 0.0452 -0.0786 0.0330 0.0386 0.0969 0.0100 0.0078 0.0221 0.0097 -0.1811 -0.0858 -0.0650 0.0419 -0.0688 -0.1522 -0.2109 -0.0746 -0.2468 -0.0763 -0.0484 -0.1125 -0.1004 -0.0228 -0.0150 -0.0381 0.0386 0.2010 -0.0163 -0.0502 -0.1090 -0.1276 -0.0692 0.0886 -0.1002 0.0063 -0.3763 0.0307 -0.1251 -0.1577 -0.0995 -0.0026 -0.0734 -0.0885 0.1277 -0.0357 0.0741 0.0170 0.1004 -0.1086 0.0487 -0.1375 0.0112 0.0612 -0.0638 -0.1035 -0.1143 -0.0347 -0.0833 -0.1491 -0.0757 -0.1049 -0.1223 -0.1248 0.0430 0.0546 0.0226 0.0206 -0.0598 0.0160 -0.0221 -0.0239 -0.0120 -0.0914 0.0714 0.0720 -0.0333 0.0647 -0.1740 -0.0390 -0.0385 -0.0223 0.0574 -0.0862 0.0872 0.0013 0.1151 0.0767 0.0504 -0.0497 -0.0034 0.0029 -0.1366 0.0431 0.1021 0.1018 0.0507 -0.0304 0.0062 -0.1527 -0.0180 0.0027 -0.0889 -0.0135 0.1527 -0.0376 0.1357 0.0873 -0.0075 -0.0584 -0.0057 -0.1040 -0.0691 0.0480 -0.0528 0.0148 0.0438 -0.0772 -0.0984 -0.0324 0.0658 -0.3606 -0.1033 -0.2843 0.1921 0.1214 0.0096 -0.3593 -0.3654 -0.3213 -0.7004 -0.0101 -0.0803 -0.0188 -0.0656 -0.0320 -0.0648 -0.0358 0.0265 0.0080 0.0214 0.0204 -0.0001 -0.0435 -0.0305 0.0397 -0.0742 0.0442 -0.0112 -0.0133 -0.0332 0.0468 -0.0265 -0.0114 0.0079 0.0735 0.0480 -0.0493 0.0132 -0.1280 -0.0599 -0.1314 -0.0429 -0.0578 0.0896 0.0729 -0.1590 0.0359 -0.0080 -0.1108 0.0094 -0.0168 -0.0560 -0.0094 0.1260 0.0618 0.1078 0.0180 -0.0087 -0.1259 -0.1175 -0.0463 0.0414 -0.0296 0.0305 0.0001 -0.1085 0.0136 -0.0781 -0.0525 -0.0702 -0.0227 0.0066 -0.0116 0.1058 0.0884 -0.0728 0.0066 -0.0508 0.0161 -0.1117 -0.0944 -0.1025 0.0943 -0.0259 -0.0442 -0.1653 -0.1313 -0.0325 -0.0253 -0.0144 0.0751 -0.0953 0.1186 0.0923 0.0247 0.1358 0.1427 -0.0369 -0.0868 -0.0722 -0.0846 -0.1276 0.1333 -0.0144 -0.0599 -0.2084 -0.0844 -0.0615 -0.1035 -0.1794 -0.1393 0.0156 0.0009 0.0827 -0.0799 -0.0293 -0.0962 -0.0401 -0.0701 0.1033 -0.0766 -0.0465 0.0501 -0.0957 -0.1070 -0.1429 -0.0722 -0.1386 -0.0865 -0.1664 -0.0379 0.0091 -0.1323 -0.0332 0.0565 0.0528 0.0382 -0.0578 0.0107 -0.1079 -0.1370 -0.0413 -0.0440 0.1122 -0.0511 -0.1195 0.0892 -0.1604 -0.1639 0.0342 -0.1129 0.0063 0.0431 0.1207 0.0883 0.0415 -0.0237 0.0481 -0.0874 0.0482 0.0296 -0.0909 0.0572 0.0552 0.0585 -0.1248 0.0722 -0.1044 -0.0850 -0.0618 -0.0652 0.0208 -0.0302 0.1031 -0.0544 0.0750 -0.0049 0.0086 -0.0051 -0.0160 0.0638 -0.1110 0.0873 -0.0704 0.0602 -0.0989 0.1016 -0.0469 -0.0352 -0.0113 -0.4049 -0.0364 -0.3274 0.0449 -0.0473 -0.0379 -0.3252 -0.3365 -0.3455 -0.7185 0.0239 -0.0209 -0.0652 0.0266 -0.0775 -0.0145 0.0510 -0.0386 -0.0581 -0.1069 0.0012 -0.0942 0.0891 -0.0056 0.0181 -0.0904 -0.0896 -0.1321 -0.0144 0.0062 0.0204 -0.0587 -0.0368 0.0093 0.0033 -0.0369 0.0712 -0.0815 -0.0380 0.0236 -0.0523 0.0401 0.0136 0.0063 0.0596 -0.1503 -0.0375 0.0075 -0.1214 0.0332 -0.0658 0.0122 -0.0469 0.1087 -0.0871 -0.0485 -0.0396 -0.1575 -0.0535 -0.0655 -0.0730 0.0217 0.0518 -0.0317 -0.0748 -0.0076 0.0367 -0.0336 -0.0468 0.0452 0.0547 -0.1318 -0.0528 -0.0483 0.0395 -0.0630 -0.0492 -0.0850 -0.0420 0.0146 -0.0518 0.0317 0.0722 0.0636 0.0347 -0.0736 0.0467 -0.1398 -0.0124 -0.0049 0.0380 -0.0232 0.0085 0.0300 -0.0145 0.0385 0.0926 -0.0443 -0.0580 0.0567 -0.1332 -0.0770 0.0859 -0.0640 0.0511 -0.0452 -0.1059 -0.1141 -0.0835 -0.1130 -0.0096 -0.0259 0.0233 0.0631 -0.0662 -0.0619 -0.0517 -0.0694 -0.0443 0.0771 -0.1189 0.0492 -0.0745 -0.0441 -0.0255 -0.1260 -0.0819 -0.0516 -0.1128 -0.1476 -0.0490 -0.1277 -0.0734 0.0305 -0.0968 0.0677 0.0518 0.0168 -0.0772 -0.0463 0.0251 -0.1275 -0.0495 0.0250 0.0380 -0.0535 -0.0269 -0.1313 0.0125 -0.1022 -0.1198 -0.0990 0.0109 0.0519 -0.0853 -0.0379 0.0809 -0.0620 -0.0213 -0.0060 -0.1168 -0.0257 -0.0094 0.0496 -0.1073 -0.0159 -0.1007 -0.0851 -0.0337 -0.1391 -0.0850 0.0291 -0.1149 -0.0207 0.0816 0.1079 -0.0532 -0.0963 0.0058 -0.0011 0.0352 -0.0710 0.0426 0.0580 -0.0476 -0.0385 -0.0793 -0.0638 0.0211 -0.1159 -0.2698 -0.0980 -0.3145 0.0212 -0.0932 -0.1449 -0.3274 -0.3087 -0.3768 -0.6709 -0.0612 -0.1384 -0.0098 0.1356 -0.0788 0.0065 0.0601 0.1071 -0.1150 0.0593 -0.1791 0.0763 0.1809 -0.0011 0.1003 0.0882 0.1780 -0.0754 0.0033 -0.1876 0.0438 0.1168 0.1430 0.1240 0.0476 -0.0411 0.0155 0.0383 -0.0533 0.1163 -0.1154 -0.0272 0.0138 0.0412 -0.0770 -0.0822 -0.0487 -0.1988 -0.0549 -0.0584 0.0322 0.0415 -0.0115 0.1721 -0.0018 -0.0263 0.0491 -0.0194 -0.0249 0.0905 0.0703 -0.1622 0.1026 0.0327 -0.0634 -0.1388 -0.0569 -0.0300 -0.0652 0.0570 0.0575 -0.2148 -0.0527 -0.0228 -0.1614 -0.0217 -0.0160 -0.0167 0.1338 -0.1457 0.0367 0.1546 0.1333 0.0237 -0.0184 -0.1756 -0.0540 -0.0216 -0.1264 -0.0806 0.2015 0.0596 0.2484 0.2028 0.1614 0.1944 0.1697 -0.1698 -0.2228 -0.0666 -0.2575 -0.0140 0.2265 -0.0785 -0.1538 -0.3905 -0.1350 -0.2572 -0.3015 -0.2520 -0.1924 0.0070 -0.0537 0.1264 -0.0284 -0.1584 -0.0484 0.1204 0.1398 0.0351 0.0760 -0.0629 -0.0143 -0.0852 0.0226 -0.2693 -0.0021 -0.2639 -0.0660 0.0625 -0.0172 0.0133 -0.0901 0.0547 -0.1104 -0.0194 0.0550 0.1695 -0.0221 -0.0162 -0.1724 -0.1410 0.0837 0.0895 0.1360 -0.1162 0.2339 -0.0174 -0.0148 -0.0337 -0.1506 -0.0651 0.0127 0.0974 -0.1827 0.1412 0.0450 -0.0377 0.1130 0.0039 0.0024 0.0165 0.0265 0.1345 0.0841 0.0486 -0.1610 0.1405 -0.0930 0.0155 0.0128 -0.0377 0.1623 0.1758 0.1719 0.1431 0.0267 -0.1337 -0.1100 0.1030 -0.0093 -0.0435 0.1544 -0.0333 0.1254 -0.0681 -0.0881 0.1160 0.0434 0.0927 -0.5544 -0.0141 -0.3623 -0.4225 -0.2394 -0.2988 -0.3618 -0.4758 -0.3486 -1.0506 -0.0134 0.1341 -0.0996 -0.2141 -0.1642 0.1988 -0.1813 -0.2819 -0.1903 0.0025 0.0125 0.0290 -0.2767 -0.0775 -0.0344 0.0011 -0.1374 0.2855 0.0554 -0.1241 0.1597 0.1506 -0.0722 -0.1962 -0.2354 -0.1202 -0.2601 -0.2480 -0.0517 -0.2638 -0.1935 -0.0451 -0.2143 -0.1742 -0.1879 -0.0140 0.2539 0.0851 -0.2505 0.2583 -0.1660 0.0760 -0.3421 -0.1730 -0.1611 0.0010 -0.6981 -0.4727 -0.1409 -0.1389 0.2702 0.2888 -0.2151 -0.0156 0.0201 0.1421 0.3545 0.1014 -0.0553 0.0002 -0.0254 0.1828 0.0704 -0.3338 -0.0323 0.0635 -0.2319 -0.4718 0.0387 -0.0221 -0.0548 -0.1483 -0.0714 0.0585 -0.1105 0.2903 0.2798 0.1312 0.0551 0.0446 -0.0639 -0.0498 -0.2946 -0.2454 -0.2485 -0.4623 -0.4349 0.0531 0.1887 0.3969 0.3298 0.2410 -0.3768 -0.1551 -0.0944 0.3763 0.2290 0.0622 0.0874 0.0109 -0.1898 0.0275 -0.1223 -0.2541 -0.2433 0.0283 -0.1230 -0.0044 0.0404 0.2792 -0.0782 -0.1659 -0.2132 -0.2863 -0.1593 0.2422 0.0623 0.1056 -0.1087 -0.0001 -0.0765 -0.1169 -0.2288 -0.2767 -0.1062 -0.2103 0.1003 0.0216 0.1779 0.0488 0.0489 -0.1442 -0.2849 -0.2219 -0.1532 0.1694 -0.1092 0.0110 -0.0674 0.2386 0.2182 -0.1164 -0.0700 -0.3812 -0.0261 -0.2334 0.0007 0.0401 -0.1600 0.0100 -0.1519 -0.0257 -0.0660 -0.1816 -0.3468 0.2355 -0.1048 -0.0144 -0.1971 -0.2369 0.1470 -0.0739 -0.1751 -0.3503 -0.0132 -0.3103 -0.0225 -0.3886 0.1841 -0.1609 0.0875 -0.0745 -0.0799 -0.1427 -0.2932 0.0445 0.0546 0.1350 -0.1180 -0.0594 -0.2817 -0.2940 -0.0644 -0.7291 -0.6461 -0.4886 -0.2210 -0.4143 -0.2095 -0.6007 -0.1432 0.0809 -0.0661 0.1202 -0.0101 -0.0405 0.0056 0.0738 0.0858 0.0153 0.0211 -0.0767 -0.0239 -0.0049 -0.1202 -0.0801 -0.1134 -0.0512 0.0233 -0.1189 -0.0968 -0.1178 -0.1408 0.0552 -0.1520 -0.0782 0.1569 0.0550 0.0904 -0.0318 0.2381 -0.1654 0.1480 0.2236 0.1895 -0.1439 -0.0581 -0.1880 -0.0139 -0.0360 0.1004 0.1468 -0.1318 0.0906 -0.1458 -0.0359 0.1191 -0.2647 -0.0549 -0.0817 -0.0377 0.1347 0.2271 -0.0317 0.0757 -0.0531 -0.0035 0.1615 -0.2099 -0.1460 0.1009 0.2428 0.0795 0.1157 0.1053 -0.3665 0.0418 -0.0041 -0.0633 -0.2407 0.0124 0.0126 -0.0365 -0.0998 -0.2456 -0.2953 0.0356 -0.2186 -0.0595 -0.4453 -0.0280 -0.0034 -0.0246 0.0488 -0.0987 0.0460 0.0063 0.2863 0.0221 -0.2013 -0.0269 -0.0954 0.1361 0.1297 0.1606 -0.3370 -0.0371 -0.2371 -0.1085 -0.4717 -0.0447 0.0083 -0.0231 0.1232 -0.0455 -0.0135 -0.0272 0.1163 0.0190 -0.0596 -0.2147 -0.1129 0.1550 0.0280 -0.0390 0.0321 -0.1803 -0.1352 -0.0786 -0.1469 0.0238 0.0035 -0.0670 0.1526 -0.0521 0.2010 -0.0334 0.0144 0.3528 0.1252 0.0958 0.0264 0.1142 -0.0005 0.1397 -0.0528 -0.2622 -0.0424 0.0078 -0.3141 0.0196 0.0831 0.1347 0.1961 0.1218 0.0135 0.1680 -0.1752 0.1089 -0.1815 0.0932 0.1624 -0.0820 -0.0554 0.1513 0.0255 0.0997 -0.0175 0.0483 -0.1612 0.0005 0.1139 0.0613 0.2145 0.1091 0.1680 0.0779 0.3237 0.1315 -0.2851 -0.0249 -0.0425 0.0705 0.2106 0.0814 0.1092 0.1711 -0.0425 0.0721 0.0925 0.0351 -0.5398 -0.7487 0.5524 0.0942 0.1733 -0.3470 -0.6999 -0.4311 -1.3129 -0.7526 -0.5423 0.5202 -0.1558 -0.5016 0.0145 0.1504 -0.3176 0.1495 -0.5080 -0.6829 -0.1315 0.1271 -0.5613 -0.4962 -0.0456 0.3165 -1.0586 -0.1119 -0.2759 -0.5679 -0.1675 0.0029 0.4213 0.0829 0.0922 0.2541 -0.2764 -0.3082 0.0722 -0.2628 0.0903 -0.5524 0.6596 -0.5309 -0.0631 -0.6034 -0.2761 -0.3707 -0.6893 0.3331 0.1505 0.0635 0.0699 0.0692 -0.2914 0.9077 -0.2723 0.4252 -0.6170 -0.6170 -0.1828 -0.0835 -1.2758 -0.9908 0.3753 -0.6738 0.2038 -0.4653 -0.1698 0.3108 0.0466 0.2899 0.1734 0.0983 -1.5239 0.2966 -0.0875 0.1801 -0.1988 -0.3398 0.2801 -0.3479 -0.2490 0.0787 0.3813 -0.1048 -0.0798 -0.4403 -0.2576 1.1853 1.0548 1.4660 0.6624 1.0670 1.4690 1.2961 0.2660 0.5985 0.0424 -1.8523 -1.4184 0.8858 0.3723 -0.5831 -1.1476 -1.0622 -2.0344 -1.7309 -1.3518 -0.1518 0.3110 0.7142 0.5608 0.2500 -1.2328 0.0990 -0.4888 -0.1098 -0.1847 -0.0288 0.2330 -0.4782 0.0519 0.0876 0.3491 -0.1279 -0.1894 -0.5411 -0.1491 0.2967 -0.1196 0.2846 0.8502 0.0684 0.8033 -0.3082 -0.4325 0.1131 -0.3252 -0.8583 -1.0026 -0.0923 0.5128 -0.2288 -0.2821 0.2453 -0.4132 -0.8379 0.1038 -0.8019 -0.1568 0.4113 -0.0826 -0.3168 -0.4051 0.1494 -0.4208 0.3701 0.1625 0.4909 -0.4859 -0.6688 0.2988 0.0881 -0.3398 0.0739 -0.2154 -0.8559 -0.5082 -0.4564 -0.2394 0.0291 0.2191 0.5648 0.1360 -0.0902 -0.0192 -0.2904 -0.1560 -1.4438 -0.0308 0.1127 -0.1008 -0.3537 0.0027 -0.4912 -0.3858 -0.4600 -0.0945 0.0191 0.2591 -0.2969 -0.3811 -10.5712 -0.0866 -0.5339 0.0316 -0.2248 -0.0910 -0.1634 -0.1065 -0.1196 -0.1355 -0.0406 -0.1019 -0.0626 -0.0935 -0.0076 -0.0246 -0.1141 0.0152 -0.0631 -0.1158 -0.1006 -0.0034 -0.0197 0.0901 -0.0234 0.0104 -0.0134 0.0357 -0.0551 -0.1693 -0.0819 0.0516 0.0150 -0.1504 -0.0012 -0.0550 0.0082 -0.1272 0.0181 -0.1670 -0.0981 0.0078 0.0094 -0.1072 -0.0925 -0.0017 0.0133 0.0124 -0.0731 -0.0079 -0.0102 -0.1013 -0.1728 -0.0639 -0.0939 -0.0161 -0.0159 -0.0126 0.0208 -0.0773 -0.1187 -0.0572 0.0210 -0.0633 0.0802 0.0217 -0.0315 0.0272 -0.1558 -0.1788 0.0338 -0.0635 -0.0723 -0.2422 0.0489 -0.0202 0.0394 -0.1310 -0.0229 -0.0347 0.0010 0.1044 0.0377 -0.0293 0.0102 -0.0720 -0.0299 -0.0567 -0.1169 -0.0038 -0.1354 -0.1134 -0.1603 -0.0229 0.0104 -0.0397 0.0626 -0.0845 -0.0225 -0.0378 -0.0908 0.0379 -0.0462 0.0879 -0.0616 -0.0414 0.0353 -0.0472 -0.0688 0.0298 0.0431 -0.0236 0.0335 -0.1367 -0.1462 -0.0872 -0.0929 -0.0857 0.0010 -0.0127 -0.0337 0.0368 0.1173 0.0443 -0.0815 -0.0066 -0.1183 0.0096 -0.1255 -0.0989 0.0488 -0.1235 -0.0861 -0.0544 0.0232 -0.1021 0.0887 -0.0548 -0.0575 -0.0289 -0.0497 0.0317 -0.0918 0.0261 -0.0138 -0.0049 -0.0011 -0.0995 -0.1001 -0.1423 -0.1106 -0.1642 -0.0451 0.0013 -0.0197 -0.0807 -0.0007 -0.1219 -0.0806 -0.0012 -0.0013 -0.0614 0.0105 -0.1333 -0.0904 -0.0155 0.0293 -0.0899 -0.1261 -0.1612 -0.0766 -0.0061 0.0079 -0.0524 -0.0576 -0.1402 -0.0131 0.0089 -0.1474 -0.1576 -0.0087 -0.0167 0.0286 -0.0177 -0.1606 0.0329 -0.2487 -0.2046 -0.2811 -0.1955 -0.2003 -0.3373 -0.2845 -0.3220 -0.2505 -0.6263 0.0371 -0.0651 -0.0376 0.0088 -0.0163 -0.1120 -0.0817 0.0142 -0.1000 -0.1110 -0.0739 -0.0529 0.0079 -0.0735 -0.0840 0.0433 0.0292 0.0114 -0.0130 -0.1189 -0.0539 -0.0400 -0.0105 0.0025 0.0035 -0.0329 -0.1575 -0.0300 -0.0421 -0.0570 -0.0009 -0.0594 -0.1258 -0.0858 -0.1399 -0.0611 -0.0537 -0.0150 0.0448 -0.0386 -0.1037 -0.1412 -0.0704 -0.0012 -0.1094 -0.0105 0.0298 -0.1813 -0.1460 -0.0215 -0.1052 -0.0247 0.0553 -0.0262 -0.0986 -0.1318 0.0292 -0.1177 -0.1199 -0.0810 0.0572 -0.0367 0.0441 -0.0772 -0.0357 -0.0824 -0.1084 -0.1223 -0.0773 -0.0752 -0.1566 -0.1127 -0.0184 -0.0548 -0.1353 -0.0838 -0.0099 -0.1378 0.0015 -0.0111 -0.1455 -0.0479 -0.1346 0.0247 -0.0713 0.0384 -0.0515 -0.0008 0.0150 0.0389 -0.1002 0.0321 0.0368 -0.0297 -0.1090 0.0310 -0.0022 -0.0680 0.0156 0.0532 -0.0903 -0.0576 -0.0847 -0.1085 -0.0494 0.0317 -0.0898 -0.0517 -0.0213 -0.0864 -0.0404 -0.0433 0.0136 -0.0475 -0.0105 -0.0402 0.0946 -0.0552 -0.0510 0.0705 -0.1477 -0.0460 0.0340 -0.1188 -0.0437 -0.0066 -0.0648 0.0136 -0.1273 -0.0158 0.0559 -0.0149 -0.0715 0.0041 -0.1596 -0.0064 -0.0572 -0.1349 -0.0631 0.0580 0.0397 0.0138 -0.0371 0.0110 -0.1106 0.0584 0.0003 -0.1628 -0.1333 -0.0754 -0.0253 -0.1580 0.0320 -0.1614 -0.1197 -0.0349 -0.0001 -0.0178 -0.1317 -0.0247 -0.0626 -0.2179 -0.0402 -0.0346 0.0237 0.0081 -0.0304 -0.0932 -0.1124 0.0015 0.0194 -0.0535 -0.0972 -0.0906 0.0298 0.0058 -0.0256 -0.1403 -0.0407 -0.0271 -0.0747 -0.1361 -0.2761 -0.3107 -0.2238 -0.0787 -0.2692 -0.3787 -0.3992 -0.5949 -0.0734 -0.0404 0.0788 0.0538 -0.1105 0.0876 -0.0027 0.0693 0.0564 0.0325 -0.0368 0.1098 0.1022 -0.0853 0.1135 0.0315 0.1761 -0.0264 -0.1148 -0.1092 -0.0127 -0.1201 0.0042 0.0346 0.0517 0.0382 0.1135 0.1192 0.0449 -0.0036 0.1248 -0.0800 0.0439 0.1151 -0.0135 -0.1779 0.0252 -0.1047 -0.0606 -0.0868 0.0437 0.0220 0.0183 0.1125 -0.0684 -0.0347 0.1291 -0.1266 -0.0900 -0.0800 -0.0193 0.0736 0.0182 -0.0763 0.1508 -0.0419 -0.0262 0.0051 -0.1789 -0.0831 -0.0215 0.0337 0.1075 0.0463 0.0719 -0.2665 0.0540 -0.0631 -0.0577 -0.1772 -0.1755 -0.0586 0.1636 -0.0759 0.0020 -0.1938 -0.1315 -0.1637 -0.1825 -0.2093 0.0371 0.0237 0.0761 0.1222 -0.0046 0.1292 0.0699 0.0798 -0.2102 -0.1215 -0.1924 -0.1863 0.2923 -0.1257 -0.0268 -0.3882 -0.0752 -0.4268 -0.2965 -0.2346 -0.1312 0.0754 -0.0148 0.1983 -0.1180 -0.0600 -0.1265 0.1290 -0.0338 -0.0030 -0.1295 -0.1290 0.0561 0.0252 -0.0362 -0.0313 -0.2362 -0.1275 -0.1610 -0.1376 -0.0894 -0.0479 -0.0430 0.1565 -0.0048 0.2137 -0.0119 0.0517 0.1855 0.0387 0.0084 -0.1000 0.0664 0.1355 0.0940 -0.0094 -0.2161 -0.0827 -0.2192 -0.1738 0.0574 0.0801 -0.0513 0.1083 0.1553 0.1245 0.0723 -0.1500 0.0866 -0.1252 0.0604 0.0482 -0.0051 0.0681 0.0439 -0.1852 0.0467 0.0086 -0.1660 0.0240 -0.1037 0.1261 -0.0618 0.1674 0.1855 0.0407 0.0574 0.0791 0.0783 -0.2068 -0.0852 0.0072 -0.0248 0.1106 0.0064 0.0553 0.0459 -0.0570 0.1097 0.0081 -0.1983 -0.1410 -0.4145 0.3765 0.1797 0.0828 -0.3489 -0.3349 -0.3322 -0.8490 0.0314 -0.0863 -0.0226 0.0345 -0.1296 0.0792 -0.0473 -0.1275 -0.1316 -0.0530 -0.0421 -0.1200 -0.1172 0.0506 -0.0464 -0.0202 -0.0809 0.0288 0.0299 0.0389 -0.0778 -0.0216 -0.1140 -0.1551 -0.1386 0.0189 -0.2002 -0.1717 -0.1393 -0.0927 0.0093 -0.0301 0.0691 -0.0307 -0.1485 -0.0111 -0.0902 -0.0609 -0.1213 -0.0056 -0.0131 -0.0950 -0.0419 -0.1602 -0.1138 -0.1139 -0.0462 0.0268 -0.1743 0.0420 -0.0619 -0.0779 -0.0323 0.0140 -0.0501 -0.1187 0.0351 0.0216 -0.0056 -0.0734 -0.0754 -0.1037 -0.1460 -0.1411 -0.0476 -0.0177 -0.0635 -0.1949 -0.1310 0.0397 -0.0372 -0.0791 -0.0388 0.0766 -0.0235 0.0080 -0.0111 -0.0855 -0.0807 0.0407 -0.1493 -0.1879 -0.0692 -0.0132 -0.0411 -0.0375 -0.0339 -0.0220 0.0177 -0.0207 -0.0098 0.0233 -0.0837 -0.0446 -0.1116 0.1001 -0.0055 -0.0453 -0.0036 -0.0070 0.0483 -0.0970 -0.1630 -0.0048 0.0086 -0.0832 -0.0802 -0.0822 0.0371 -0.0667 -0.0348 -0.0397 -0.0033 0.0503 -0.0458 0.0534 -0.0294 0.0190 -0.0809 0.0615 0.0248 -0.1626 -0.0163 -0.1181 0.0417 0.0464 -0.0140 -0.1021 -0.1053 0.0232 -0.0471 -0.0763 -0.1247 -0.1164 -0.0895 -0.0068 -0.1174 -0.0714 -0.1405 -0.0005 -0.0496 -0.0002 -0.0613 -0.1357 -0.0431 -0.1629 -0.1107 -0.1795 -0.0779 -0.0513 -0.1271 0.0717 -0.0791 -0.0185 -0.1010 0.0419 -0.1170 -0.1122 -0.0215 -0.0079 -0.0796 -0.1139 -0.0314 0.0363 0.0080 -0.1878 -0.0468 -0.1334 -0.0328 -0.0894 0.0098 0.0221 0.0133 -0.1117 -0.0953 -0.1250 0.0159 -0.0152 -0.0277 0.0593 -0.2379 -0.2145 -0.3176 -0.1223 -0.1856 -0.2196 -0.2172 -0.2309 -0.2407 -0.6738 0.0117 0.0323 0.0145 0.0181 0.0222 -0.0519 -0.1799 -0.0412 -0.1177 -0.0114 -0.1558 -0.1405 -0.1161 0.0662 -0.0653 -0.0909 -0.1061 -0.0070 -0.1186 -0.0964 0.0341 -0.1443 -0.1342 -0.0414 0.0310 -0.0203 0.0005 -0.0619 -0.0624 -0.0322 -0.0818 -0.1236 -0.0778 -0.1323 -0.0782 -0.0153 -0.0702 -0.0729 -0.0151 0.0637 -0.0388 -0.1867 -0.0608 -0.1057 -0.0723 -0.0549 -0.0068 -0.0809 -0.1966 -0.1225 0.0317 -0.0552 -0.0147 0.0704 0.0707 0.0589 -0.0290 -0.0421 0.0032 -0.0912 -0.1214 -0.0359 0.0233 -0.1153 0.0224 -0.0390 -0.0319 -0.1280 -0.0130 0.0184 -0.1550 0.0448 0.0348 0.0009 -0.0418 0.0688 -0.0279 0.0000 -0.1354 -0.1082 -0.1717 -0.2005 -0.0611 -0.0513 -0.1191 -0.0208 -0.0656 -0.0256 0.1063 0.0165 0.0069 0.0933 -0.0167 -0.0056 -0.0313 0.1214 0.0023 0.0740 -0.0074 -0.0653 0.0540 -0.0219 -0.0475 -0.0832 -0.0385 0.0719 -0.0527 -0.0904 -0.1129 -0.0154 -0.1336 -0.0741 -0.0926 0.0031 -0.0705 -0.0358 -0.0845 -0.0449 -0.1011 -0.0700 -0.0496 0.0337 -0.1063 -0.0633 -0.0314 -0.0261 -0.0799 -0.1703 -0.1246 0.0025 -0.0926 -0.1287 -0.0342 -0.1122 -0.1897 0.0221 0.0353 -0.0518 0.0393 -0.0698 -0.0376 -0.1196 0.0151 -0.1856 0.0464 -0.1074 0.0340 -0.1660 -0.1323 0.0444 0.0076 0.0382 0.0320 0.0078 -0.1779 0.0211 -0.1302 0.0116 0.0136 0.0495 0.0511 -0.0507 0.0138 -0.0225 -0.0215 0.0347 -0.1651 -0.0812 0.0588 -0.0439 0.0303 -0.1287 0.0546 -0.1223 -0.1300 -0.0077 -0.0556 0.0119 -0.0184 -0.0767 -0.2249 -0.1440 -0.4427 -0.3773 -0.0512 -0.3706 -0.3292 -0.2603 -0.3322 -0.5974 0.0078 0.3898 0.1702 0.1751 -0.1120 0.1894 -0.2907 -0.2799 -0.0960 0.1657 -0.0775 0.3246 0.3307 0.0206 0.1906 0.4256 0.3604 0.0211 -0.0354 -0.5250 0.1178 0.7964 0.0416 0.1250 0.1736 -0.3097 -0.0002 -0.2660 -0.0152 -0.1117 0.1048 0.0599 0.1674 0.2395 -0.0073 -0.1661 0.0964 0.1099 -0.2251 -0.1522 0.0122 0.4142 -0.2893 0.0431 -0.0915 0.1204 -0.2376 -0.1842 -0.0216 -0.4815 0.4470 0.1022 0.0220 -0.0573 0.5438 0.4237 0.4266 0.4193 -0.2711 -0.0464 0.4647 0.3482 0.1131 0.1119 -0.5760 -0.8703 -0.0131 0.0232 0.2258 -0.4464 0.0733 0.2762 0.1044 -0.0409 -0.2198 0.1003 -0.1418 -0.1326 0.1359 -0.5204 0.3486 0.1845 0.3629 0.0769 -0.2396 0.4630 -0.1618 0.1646 0.4319 -0.2902 -0.3456 -0.0032 0.5073 -0.0745 -0.0496 -0.3465 -0.6802 -0.9951 0.0662 -0.6347 0.3412 0.4204 -0.1430 -0.0052 -0.1681 -0.3460 0.0978 0.1101 0.0996 0.0703 0.3832 -0.0855 -0.2165 -0.2027 -0.2532 -0.2619 -0.2643 -0.2516 -0.1441 0.0054 0.3675 0.0633 -0.3163 0.1191 0.1077 0.0520 -0.1987 -0.0663 0.2947 -0.6293 -0.1893 0.0459 0.0168 0.1276 0.2051 0.5292 -0.3535 0.7113 -0.1447 0.0775 0.6154 0.1423 0.1387 0.1608 -0.0441 0.0033 0.3316 -0.1157 0.3937 -0.0672 0.3131 0.1384 -0.0647 -0.2282 0.1596 -0.1590 0.1924 -0.0841 -0.0282 -0.0166 0.3545 0.1365 0.3541 0.3021 0.5392 -0.1100 0.5729 -0.0785 -0.1004 -0.0624 0.0993 0.4877 0.0869 0.2693 0.2693 0.0792 -0.2920 0.1741 0.1633 0.2476 0.0853 -0.1442 -1.7393 0.4324 0.7225 0.6399 -0.4957 -0.9188 -0.5190 -1.7525 -0.1269 -0.0070 -0.0077 0.0634 0.1087 -0.0229 0.0355 0.0344 -0.0511 -0.0539 0.0232 -0.1300 0.1212 -0.0409 0.0287 -0.0950 -0.0568 -0.0653 0.0070 -0.1161 -0.0701 -0.0813 0.0025 0.1454 -0.0179 -0.1233 0.0730 -0.0852 -0.1297 -0.0172 -0.0526 -0.0388 0.0461 0.0471 -0.0379 -0.1421 -0.1107 -0.1676 0.0782 -0.1001 -0.0162 -0.1802 0.0824 0.0997 0.0080 0.0288 0.1478 0.0728 0.0556 0.0400 -0.0153 -0.0477 0.0278 0.0095 0.0573 -0.0096 -0.1254 -0.0490 0.0773 -0.0401 -0.0808 0.0010 0.0216 0.1882 -0.0232 -0.0048 -0.0020 0.1639 -0.0927 -0.1550 -0.0966 -0.0862 0.1059 -0.0665 -0.0592 -0.3816 -0.0072 -0.0504 -0.1342 -0.0465 -0.0304 -0.1761 -0.0601 -0.0217 -0.0687 -0.1004 0.0169 0.0238 -0.1454 -0.0625 -0.0908 -0.1365 0.1230 0.0699 -0.1028 -0.2195 -0.0237 0.0457 -0.0767 0.0509 -0.1690 -0.1582 -0.0039 0.1331 -0.1785 0.1432 0.0111 0.1372 0.0067 0.0210 -0.0913 -0.0187 0.0603 0.0392 -0.0996 -0.1238 -0.0351 -0.0912 -0.1668 -0.1177 -0.0996 -0.0104 -0.1078 0.1416 -0.0874 0.0046 0.0413 -0.0033 -0.1924 -0.0361 -0.0061 -0.0263 0.0912 0.0937 0.0264 0.0169 -0.0190 -0.0707 0.0588 -0.0658 -0.1102 0.1153 -0.0360 0.1994 0.0367 0.1543 -0.1827 0.0699 -0.0194 -0.1137 -0.0708 -0.0380 -0.0116 0.1442 0.0491 -0.1891 0.1093 0.0841 0.0367 -0.0710 -0.0730 0.0425 -0.0726 0.1056 -0.0163 0.0561 -0.1363 -0.0688 0.0162 -0.1337 -0.0755 -0.0653 0.0456 0.0777 0.0342 -0.1066 0.1788 0.0758 0.0301 -0.1416 -0.3088 -0.5764 -0.0327 -0.0028 0.0044 -0.1107 -0.3903 -0.3496 -0.4578 -0.8418 0.0986 -0.0363 -0.0605 -0.0320 -0.0369 -0.0096 -0.0401 -0.2170 -0.0425 -0.1009 -0.0370 -0.0138 -0.0416 -0.0890 -0.1439 0.0225 -0.0630 0.0738 0.0271 -0.0905 -0.0842 0.0463 -0.0143 -0.0411 0.0183 -0.1367 -0.3354 -0.1727 -0.0962 -0.0058 0.0552 0.1218 -0.0924 -0.0537 -0.0025 0.0407 0.0968 0.0751 -0.0733 0.0162 -0.0601 -0.0376 -0.0145 -0.2035 -0.1887 -0.0119 -0.1361 -0.1021 -0.0864 -0.0152 0.0227 -0.0220 -0.1106 -0.0157 -0.0518 -0.0969 0.1402 0.0072 -0.0278 0.1040 -0.1404 -0.0166 -0.0826 -0.1762 0.1209 0.1568 -0.0663 -0.1219 -0.0594 -0.0920 -0.0428 -0.1102 -0.1748 -0.0313 -0.1348 0.1288 0.0758 -0.0337 0.0207 -0.0539 -0.2562 -0.2097 -0.1960 -0.1498 -0.1760 -0.1812 -0.2911 -0.0289 0.0159 0.1397 0.2082 0.1811 -0.2040 -0.0949 0.0864 0.2188 0.1263 0.1343 0.0231 -0.0311 -0.1122 -0.1130 -0.0055 -0.0077 -0.0991 -0.1175 0.0384 -0.1439 -0.0012 0.0234 -0.0299 -0.2315 -0.1400 -0.0125 -0.0678 0.0703 0.1133 0.0500 -0.0302 -0.0189 -0.0790 -0.0337 -0.1128 -0.1101 0.0340 -0.0827 0.0806 -0.0209 -0.0512 0.0094 0.1037 -0.0380 -0.1253 -0.2130 -0.0537 -0.0440 -0.1212 -0.1101 -0.0441 0.0130 -0.0414 -0.0469 -0.1621 -0.2088 -0.0306 -0.1498 0.0564 -0.1662 -0.1097 0.1100 -0.1022 0.0262 0.0780 -0.2407 -0.1592 -0.0358 0.0087 -0.0344 -0.0231 0.0199 -0.1109 -0.1902 -0.0675 -0.1327 -0.0868 -0.2326 0.0294 -0.1546 -0.1446 -0.1260 -0.0044 -0.0661 -0.1784 -0.0439 -0.0567 -0.0748 -0.0651 0.0246 0.0541 0.0702 -0.0394 -0.1296 -0.2918 -0.4297 -0.2049 -0.3310 -0.3070 -0.3541 -0.2906 -0.6904 -0.1416 -0.0437 -0.0231 0.1095 -0.0867 -0.0581 -0.0229 0.0175 0.0290 -0.0890 0.0274 -0.0805 0.0425 0.0476 -0.1026 -0.0513 0.1060 -0.1876 -0.0856 -0.0788 -0.0824 -0.1228 -0.0848 0.0503 -0.0674 0.1336 0.0370 -0.0455 -0.1046 0.0066 -0.0331 -0.0381 0.0658 0.1306 -0.0773 -0.0544 -0.0844 -0.1138 -0.0611 -0.0914 0.0033 0.0532 -0.0065 -0.0230 0.0301 0.0018 0.0020 -0.0769 -0.0522 0.0397 0.0133 0.0975 0.1054 -0.0467 0.0289 -0.0093 -0.0481 0.0330 -0.1224 -0.0576 0.0565 -0.0586 -0.1004 0.0133 0.0507 -0.1054 0.0707 0.0011 -0.1030 -0.0967 -0.1378 -0.0033 0.1213 -0.0766 -0.0825 -0.1329 -0.1095 -0.0850 -0.0179 -0.0232 -0.0686 -0.0729 0.0616 0.1292 0.0927 0.0247 -0.0012 0.0256 -0.1416 0.0013 -0.0221 -0.1084 0.1772 -0.0257 -0.1104 -0.1509 0.0569 -0.1972 0.0062 -0.1647 0.0276 0.0194 0.0471 0.1413 -0.0894 0.0618 -0.0788 -0.0697 0.0511 0.1064 -0.1546 -0.0648 0.0999 -0.0176 -0.1074 -0.0186 -0.0204 -0.1781 -0.1811 -0.0172 -0.1242 -0.0961 0.0217 0.0309 0.0629 0.0903 -0.0326 -0.1140 0.0373 0.0515 -0.0464 -0.1105 0.0396 -0.0035 -0.0081 -0.0405 -0.0956 -0.0020 -0.1425 -0.0102 -0.0549 -0.0833 -0.0345 0.0150 -0.0690 0.1520 -0.0669 -0.0027 0.0430 -0.0400 0.0239 -0.0011 -0.0239 -0.0033 -0.0121 -0.0069 0.0488 -0.1456 -0.1541 -0.0349 -0.0778 -0.0188 0.0317 0.0741 0.0562 0.0938 -0.0517 0.0848 0.0097 -0.0073 -0.0464 -0.1147 -0.0040 0.1180 0.0789 0.0299 0.0002 -0.0683 -0.1047 -0.0891 -0.2582 -0.1218 -0.3164 0.0038 0.0576 0.0776 -0.2883 -0.3804 -0.4321 -0.7330 0.0935 0.0396 -0.2170 0.0202 -0.0156 -0.0469 -0.1262 -0.2376 -0.1208 0.0710 0.0052 -0.1343 -0.1557 -0.0496 -0.1268 0.0343 -0.2281 0.1070 -0.0461 -0.2317 -0.0069 -0.0345 -0.1728 -0.1740 0.0442 0.0199 -0.0956 -0.1966 0.0059 -0.1619 -0.0510 0.0763 -0.0682 -0.2583 -0.1877 0.1673 0.1864 0.1002 -0.0126 0.0986 -0.0812 -0.1634 0.0887 -0.0956 -0.1239 0.0046 -0.3293 -0.3003 -0.1557 0.1454 0.0053 0.1757 -0.1347 0.0640 -0.0863 0.0867 0.1094 -0.0037 0.0552 -0.0502 0.0174 0.0752 0.0275 -0.1941 0.0716 0.0316 -0.0137 -0.2414 -0.1748 -0.0337 -0.2049 -0.0363 -0.0398 0.0892 -0.1554 0.1921 0.1817 -0.0375 -0.1306 0.0718 -0.1236 -0.3131 -0.3969 -0.0781 -0.0847 -0.3404 -0.3843 -0.0907 0.1765 0.2360 0.2107 0.2953 -0.2393 -0.0615 0.0270 0.2986 0.1019 0.1786 0.1143 0.1316 0.0258 0.0175 -0.1137 -0.0670 -0.0332 0.0152 -0.0989 -0.1634 -0.0739 0.2228 -0.1157 -0.2349 -0.1674 -0.2144 -0.2014 0.1857 0.0864 0.0614 -0.0791 0.1331 -0.1898 -0.0492 -0.1204 -0.3586 -0.1497 -0.2600 -0.1416 0.0270 0.0951 -0.1550 -0.0239 0.0740 -0.2265 -0.2407 -0.0435 0.0831 -0.0195 0.0205 -0.0299 0.1618 -0.0182 -0.2334 -0.1951 -0.1738 0.1390 0.0132 -0.0137 -0.2201 0.0532 0.0152 -0.1369 -0.2113 -0.0820 -0.1746 -0.4462 0.0624 -0.0623 -0.0907 -0.1256 -0.0948 0.0452 -0.2012 -0.1599 -0.2165 -0.0191 -0.3278 -0.0523 -0.2096 0.0160 -0.0595 0.0400 -0.0907 -0.0766 -0.3096 -0.1959 0.0728 -0.0517 0.1767 -0.1019 -0.1411 0.0739 -0.2202 -0.4319 -0.7838 -0.3228 -0.5032 -0.3236 -0.2307 -0.1575 -0.6344 0.3328 -0.0163 -0.1482 -0.1833 -0.0993 -0.0596 -0.3434 -0.2292 -0.0423 -0.0544 -0.2513 0.0176 -0.2072 -0.1309 0.0916 0.2468 0.0260 0.1696 -0.1542 -0.1589 0.2159 0.2484 0.0644 -0.1240 0.0788 0.0092 -0.1257 -0.1711 0.0332 -0.4275 -0.3171 0.0505 -0.1450 -0.2800 -0.1465 0.0396 0.2434 0.1177 -0.1990 0.0286 0.2094 -0.1766 -0.0698 -0.0174 0.0060 -0.2124 -0.1861 -0.2690 -0.2520 0.0046 -0.0396 0.1512 -0.4050 0.2369 -0.0813 0.1886 0.1973 -0.0863 -0.0859 0.0603 0.1673 0.3663 0.1079 -0.0523 0.2612 0.0600 -0.1595 -0.3147 -0.0471 -0.2159 -0.0900 -0.2558 -0.0631 -0.0961 -0.2125 0.2001 0.2343 0.0358 -0.0979 0.0461 -0.2020 -0.3380 -0.2618 -0.1467 -0.0793 -0.4776 -0.5739 0.2322 0.0887 0.1384 0.4272 0.2961 -0.2282 -0.1199 0.1859 0.2247 0.0479 0.1261 0.0373 0.1716 0.2889 0.5288 0.0943 -0.2124 0.2572 0.2194 0.0980 0.0006 -0.0545 -0.0657 -0.2276 -0.5286 -0.0207 -0.1391 -0.1351 0.0044 0.0693 -0.1787 -0.2046 -0.0384 -0.3839 -0.2580 0.0780 -0.2796 -0.1210 -0.2258 -0.1366 -0.2421 0.1357 0.0599 0.3768 0.1028 -0.3400 -0.2392 -0.0588 0.0372 -0.0246 0.1289 -0.2592 0.0390 0.0936 -0.0752 -0.1519 -0.4141 0.0830 0.0070 0.0724 0.0110 -0.0478 -0.0076 -0.2141 -0.4521 0.0829 -0.2446 -0.3247 0.0887 -0.1234 -0.0706 -0.2486 0.1493 -0.0754 -0.5282 -0.0757 -0.3109 -0.0198 -0.3845 -0.0264 -0.3017 0.1376 0.1854 0.1888 -0.2062 -0.1052 -0.2593 -0.0926 -0.0591 -0.0969 0.0742 -0.1994 -0.1449 0.3008 -0.2588 -0.3751 -0.8714 -0.4520 -1.3731 -0.2366 -0.3208 -0.2832 -0.5232 -0.0669 -0.0833 -0.1181 -0.0534 -0.0892 0.0688 0.0214 -0.0387 -0.0623 -0.0745 -0.0793 -0.0874 0.0317 0.0727 -0.1107 0.0422 -0.0210 -0.0925 -0.1034 0.0285 -0.0779 -0.1334 -0.0274 0.0175 -0.0674 0.0286 -0.0117 -0.0215 0.0345 -0.0837 -0.0371 -0.0540 -0.0582 -0.0756 -0.0011 -0.0389 0.0693 -0.0673 -0.1154 -0.0641 -0.0840 -0.0132 0.0173 -0.1261 -0.1201 0.0339 -0.1248 -0.0971 0.0326 0.0280 0.0597 -0.0693 -0.1106 0.0801 -0.0642 0.0608 -0.0566 -0.0734 -0.0518 -0.1164 0.0071 0.0197 -0.0151 -0.0130 -0.0066 0.0615 0.0103 -0.0018 -0.0403 -0.0625 -0.0289 -0.0357 -0.0780 0.0524 -0.0657 -0.0016 -0.0188 0.0555 -0.1182 -0.1068 -0.1332 -0.0663 -0.0167 -0.0775 -0.0652 -0.0913 -0.0494 -0.0397 -0.0855 -0.0203 0.0548 0.0716 -0.0987 -0.0220 -0.0898 -0.0264 0.0469 -0.0574 -0.0809 -0.0879 -0.1380 -0.0407 0.0432 0.0085 -0.0046 0.0612 -0.0670 -0.1114 -0.1281 -0.0707 -0.0844 -0.0627 -0.1081 0.0114 0.0337 0.0324 0.0784 -0.0290 -0.0486 0.0440 -0.0320 -0.1006 0.0234 -0.0063 -0.0500 -0.0955 -0.0189 -0.0005 0.0454 0.0033 -0.0539 -0.1107 -0.0592 0.0516 -0.1491 0.0006 0.0551 0.0224 0.0125 -0.0856 -0.0131 -0.0138 -0.1273 -0.0010 0.0597 -0.0255 0.0212 -0.0459 -0.1103 -0.0595 0.0120 -0.0445 0.0694 0.0599 -0.0009 -0.0324 -0.0467 -0.0097 0.0215 -0.0098 0.0331 -0.0927 -0.0473 -0.1191 0.0152 0.0012 0.0180 -0.1700 0.0383 -0.0242 -0.0688 -0.0383 -0.1157 -0.1469 -0.1131 -0.1251 -0.1007 -0.0520 -0.0811 -0.0312 -0.2391 -0.2292 -0.2571 -0.1080 -0.1381 -0.2377 -0.3499 -0.2396 -0.2671 -0.7097 -0.0778 -0.1402 -0.0945 -0.0985 -0.0732 0.0055 -0.0377 -0.1462 -0.1197 -0.0652 -0.0091 -0.0172 0.0070 -0.0908 -0.0403 0.0605 -0.1123 0.0007 0.0299 -0.0885 0.0154 -0.0257 -0.0436 0.0052 -0.0694 -0.0076 0.0242 -0.0506 0.0381 0.0355 -0.1059 0.0614 -0.0499 0.0452 -0.0109 0.0591 -0.0556 -0.0960 0.0637 0.0483 -0.0933 -0.1823 -0.0199 -0.0609 -0.0965 0.0790 -0.0928 0.0356 -0.0695 0.0746 0.0320 -0.0519 0.0305 0.0169 -0.0424 -0.0565 -0.0573 -0.0780 -0.0964 -0.0736 -0.1322 -0.0192 -0.0221 -0.1297 -0.0031 -0.0339 -0.0849 -0.0847 -0.0366 -0.0619 -0.1248 -0.1464 0.0205 -0.0373 -0.0579 0.0412 0.0504 -0.1043 0.0569 0.0117 -0.1404 -0.0834 -0.0973 0.0353 -0.0494 -0.0848 -0.1434 -0.1499 -0.1143 -0.0211 0.0783 -0.0080 -0.0266 -0.0706 0.0150 0.0220 -0.0496 0.0041 -0.0708 -0.0063 -0.0202 -0.0162 -0.0976 0.0495 0.0361 -0.0174 -0.1023 -0.0767 -0.0224 -0.0076 -0.1255 -0.0134 -0.0206 0.0254 -0.0833 -0.0077 0.0480 0.0537 0.0445 0.0481 -0.1050 -0.1608 -0.0422 -0.0354 -0.0877 -0.0302 0.0609 -0.1054 -0.0563 -0.0994 0.0153 -0.1250 0.0328 -0.0295 -0.0419 -0.0449 -0.0039 -0.0315 -0.1045 -0.1174 -0.0800 0.0172 -0.1419 0.0402 0.0361 -0.0956 -0.0623 -0.0480 -0.1170 0.0784 -0.1115 -0.1158 -0.0374 -0.0585 -0.0396 0.0380 -0.0774 -0.1058 0.0232 -0.0340 -0.0459 -0.1001 -0.1458 -0.1436 -0.0405 -0.1063 -0.0890 0.0081 -0.0070 -0.0695 0.0032 0.0281 0.0652 0.0515 -0.0114 0.0191 -0.1034 0.0240 -0.0428 -0.0018 -0.1157 -0.2141 -0.3721 -0.1508 -0.0749 -0.0709 -0.3683 -0.2379 -0.2779 -0.7039 -0.1541 0.1855 -0.0340 0.2000 -0.1443 0.1795 -0.0992 -0.0510 -0.0055 0.0651 0.0917 0.2904 -0.0343 0.1462 0.0973 0.1508 0.1822 -0.2386 0.0820 -0.1069 -0.1167 0.3680 -0.2315 0.2540 0.0126 0.3547 0.1615 0.1474 0.0146 -0.2452 0.2200 0.0788 -0.0115 0.1764 0.1337 -0.0500 0.1731 -0.4073 -0.1328 -0.2129 0.1297 0.3283 -0.2462 0.1544 -0.1230 -0.0503 0.2440 -0.5437 -0.0060 -0.3114 0.1599 0.1044 0.0150 -0.0153 -0.0138 0.1747 0.4099 0.2897 -0.1894 -0.0484 0.2498 0.1341 -0.1635 0.2200 -0.1424 -0.3134 0.0292 -0.0934 0.1201 -0.2352 0.0291 0.0518 -0.0613 -0.0129 0.0701 -0.0778 0.3183 -0.3332 -0.1561 -0.3152 0.3047 0.3787 0.1986 0.0860 -0.0678 0.3499 0.1723 0.0914 0.2223 -0.2927 -0.4042 -0.0634 0.1540 -0.0684 -0.0674 -0.2903 0.1441 -0.8704 -0.0505 -0.8789 0.1095 0.2191 -0.1214 0.1265 0.0498 -0.0161 -0.0113 -0.0955 0.0670 -0.1360 0.0636 -0.0235 0.0666 -0.2045 0.0854 0.2854 -0.0110 -0.3202 -0.1857 -0.2248 0.1220 0.0675 -0.2802 0.1061 -0.0632 0.3431 0.0047 -0.2588 0.5265 -0.0149 -0.0610 -0.1316 -0.0880 0.1005 0.1087 -0.1579 0.1500 0.0994 -0.4036 -0.1721 0.2925 0.1425 0.1329 0.1971 -0.1088 -0.1111 0.4935 -0.1526 0.3939 -0.2018 0.1866 0.1761 -0.1042 -0.2511 0.3145 0.0921 0.0243 -0.1401 -0.2015 -0.4709 0.0536 0.1260 0.1774 0.2965 0.3210 -0.0662 0.2548 -0.0896 -0.1175 0.0171 -0.1069 0.1882 0.0282 0.3308 0.1230 0.2441 0.1008 -0.0319 0.0130 0.2031 0.2575 0.5196 -2.0449 0.3571 -0.1071 0.2190 -0.3448 -0.4403 -0.5195 -1.0775 0.0598 -0.1065 -0.0177 -0.0472 0.0113 -0.0935 -0.0312 -0.1406 -0.0610 -0.0903 -0.1442 -0.1032 0.0093 0.0150 -0.0537 -0.1073 -0.0022 -0.0286 -0.0349 0.0589 0.0463 -0.0347 -0.0966 0.0452 0.0365 0.0855 -0.0757 -0.1244 -0.0282 0.0146 0.0013 0.0706 0.0626 -0.1301 -0.0204 -0.1310 -0.0102 -0.0090 -0.0188 -0.0313 0.0112 -0.1004 -0.0310 -0.0108 -0.1081 -0.1016 -0.0255 -0.1884 -0.0942 -0.1178 -0.0649 0.0182 -0.0666 -0.0651 -0.0027 -0.0727 0.0608 -0.1006 -0.0999 -0.0042 -0.1058 -0.0231 0.0205 0.0024 -0.0451 0.0839 0.0364 -0.1415 -0.1359 0.0179 -0.1096 0.0300 -0.0635 -0.0201 -0.0323 -0.0815 -0.0072 -0.1139 -0.1213 -0.0940 -0.1383 -0.0427 -0.0573 -0.0535 -0.0360 -0.0977 -0.1185 0.0228 -0.1111 0.0040 -0.1051 -0.1105 0.0573 0.0565 0.0672 -0.1050 -0.0003 -0.1036 -0.1194 0.0040 -0.1143 0.0463 0.0442 -0.0255 -0.0980 -0.0374 -0.0137 -0.1504 -0.1095 -0.0229 -0.0717 -0.1442 -0.0310 -0.1193 -0.1460 -0.0187 -0.0326 -0.0504 -0.0070 0.0369 -0.0730 -0.1026 -0.1031 -0.0221 -0.1111 0.0403 0.0462 -0.0589 -0.1044 0.0152 -0.0550 -0.1153 -0.0688 -0.0131 -0.1513 -0.0432 0.0353 -0.0896 -0.1092 -0.0871 -0.0780 -0.1467 -0.1317 0.0353 -0.0535 -0.0466 0.0156 -0.1481 -0.1411 -0.0269 0.0496 -0.0846 -0.0975 -0.0858 -0.1543 0.0530 0.0002 -0.1049 -0.0206 -0.0385 0.0096 -0.1604 -0.0589 -0.0003 0.0276 -0.0123 0.0144 -0.0044 0.0258 0.0376 -0.1273 -0.0034 -0.0652 0.0158 -0.0020 0.0233 -0.0098 0.0012 -0.1128 -0.1323 -0.2492 -0.2144 -0.2396 -0.1170 -0.2068 -0.1781 -0.2289 -0.2151 -0.2726 -0.6764 0.0116 0.0078 -0.1196 0.0093 -0.0331 0.0344 -0.2167 -0.1834 -0.2048 0.0162 -0.0530 -0.0544 -0.1327 -0.0200 -0.0595 0.0468 -0.1122 0.1768 0.0741 -0.0955 -0.0937 0.0103 -0.2589 -0.2711 -0.0188 -0.2015 -0.2784 -0.0114 0.1076 -0.1838 0.0957 0.0350 -0.1364 -0.1866 -0.1680 -0.0596 0.0479 0.2469 0.0452 0.0696 0.0219 -0.1342 -0.1988 -0.1860 -0.1042 -0.1084 -0.5288 -0.1735 -0.0894 0.0732 0.0332 -0.1002 -0.2516 0.0624 -0.0046 0.0375 0.1040 0.1240 -0.0090 0.0176 0.1592 0.0593 0.1008 -0.2387 0.0752 0.0939 -0.0897 -0.1614 0.0549 -0.0890 0.0333 -0.1352 -0.2148 -0.0853 -0.0990 0.0716 0.0094 -0.1063 0.0000 -0.0445 -0.1573 -0.2590 -0.3129 -0.2051 -0.1955 -0.1509 -0.4297 0.0795 0.3397 0.3366 0.1720 0.3122 -0.2637 -0.1493 -0.1165 0.1898 0.1733 0.1018 0.0613 -0.0469 -0.0632 -0.0061 -0.1867 -0.0554 -0.1041 -0.1176 -0.1343 -0.2465 -0.0165 0.0772 -0.0961 -0.1544 -0.1874 -0.1058 -0.1075 0.1579 0.0214 0.1243 -0.0290 0.0893 0.0299 0.1347 -0.0849 -0.2528 -0.1331 -0.2272 -0.0720 -0.2808 0.2004 0.0126 0.0150 0.0099 -0.1484 -0.3317 -0.1669 -0.0496 -0.0322 0.1634 -0.0864 0.1115 0.0548 -0.0290 -0.1454 -0.2172 -0.0654 -0.1427 -0.0040 -0.1839 0.0451 -0.1038 -0.1580 -0.0123 -0.1236 -0.2659 -0.3173 0.0634 -0.1673 -0.0927 -0.0403 0.0327 -0.0018 -0.1524 -0.0795 -0.2383 -0.1666 -0.4210 -0.0580 -0.4307 0.1264 0.0219 -0.0258 -0.0721 -0.0141 -0.1933 -0.2356 0.1194 0.0075 0.0399 -0.2210 -0.0707 -0.1726 -0.1922 -0.2125 -0.8371 -0.3027 -0.2571 -0.2719 -0.2392 -0.3424 -0.6039 -0.0579 0.0321 0.1909 0.1510 0.0084 -0.0200 0.0741 0.0864 0.1370 -0.1507 -0.1448 -0.0257 0.1075 -0.0551 0.0184 0.0183 0.0097 -0.1824 0.0377 -0.2888 -0.0271 0.2727 -0.0653 0.1060 -0.0175 -0.1735 0.1335 -0.2799 -0.0543 -0.0813 -0.0377 -0.0497 0.0411 0.1345 0.0397 -0.0693 0.1584 -0.0518 0.0121 0.0373 -0.0040 -0.0060 -0.0605 0.0653 -0.1859 -0.0741 0.0032 0.0063 0.0863 -0.1113 0.0831 0.0577 0.0304 -0.1862 0.2081 -0.0490 0.0856 0.4056 -0.1447 0.0371 0.0813 0.2418 0.0818 0.0884 -0.1923 -0.3278 0.0962 0.0549 0.1208 -0.2438 0.0225 0.1436 -0.1387 -0.0522 -0.0275 -0.3684 0.0210 -0.0237 -0.2133 -0.4312 0.3428 -0.0805 0.2730 0.1378 -0.1202 0.0269 0.0086 0.3278 0.2060 -0.3004 -0.0464 -0.0123 0.3831 0.0929 -0.1118 -0.2729 -0.4104 -0.3549 -0.0631 -0.4294 -0.0053 0.1014 -0.0202 0.0886 0.1121 0.0394 0.0747 0.1305 0.0450 0.0090 -0.0005 0.0503 -0.1016 0.1057 -0.1220 -0.1747 -0.2155 -0.3691 -0.1218 0.0148 0.2288 -0.0153 -0.1069 0.2147 -0.0721 0.0313 0.0209 0.0347 0.0764 -0.3177 0.0138 -0.1104 -0.0700 0.0283 0.1920 0.3156 -0.1541 0.3722 -0.1389 -0.0788 0.0730 0.0841 0.2597 0.0822 -0.0882 0.0259 0.0487 -0.0348 -0.0845 0.0462 0.0135 -0.0145 -0.1989 -0.0118 0.2573 0.0556 0.1910 0.1180 0.0387 -0.0163 -0.0805 0.1745 0.0614 0.1666 0.1422 0.1117 0.1323 0.0096 0.0440 -0.1995 0.0883 0.0716 0.0733 0.0979 0.1830 0.0902 0.1260 0.0395 -0.0288 0.1376 0.3685 -0.3973 -0.9314 0.4899 -0.1338 0.5025 -0.3995 -0.5718 -0.3774 -1.2036 -0.0810 -0.0756 0.0051 0.0571 -0.0637 0.0179 0.0448 -0.0025 -0.0230 0.0632 -0.1060 -0.0200 0.0145 -0.0035 -0.1071 -0.1137 0.0525 -0.1717 -0.1086 -0.0437 -0.0303 -0.0356 0.0431 0.0304 -0.0432 -0.0218 0.0823 0.0347 -0.1329 -0.1570 0.0560 -0.0571 0.1203 0.0418 0.0308 -0.0034 -0.0885 -0.1466 -0.0758 0.0316 0.0087 -0.0392 -0.0997 0.0074 -0.1093 -0.0576 0.0044 -0.1853 0.0174 0.0211 -0.0770 0.0238 -0.0023 -0.0368 0.0856 0.0760 -0.0910 0.0386 0.0162 0.0097 0.0374 0.0366 -0.0028 0.1372 -0.0835 0.0177 0.1021 0.0866 -0.0950 -0.2190 -0.1173 0.0431 0.0311 -0.1046 0.0020 -0.0347 -0.0695 0.0336 -0.1344 -0.1910 -0.0349 0.0198 0.0471 0.1354 0.0612 0.1116 0.0321 -0.0403 -0.1043 -0.0939 -0.1839 -0.2110 0.0472 -0.1253 -0.0998 -0.1321 -0.1302 -0.2000 -0.0866 -0.1071 -0.1114 -0.1434 -0.1149 0.0087 -0.0561 0.0528 -0.0395 0.0177 -0.0914 -0.0247 -0.1237 -0.1086 0.0513 -0.0047 -0.0208 -0.1189 -0.0251 -0.0229 -0.1580 0.0019 -0.1155 -0.0288 -0.0179 0.1597 -0.0923 0.0986 -0.0008 -0.1184 -0.0177 0.0100 -0.1150 -0.0515 -0.0036 -0.0601 0.1058 -0.0059 -0.0569 -0.0340 -0.0660 -0.0276 -0.0326 0.0095 -0.0102 0.1806 0.0440 -0.0266 0.0759 -0.1486 -0.0927 -0.0252 0.0638 -0.0331 0.0030 0.0037 0.1216 0.0067 -0.0437 -0.1142 0.0355 -0.1360 -0.0554 -0.0761 -0.0582 -0.0284 -0.0268 0.0587 0.0583 0.0644 -0.0164 0.0513 0.0182 0.0023 -0.0196 0.0012 -0.0670 0.0449 0.1024 0.0141 0.0834 0.0066 -0.1976 -0.1786 -0.4246 0.2109 0.0751 0.0385 -0.3854 -0.3230 -0.3075 -0.7763 0.0956 -0.2699 -0.0935 0.1163 0.1514 0.1151 -0.1108 0.0552 0.1243 0.0831 -0.1778 -0.0397 -0.0237 -0.2871 0.1488 -0.2589 0.5626 -0.3391 -0.1215 0.3228 0.2909 -0.1825 0.0499 0.5285 0.0255 -0.1815 0.0518 0.1897 0.3607 -0.1140 -0.0050 0.2188 -0.1883 0.0546 0.2820 -0.1680 -0.2966 -0.2934 -0.0032 0.5933 0.0229 -0.1061 0.0679 0.2632 0.3605 0.2511 0.0960 -0.2926 -0.0074 0.2006 0.1895 0.7594 -0.1668 0.2832 0.2469 -0.5721 -0.3280 -0.2824 0.1522 0.4712 0.0427 0.2088 0.1161 0.1488 0.6890 0.6529 0.2901 0.1541 -0.1942 -0.1580 -0.1881 0.2471 -0.0318 0.1847 -0.3039 -1.0330 -0.7759 -0.2690 -0.3871 -0.0547 0.0020 -0.1697 -0.2123 0.1868 0.3401 0.0165 0.1827 0.1277 -0.2538 0.0477 -0.2975 0.1409 0.1927 0.0950 0.0995 -0.6608 -0.0885 -0.5118 -0.5878 0.0636 -0.0613 -0.0408 0.0425 0.3159 0.3692 -0.1693 0.0281 0.4385 -0.0144 0.3001 -0.3396 -0.4995 0.6420 0.1737 -0.3081 -0.4764 0.2125 -0.5587 -0.7044 -0.1708 -0.2442 0.0196 0.0365 0.1872 0.0445 0.4848 0.0790 0.1861 -0.1247 0.1703 0.1142 0.0845 0.0489 0.1493 -0.0624 -0.4809 0.4486 -0.2035 -0.3731 0.2428 -0.0401 0.1455 -0.2599 0.2598 0.4588 0.6422 0.0098 -0.4687 0.4971 -0.0999 0.2860 0.0075 -0.0260 0.1767 -0.1301 0.5138 -0.2717 -0.0415 -0.4369 -0.0736 0.1503 0.3559 -0.0716 0.2856 0.2024 0.5480 0.1170 -0.2519 0.1009 0.0881 0.2988 -0.0027 -0.1797 -0.1091 -0.1726 -0.0988 -0.1690 -0.0611 -0.2161 0.0169 -1.3148 -0.1494 -0.0520 0.5213 0.1919 0.4770 -0.3489 -0.8444 -0.5813 -1.5572 -0.1167 0.0042 0.0100 -0.0467 0.0655 -0.0246 0.0539 0.0673 0.0198 0.0201 -0.0502 0.0251 0.0365 -0.0011 -0.0355 0.0268 -0.1158 0.0470 -0.0296 -0.0235 -0.1240 -0.0290 -0.0273 -0.0593 0.0406 0.0207 -0.0287 -0.0233 0.0227 0.0234 0.0423 -0.0409 -0.0309 0.0401 0.0491 -0.1381 -0.0014 0.0382 0.0484 0.0051 0.0159 -0.1461 -0.0808 0.0994 -0.0409 -0.0267 -0.0391 -0.0017 -0.0060 0.0029 -0.1250 -0.0842 -0.0077 -0.0080 0.0862 -0.0014 -0.1063 0.0047 0.0409 0.0190 -0.1214 -0.0345 -0.0172 0.0604 -0.0266 0.0358 -0.0110 0.0816 -0.1328 0.0376 -0.1149 0.0241 0.0290 -0.0183 0.0199 0.0530 -0.0328 0.0830 -0.0489 -0.0324 0.0187 -0.0069 0.0065 0.0065 0.0958 0.0221 0.0048 0.0375 -0.1496 -0.1406 0.0088 -0.1341 0.0087 -0.0493 0.0486 -0.1019 -0.0152 -0.0115 -0.1372 -0.0992 -0.0643 -0.0917 -0.1275 0.0334 -0.0655 0.0871 0.0349 0.0814 0.0135 -0.0640 -0.0987 -0.0111 -0.0445 -0.0777 -0.0400 -0.0271 0.0606 0.0555 -0.0680 0.0464 -0.1279 -0.0815 0.0570 0.0845 -0.0427 -0.0759 -0.0764 0.0444 -0.0048 0.0208 -0.0804 0.0014 -0.0619 -0.0108 0.0013 0.0315 -0.0363 -0.0748 0.0566 -0.0638 -0.1527 0.0236 -0.0172 0.0777 0.0246 0.1168 -0.0206 0.0448 -0.0269 -0.0985 -0.1008 0.0337 -0.0865 0.0611 -0.0257 -0.0127 -0.0243 -0.0163 0.0494 0.0637 -0.1367 0.0111 -0.0922 0.0170 -0.0619 -0.0753 -0.0209 -0.1005 0.0366 -0.1006 -0.0997 -0.0656 0.0257 0.0820 -0.0974 -0.0167 -0.0415 -0.0902 -0.0776 -0.0381 -0.2698 -0.2838 -0.2004 -0.1214 -0.1395 -0.2330 -0.4112 -0.4013 -0.3673 -0.7153 -0.1272 -0.1733 -0.0839 -0.0193 -0.1178 0.0514 -0.0104 0.0341 -0.1154 -0.1345 -0.0540 -0.0723 -0.0689 0.0806 -0.0012 -0.0985 0.0686 -0.0430 -0.0021 -0.0902 -0.1420 0.0358 -0.1392 0.0432 -0.0939 0.0029 0.0108 -0.1731 -0.0101 -0.0833 0.0178 0.0031 0.0687 -0.1143 -0.0663 -0.0044 0.0098 0.0439 -0.1155 0.0029 -0.0292 -0.1201 -0.0418 -0.0616 0.0038 -0.1290 0.0089 -0.0610 -0.1275 -0.0830 -0.0149 -0.0484 -0.0292 -0.0678 -0.0786 -0.0003 -0.0506 -0.0298 -0.0207 -0.0466 0.0346 0.0120 -0.0906 -0.0267 0.0559 -0.0594 -0.0532 -0.0053 -0.1299 -0.0420 -0.0690 -0.0572 -0.1139 0.0812 -0.0340 0.0767 -0.1141 0.0014 -0.1163 -0.0686 -0.0581 -0.0531 -0.1723 -0.1105 0.0351 -0.0662 -0.0526 0.0198 -0.0162 0.0469 0.0074 -0.0987 0.0413 0.0270 -0.0859 -0.0052 0.0700 -0.0481 0.0331 -0.0620 -0.1022 -0.1239 0.0285 -0.1466 -0.0747 -0.1125 -0.0385 -0.1211 -0.1172 0.0770 -0.0188 -0.1016 0.0539 0.0302 -0.0954 -0.0784 -0.1098 -0.0762 -0.0249 -0.0679 -0.1429 -0.1546 -0.1478 0.0137 0.0286 -0.0759 -0.0266 -0.1122 -0.0392 -0.0438 -0.0180 -0.1293 -0.0844 -0.0341 0.0083 -0.0665 0.0545 -0.0509 0.0504 -0.0744 0.0587 -0.1795 0.0279 -0.0461 0.0746 -0.0641 -0.0275 -0.0981 0.0151 -0.1188 -0.0126 -0.1383 0.0645 0.0182 -0.0246 -0.0930 -0.0864 -0.1493 0.0017 -0.1386 -0.0816 -0.0901 -0.0023 -0.0667 -0.0720 -0.1355 -0.1303 -0.1689 -0.0809 0.0266 0.0697 -0.0423 0.0381 0.0100 -0.1538 0.0226 -0.0727 0.0348 0.0074 -0.0452 -0.1933 -0.0893 -0.3358 -0.2626 -0.1839 -0.1622 -0.2643 -0.2920 -0.2702 -0.6275 0.0005 -0.0497 -0.0527 -0.0665 0.0250 0.0625 0.0193 -0.1256 -0.0877 -0.0676 -0.0808 -0.0059 0.0268 0.0361 0.0692 -0.1469 -0.0664 -0.0986 0.0076 0.0224 -0.0361 -0.0437 -0.1297 0.0678 -0.0094 -0.0780 0.0584 0.0373 -0.0303 0.0053 0.0024 -0.1253 -0.0229 -0.0792 0.0175 -0.0361 -0.0745 0.0255 -0.0849 0.0301 -0.0870 -0.0249 -0.0642 0.0093 -0.0641 0.0419 0.0670 0.0050 -0.0720 -0.0133 0.0117 0.0403 0.0273 0.0483 0.0786 0.0262 0.0069 -0.0389 -0.1396 -0.0029 0.0045 -0.1425 0.0143 -0.0663 -0.0419 -0.0624 0.1023 -0.0994 0.0143 -0.1262 0.0151 -0.0092 0.0696 -0.0028 -0.0545 -0.1059 0.0367 -0.0189 0.0119 -0.1622 0.0392 -0.1392 0.0478 -0.0422 -0.0377 0.1008 0.0236 -0.1236 -0.0361 -0.0990 -0.0791 0.0115 -0.0024 -0.0587 0.0128 -0.1441 0.0615 -0.1865 -0.0800 0.0461 -0.0224 -0.0615 -0.0802 0.0398 0.0539 -0.0510 0.0419 0.0239 0.0555 -0.1072 0.0021 -0.0548 -0.0485 -0.0525 -0.1226 -0.0948 0.0447 -0.1177 -0.1039 -0.1284 -0.0601 -0.1207 -0.1061 -0.0179 -0.0124 -0.0220 -0.0179 0.0328 -0.1490 -0.0247 -0.0085 -0.0476 0.0769 0.0793 0.0172 -0.1484 -0.0492 -0.1130 -0.0296 -0.0974 -0.1093 -0.0523 -0.0765 -0.0424 -0.1003 -0.0455 0.0704 0.0011 -0.1258 -0.0694 -0.1008 0.0105 -0.0105 -0.0968 0.0279 -0.0609 -0.0905 -0.0500 0.0241 0.0496 -0.0736 0.0208 -0.0897 0.0455 -0.0243 0.1029 -0.0764 -0.0015 -0.0897 0.0070 -0.0787 -0.0345 0.0318 0.0811 0.0088 -0.1250 -0.0792 -0.0747 -0.0328 -0.0271 -0.2520 -0.1563 -0.2852 -0.0927 -0.1169 -0.0928 -0.3666 -0.3113 -0.3900 -0.6423 -0.0831 0.0226 -0.3051 -0.1735 -0.0430 0.0866 -0.2135 -0.2358 -0.2620 0.0205 0.0297 -0.1119 -0.2270 0.0913 -0.0003 0.1643 -0.0637 0.2501 -0.0700 -0.0500 0.1639 0.1115 -0.0721 -0.3627 -0.0442 -0.1111 -0.3357 -0.3294 -0.0358 -0.1734 -0.0025 0.1087 -0.1527 -0.2969 -0.0586 0.0289 0.2122 0.1269 -0.0632 0.1098 -0.2428 -0.0985 -0.2744 -0.1482 -0.2906 -0.1829 -0.3638 -0.2251 -0.1281 0.1734 0.1267 -0.0098 -0.1061 -0.0505 -0.0064 0.0459 0.2108 0.1237 -0.0606 0.0747 -0.1074 -0.0281 -0.0468 -0.1343 -0.1744 -0.1271 -0.0883 -0.1519 -0.0103 -0.0272 0.2022 -0.0977 -0.1853 -0.0914 -0.0552 0.2121 0.1820 0.1600 0.1156 0.1472 -0.2348 -0.0925 -0.2345 -0.2889 -0.2767 -0.4385 -0.4502 0.0884 0.1840 0.3683 0.3864 0.2503 -0.2278 -0.1565 -0.0106 0.2688 0.2266 0.1621 0.1526 0.0236 0.1615 0.1271 -0.1822 -0.1603 -0.1587 -0.1158 -0.0474 -0.2032 -0.1475 0.0719 0.0308 0.0369 -0.1172 -0.2480 -0.0087 0.1278 0.1234 -0.0066 0.0762 0.0696 -0.0911 -0.0866 -0.2101 -0.2933 -0.1466 -0.1679 0.1162 -0.1827 0.1492 -0.1968 0.0482 0.0412 -0.2205 -0.2274 -0.1668 0.0336 0.0503 0.0098 -0.1101 0.1196 0.0775 -0.2774 -0.0534 -0.3558 -0.1338 -0.2030 -0.0271 -0.2024 0.0510 -0.0248 0.1102 0.1821 0.0738 -0.1901 -0.1734 0.1458 -0.0731 -0.0733 -0.2361 -0.0148 0.0690 -0.2296 -0.0269 -0.2080 -0.0579 -0.3085 0.0147 -0.2451 0.0289 0.0771 0.0038 -0.0758 -0.0296 -0.1658 -0.2599 0.0263 0.0368 -0.0124 -0.0673 -0.1578 -0.3450 -0.1812 -0.0750 -0.2135 -0.3687 -0.5888 -0.1632 -0.3213 -0.3148 -0.6244 * -------------------- * jct 2nd layer: row=numhid+1 (10F10.4), col=numout 0.3071 -0.3271 2.5986 -2.5910 -0.5951 0.0306 0.0881 0.5235 -1.6164 0.3667 -0.6628 3.8610 -0.7887 0.6777 1.3300 -1.6209 -0.1358 -0.1648 0.6287 -0.4671 0.2843 -0.3790 0.2789 -0.4461 -1.7934 3.3284 0.2495 0.7517 -0.1569 -0.0934 -0.2259 -0.0882 -0.4719 0.0752 1.3174 -1.5130 0.1387 -0.4115 -0.0879 0.1270 -0.3875 -0.0401 -0.3685 -0.1688 -0.2635 -0.1318 -0.8674 1.2244 0.7706 -0.6243 0.2580 3.5301 4.7714 -4.7233 0.1254 -0.1310 0.0453 -0.2530 -0.6286 0.2619 0.1264 -0.2507 0.1146 -0.3072 -2.1065 3.8620 -0.2813 1.2108 0.3692 -0.3186 -0.3840 -0.1145 0.6335 -0.6061 1.0890 -1.1813 -0.0506 -0.0507 0.0847 -0.0148 -1.7924 0.1829 -0.1456 -0.3517 0.6071 -0.6627 -1.3221 1.0525 -0.3218 0.3527 -1.8619 4.1969 -0.0429 0.5808 -0.0931 -0.2654 -0.2213 -0.1639 0.7675 -0.4839 0.1935 -0.2626 // profisis-1.0.11/profisisrc.default0000644015075101507510000000004511777007367014134 00000000000000[profisis] pkgdatadir=__pkgdatadir__ profisis-1.0.11/Makefile.am0000644015075101507510000000176712012404452012426 00000000000000SUBDIRS = examples man_MANS = profisis.1 dist_pkgdata_DATA = jctAuto9newHssp990-51 profisisrc.default dist_bin_SCRIPTS = profisis CLEANFILES = $(dist_man_MANS) %.1: % sed -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@" clean-local: rm -f profisis.1 dist-hook: rm -rf `find $(distdir) -name .svn` install-data-hook: find '$(DESTDIR)$(pkgdatadir)/profisisrc.default' -type f -exec sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' '{}' \; install-exec-hook: sed -i -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$(DESTDIR)$(bindir)/profisis" profisis-1.0.11/Makefile.in0000644015075101507510000007231312012425010012423 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = . DIST_COMMON = README $(am__configure_deps) $(dist_bin_SCRIPTS) \ $(dist_pkgdata_DATA) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in $(top_srcdir)/configure AUTHORS COPYING \ ChangeLog INSTALL NEWS install-sh missing ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \ configure.lineno config.status.lineno mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)" \ "$(DESTDIR)$(pkgdatadir)" SCRIPTS = $(dist_bin_SCRIPTS) SOURCES = DIST_SOURCES = RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-dvi-recursive install-exec-recursive \ install-html-recursive install-info-recursive \ install-pdf-recursive install-ps-recursive install-recursive \ installcheck-recursive installdirs-recursive pdf-recursive \ ps-recursive uninstall-recursive am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac man1dir = $(mandir)/man1 NROFF = nroff MANS = $(man_MANS) DATA = $(dist_pkgdata_DATA) RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive \ distclean-recursive maintainer-clean-recursive AM_RECURSIVE_TARGETS = $(RECURSIVE_TARGETS:-recursive=) \ $(RECURSIVE_CLEAN_TARGETS:-recursive=) tags TAGS ctags CTAGS \ distdir dist dist-all distcheck ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) am__remove_distdir = \ if test -d "$(distdir)"; then \ find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \ && rm -rf "$(distdir)" \ || { sleep 5 && rm -rf "$(distdir)"; }; \ else :; fi am__relativize = \ dir0=`pwd`; \ sed_first='s,^\([^/]*\)/.*$$,\1,'; \ sed_rest='s,^[^/]*/*,,'; \ sed_last='s,^.*/\([^/]*\)$$,\1,'; \ sed_butlast='s,/*[^/]*$$,,'; \ while test -n "$$dir1"; do \ first=`echo "$$dir1" | sed -e "$$sed_first"`; \ if test "$$first" != "."; then \ if test "$$first" = ".."; then \ dir2=`echo "$$dir0" | sed -e "$$sed_last"`/"$$dir2"; \ dir0=`echo "$$dir0" | sed -e "$$sed_butlast"`; \ else \ first2=`echo "$$dir2" | sed -e "$$sed_first"`; \ if test "$$first2" = "$$first"; then \ dir2=`echo "$$dir2" | sed -e "$$sed_rest"`; \ else \ dir2="../$$dir2"; \ fi; \ dir0="$$dir0"/"$$first"; \ fi; \ fi; \ dir1=`echo "$$dir1" | sed -e "$$sed_rest"`; \ done; \ reldir="$$dir2" DIST_ARCHIVES = $(distdir).tar.gz GZIP_ENV = --best distuninstallcheck_listfiles = find . -type f -print am__distuninstallcheck_listfiles = $(distuninstallcheck_listfiles) \ | sed 's|^\./|$(prefix)/|' | grep -v '$(infodir)/dir$$' distcleancheck_listfiles = find . -type f -print ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ SUBDIRS = examples man_MANS = profisis.1 dist_pkgdata_DATA = jctAuto9newHssp990-51 profisisrc.default dist_bin_SCRIPTS = profisis CLEANFILES = $(dist_man_MANS) all: all-recursive .SUFFIXES: am--refresh: Makefile @: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ echo ' cd $(srcdir) && $(AUTOMAKE) --gnu'; \ $(am__cd) $(srcdir) && $(AUTOMAKE) --gnu \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ echo ' $(SHELL) ./config.status'; \ $(SHELL) ./config.status;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(top_srcdir)/configure: $(am__configure_deps) $(am__cd) $(srcdir) && $(AUTOCONF) $(ACLOCAL_M4): $(am__aclocal_m4_deps) $(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS) $(am__aclocal_m4_deps): install-dist_binSCRIPTS: $(dist_bin_SCRIPTS) @$(NORMAL_INSTALL) @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(bindir)'"; \ $(MKDIR_P) "$(DESTDIR)$(bindir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; echo "$$p"; else :; fi; \ done | \ sed -e 'p;s,.*/,,;n' \ -e 'h;s|.*|.|' \ -e 'p;x;s,.*/,,;$(transform)' | sed 'N;N;N;s,\n, ,g' | \ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1; } \ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \ if ($$2 == $$4) { files[d] = files[d] " " $$1; \ if (++n[d] == $(am__install_max)) { \ print "f", d, files[d]; n[d] = 0; files[d] = "" } } \ else { print "f", d "/" $$4, $$1 } } \ END { for (d in files) print "f", d, files[d] }' | \ while read type dir files; do \ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \ test -z "$$files" || { \ echo " $(INSTALL_SCRIPT) $$files '$(DESTDIR)$(bindir)$$dir'"; \ $(INSTALL_SCRIPT) $$files "$(DESTDIR)$(bindir)$$dir" || exit $$?; \ } \ ; done uninstall-dist_binSCRIPTS: @$(NORMAL_UNINSTALL) @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || exit 0; \ files=`for p in $$list; do echo "$$p"; done | \ sed -e 's,.*/,,;$(transform)'`; \ dir='$(DESTDIR)$(bindir)'; $(am__uninstall_files_from_dir) install-man1: $(man_MANS) @$(NORMAL_INSTALL) @list1=''; \ list2='$(man_MANS)'; \ test -n "$(man1dir)" \ && test -n "`echo $$list1$$list2`" \ || exit 0; \ echo " $(MKDIR_P) '$(DESTDIR)$(man1dir)'"; \ $(MKDIR_P) "$(DESTDIR)$(man1dir)" || exit 1; \ { for i in $$list1; do echo "$$i"; done; \ if test -n "$$list2"; then \ for i in $$list2; do echo "$$i"; done \ | sed -n '/\.1[a-z]*$$/p'; \ fi; \ } | while read p; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; echo "$$p"; \ done | \ sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \ sed 'N;N;s,\n, ,g' | { \ list=; while read file base inst; do \ if test "$$base" = "$$inst"; then list="$$list $$file"; else \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst" || exit $$?; \ fi; \ done; \ for i in $$list; do echo "$$i"; done | $(am__base_list) | \ while read files; do \ test -z "$$files" || { \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man1dir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(man1dir)" || exit $$?; }; \ done; } uninstall-man1: @$(NORMAL_UNINSTALL) @list=''; test -n "$(man1dir)" || exit 0; \ files=`{ for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.1[a-z]*$$/p'; \ } | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \ dir='$(DESTDIR)$(man1dir)'; $(am__uninstall_files_from_dir) install-dist_pkgdataDATA: $(dist_pkgdata_DATA) @$(NORMAL_INSTALL) @list='$(dist_pkgdata_DATA)'; test -n "$(pkgdatadir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(pkgdatadir)'"; \ $(MKDIR_P) "$(DESTDIR)$(pkgdatadir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; \ done | $(am__base_list) | \ while read files; do \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(pkgdatadir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(pkgdatadir)" || exit $$?; \ done uninstall-dist_pkgdataDATA: @$(NORMAL_UNINSTALL) @list='$(dist_pkgdata_DATA)'; test -n "$(pkgdatadir)" || list=; \ files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \ dir='$(DESTDIR)$(pkgdatadir)'; $(am__uninstall_files_from_dir) # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" $(RECURSIVE_CLEAN_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) set x; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ set "$$@" "$$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ shift; \ if test -z "$(ETAGS_ARGS)$$*$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ if test $$# -gt 0; then \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ "$$@" $$unique; \ else \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$unique; \ fi; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && $(am__cd) $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) "$$here" distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @list='$(MANS)'; if test -n "$$list"; then \ list=`for p in $$list; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \ if test -n "$$list" && \ grep 'ab help2man is required to generate this page' $$list >/dev/null; then \ echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \ grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/ /' >&2; \ echo " to fix them, install help2man, remove and regenerate the man pages;" >&2; \ echo " typically \`make maintainer-clean' will remove them" >&2; \ exit 1; \ else :; fi; \ else :; fi $(am__remove_distdir) test -d "$(distdir)" || mkdir "$(distdir)" @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ $(am__make_dryrun) \ || test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ dir1=$$subdir; dir2="$(distdir)/$$subdir"; \ $(am__relativize); \ new_distdir=$$reldir; \ dir1=$$subdir; dir2="$(top_distdir)"; \ $(am__relativize); \ new_top_distdir=$$reldir; \ echo " (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir="$$new_top_distdir" distdir="$$new_distdir" \\"; \ echo " am__remove_distdir=: am__skip_length_check=: am__skip_mode_fix=: distdir)"; \ ($(am__cd) $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$new_top_distdir" \ distdir="$$new_distdir" \ am__remove_distdir=: \ am__skip_length_check=: \ am__skip_mode_fix=: \ distdir) \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook -test -n "$(am__skip_mode_fix)" \ || find "$(distdir)" -type d ! -perm -755 \ -exec chmod u+rwx,go+rx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r "$(distdir)" dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | BZIP2=$${BZIP2--9} bzip2 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-lzip: distdir tardir=$(distdir) && $(am__tar) | lzip -c $${LZIP_OPT--9} >$(distdir).tar.lz $(am__remove_distdir) dist-lzma: distdir tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma $(am__remove_distdir) dist-xz: distdir tardir=$(distdir) && $(am__tar) | XZ_OPT=$${XZ_OPT--e} xz -c >$(distdir).tar.xz $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.lzma*) \ lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\ *.tar.lz*) \ lzip -dc $(distdir).tar.lz | $(am__untar) ;;\ *.tar.xz*) \ xz -dc $(distdir).tar.xz | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod u+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) test -d $(distdir)/_build || exit 0; \ dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && am__cwd=`pwd` \ && $(am__cd) $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(AM_DISTCHECK_CONFIGURE_FLAGS) \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \ && cd "$$am__cwd" \ || exit 1 $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x' distuninstallcheck: @test -n '$(distuninstallcheck_dir)' || { \ echo 'ERROR: trying to run $@ with an empty' \ '$$(distuninstallcheck_dir)' >&2; \ exit 1; \ }; \ $(am__cd) '$(distuninstallcheck_dir)' || { \ echo 'ERROR: cannot chdir into $(distuninstallcheck_dir)' >&2; \ exit 1; \ }; \ test `$(am__distuninstallcheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: check-recursive all-am: Makefile $(SCRIPTS) $(MANS) $(DATA) installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)" "$(DESTDIR)$(pkgdatadir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: -test -z "$(CLEANFILES)" || rm -f $(CLEANFILES) distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-recursive clean-am: clean-generic clean-local mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -f Makefile distclean-am: clean-am distclean-generic distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive html-am: info: info-recursive info-am: install-data-am: install-dist_pkgdataDATA install-man @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-data-hook install-dvi: install-dvi-recursive install-dvi-am: install-exec-am: install-dist_binSCRIPTS @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-exec-hook install-html: install-html-recursive install-html-am: install-info: install-info-recursive install-info-am: install-man: install-man1 install-pdf: install-pdf-recursive install-pdf-am: install-ps: install-ps-recursive install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-dist_binSCRIPTS uninstall-dist_pkgdataDATA \ uninstall-man uninstall-man: uninstall-man1 .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) ctags-recursive \ install-am install-data-am install-exec-am install-strip \ tags-recursive .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am am--refresh check check-am clean clean-generic \ clean-local ctags ctags-recursive dist dist-all dist-bzip2 \ dist-gzip dist-hook dist-lzip dist-lzma dist-shar dist-tarZ \ dist-xz dist-zip distcheck distclean distclean-generic \ distclean-tags distcleancheck distdir distuninstallcheck dvi \ dvi-am html html-am info info-am install install-am \ install-data install-data-am install-data-hook \ install-dist_binSCRIPTS install-dist_pkgdataDATA install-dvi \ install-dvi-am install-exec install-exec-am install-exec-hook \ install-html install-html-am install-info install-info-am \ install-man install-man1 install-pdf install-pdf-am install-ps \ install-ps-am install-strip installcheck installcheck-am \ installdirs installdirs-am maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am tags tags-recursive uninstall uninstall-am \ uninstall-dist_binSCRIPTS uninstall-dist_pkgdataDATA \ uninstall-man uninstall-man1 %.1: % sed -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@" clean-local: rm -f profisis.1 dist-hook: rm -rf `find $(distdir) -name .svn` install-data-hook: find '$(DESTDIR)$(pkgdatadir)/profisisrc.default' -type f -exec sed -i -e 's|__datadir__|$(datadir)|g;s|__docdir__|$(docdir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' '{}' \; install-exec-hook: sed -i -e 's|__docdir__|$(docdir)|g;s|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$(DESTDIR)$(bindir)/profisis" # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: profisis-1.0.11/configure0000755015075101507510000030340612012425010012265 00000000000000#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.69 for profisis 1.0.11. # # Report bugs to . # # # Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc. # # # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # Use a proper internal environment variable to ensure we don't fall # into an infinite loop, continuously re-executing ourselves. if test x"${_as_can_reexec}" != xno && test "x$CONFIG_SHELL" != x; then _as_can_reexec=no; export _as_can_reexec; # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also # works around shells that cannot unset nonexistent variables. # Preserve -v and -x to the replacement shell. BASH_ENV=/dev/null ENV=/dev/null (unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV case $- in # (((( *v*x* | *x*v* ) as_opts=-vx ;; *v* ) as_opts=-v ;; *x* ) as_opts=-x ;; * ) as_opts= ;; esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. $as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 as_fn_exit 255 fi # We don't want this to propagate to other subprocesses. { _as_can_reexec=; unset _as_can_reexec;} if test "x$CONFIG_SHELL" = x; then as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which # is contrary to our usage. Disable this feature. alias -g '\${1+\"\$@\"}'='\"\$@\"' setopt NO_GLOB_SUBST else case \`(set -o) 2>/dev/null\` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi " as_required="as_fn_return () { (exit \$1); } as_fn_success () { as_fn_return 0; } as_fn_failure () { as_fn_return 1; } as_fn_ret_success () { return 0; } as_fn_ret_failure () { return 1; } exitcode=0 as_fn_success || { exitcode=1; echo as_fn_success failed.; } as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; } as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; } as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; } if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then : else exitcode=1; echo positional parameters were not saved. fi test x\$exitcode = x0 || exit 1 test -x / || exit 1" as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" && test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1" if (eval "$as_required") 2>/dev/null; then : as_have_required=yes else as_have_required=no fi if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then : else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR as_found=false for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. as_found=: case $as_dir in #( /*) for as_base in sh bash ksh sh5; do # Try only shells that exist, to save several forks. as_shell=$as_dir/$as_base if { test -f "$as_shell" || test -f "$as_shell.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then : CONFIG_SHELL=$as_shell as_have_required=yes if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then : break 2 fi fi done;; esac as_found=false done $as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then : CONFIG_SHELL=$SHELL as_have_required=yes fi; } IFS=$as_save_IFS if test "x$CONFIG_SHELL" != x; then : export CONFIG_SHELL # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also # works around shells that cannot unset nonexistent variables. # Preserve -v and -x to the replacement shell. BASH_ENV=/dev/null ENV=/dev/null (unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV case $- in # (((( *v*x* | *x*v* ) as_opts=-vx ;; *v* ) as_opts=-v ;; *x* ) as_opts=-x ;; * ) as_opts= ;; esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. $as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 exit 255 fi if test x$as_have_required = xno; then : $as_echo "$0: This script requires a shell more modern than all" $as_echo "$0: the shells that I found on your system." if test x${ZSH_VERSION+set} = xset ; then $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should" $as_echo "$0: be upgraded to zsh 4.3.4 or later." else $as_echo "$0: Please tell bug-autoconf@gnu.org and $0: https://rostlab.org/bugzilla3/enter_bug.cgi?product=profisis $0: about your system, including any error possibly output $0: before this message. Then install a modern shell, or $0: manually run the script under such a shell if you do $0: have one." fi exit 1 fi fi fi SHELL=${CONFIG_SHELL-/bin/sh} export SHELL # Unset more variables known to interfere with behavior of common tools. CLICOLOR_FORCE= GREP_OPTIONS= unset CLICOLOR_FORCE GREP_OPTIONS ## --------------------- ## ## M4sh Shell Functions. ## ## --------------------- ## # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p # as_fn_executable_p FILE # ----------------------- # Test if FILE is an executable regular file. as_fn_executable_p () { test -f "$1" && test -x "$1" } # as_fn_executable_p # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits as_lineno_1=$LINENO as_lineno_1a=$LINENO as_lineno_2=$LINENO as_lineno_2a=$LINENO eval 'test "x$as_lineno_1'$as_run'" != "x$as_lineno_2'$as_run'" && test "x`expr $as_lineno_1'$as_run' + 1`" = "x$as_lineno_2'$as_run'"' || { # Blame Lee E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; } # If we had to re-execute with $CONFIG_SHELL, we're ensured to have # already done that, so ensure we don't try to do so again and fall # in an infinite loop. This has already happened in practice. _as_can_reexec=no; export _as_can_reexec # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -pR'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -pR' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -pR' fi else as_ln_s='cp -pR' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi as_test_x='test -x' as_executable_p=as_fn_executable_p # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" test -n "$DJDIR" || exec 7<&0 &1 # Name of the host. # hostname on some systems (SVR3.2, old GNU/Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` # # Initializations. # ac_default_prefix=/usr/local ac_clean_files= ac_config_libobj_dir=. LIBOBJS= cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= # Identity of this package. PACKAGE_NAME='profisis' PACKAGE_TARNAME='profisis' PACKAGE_VERSION='1.0.11' PACKAGE_STRING='profisis 1.0.11' PACKAGE_BUGREPORT='https://rostlab.org/bugzilla3/enter_bug.cgi?product=profisis' PACKAGE_URL='' ac_unique_file="profisis" ac_subst_vars='LTLIBOBJS LIBOBJS am__untar am__tar AMTAR am__leading_dot SET_MAKE AWK mkdir_p MKDIR_P INSTALL_STRIP_PROGRAM STRIP install_sh MAKEINFO AUTOHEADER AUTOMAKE AUTOCONF ACLOCAL VERSION PACKAGE CYGPATH_W am__isrc INSTALL_DATA INSTALL_SCRIPT INSTALL_PROGRAM target_alias host_alias build_alias LIBS ECHO_T ECHO_N ECHO_C DEFS mandir localedir libdir psdir pdfdir dvidir htmldir infodir docdir oldincludedir includedir localstatedir sharedstatedir sysconfdir datadir datarootdir libexecdir sbindir bindir program_transform_name prefix exec_prefix PACKAGE_URL PACKAGE_BUGREPORT PACKAGE_STRING PACKAGE_VERSION PACKAGE_TARNAME PACKAGE_NAME PATH_SEPARATOR SHELL' ac_subst_files='' ac_user_opts=' enable_option_checking ' ac_precious_vars='build_alias host_alias target_alias' # Initialize some variables set by options. ac_init_help= ac_init_version=false ac_unrecognized_opts= ac_unrecognized_sep= # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. # (The list follows the same order as the GNU Coding Standards.) bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datarootdir='${prefix}/share' datadir='${datarootdir}' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' includedir='${prefix}/include' oldincludedir='/usr/include' docdir='${datarootdir}/doc/${PACKAGE_TARNAME}' infodir='${datarootdir}/info' htmldir='${docdir}' dvidir='${docdir}' pdfdir='${docdir}' psdir='${docdir}' libdir='${exec_prefix}/lib' localedir='${datarootdir}/locale' mandir='${datarootdir}/man' ac_prev= ac_dashdash= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval $ac_prev=\$ac_option ac_prev= continue fi case $ac_option in *=?*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; *=) ac_optarg= ;; *) ac_optarg=yes ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=*) datadir=$ac_optarg ;; -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ | --dataroo | --dataro | --datar) ac_prev=datarootdir ;; -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) datarootdir=$ac_optarg ;; -disable-* | --disable-*) ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=no ;; -docdir | --docdir | --docdi | --doc | --do) ac_prev=docdir ;; -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) docdir=$ac_optarg ;; -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) ac_prev=dvidir ;; -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) dvidir=$ac_optarg ;; -enable-* | --enable-*) ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=\$ac_optarg ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) ac_prev=htmldir ;; -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ | --ht=*) htmldir=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localedir | --localedir | --localedi | --localed | --locale) ac_prev=localedir ;; -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) localedir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst | --locals) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) ac_prev=pdfdir ;; -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) pdfdir=$ac_optarg ;; -psdir | --psdir | --psdi | --psd | --ps) ac_prev=psdir ;; -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) psdir=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=\$ac_optarg ;; -without-* | --without-*) ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=no ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) as_fn_error $? "unrecognized option: \`$ac_option' Try \`$0 --help' for more information" ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. case $ac_envvar in #( '' | [0-9]* | *[!_$as_cr_alnum]* ) as_fn_error $? "invalid variable name: \`$ac_envvar'" ;; esac eval $ac_envvar=\$ac_optarg export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}" ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` as_fn_error $? "missing argument to $ac_option" fi if test -n "$ac_unrecognized_opts"; then case $enable_option_checking in no) ;; fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;; *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; esac fi # Check all directory arguments for consistency. for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ datadir sysconfdir sharedstatedir localstatedir includedir \ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ libdir localedir mandir do eval ac_val=\$$ac_var # Remove trailing slashes. case $ac_val in */ ) ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'` eval $ac_var=\$ac_val;; esac # Be sure to have absolute directory names. case $ac_val in [\\/$]* | ?:[\\/]* ) continue;; NONE | '' ) case $ac_var in *prefix ) continue;; esac;; esac as_fn_error $? "expected an absolute directory name for --$ac_var: $ac_val" done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null ac_pwd=`pwd` && test -n "$ac_pwd" && ac_ls_di=`ls -di .` && ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || as_fn_error $? "working directory cannot be determined" test "X$ac_ls_di" = "X$ac_pwd_ls_di" || as_fn_error $? "pwd does not report name of working directory" # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then the parent directory. ac_confdir=`$as_dirname -- "$as_myself" || $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_myself" : 'X\(//\)[^/]' \| \ X"$as_myself" : 'X\(//\)$' \| \ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_myself" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` srcdir=$ac_confdir if test ! -r "$srcdir/$ac_unique_file"; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r "$srcdir/$ac_unique_file"; then test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." as_fn_error $? "cannot find sources ($ac_unique_file) in $srcdir" fi ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" ac_abs_confdir=`( cd "$srcdir" && test -r "./$ac_unique_file" || as_fn_error $? "$ac_msg" pwd)` # When building in place, set srcdir=. if test "$ac_abs_confdir" = "$ac_pwd"; then srcdir=. fi # Remove unnecessary trailing slashes from srcdir. # Double slashes in file names in object file debugging info # mess up M-x gdb in Emacs. case $srcdir in */) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; esac for ac_var in $ac_precious_vars; do eval ac_env_${ac_var}_set=\${${ac_var}+set} eval ac_env_${ac_var}_value=\$${ac_var} eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} eval ac_cv_env_${ac_var}_value=\$${ac_var} done # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures profisis 1.0.11 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking ...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] --datadir=DIR read-only architecture-independent data [DATAROOTDIR] --infodir=DIR info documentation [DATAROOTDIR/info] --localedir=DIR locale-dependent data [DATAROOTDIR/locale] --mandir=DIR man documentation [DATAROOTDIR/man] --docdir=DIR documentation root [DATAROOTDIR/doc/profisis] --htmldir=DIR html documentation [DOCDIR] --dvidir=DIR dvi documentation [DOCDIR] --pdfdir=DIR pdf documentation [DOCDIR] --psdir=DIR ps documentation [DOCDIR] _ACEOF cat <<\_ACEOF Program names: --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in short | recursive ) echo "Configuration of profisis 1.0.11:";; esac cat <<\_ACEOF Report bugs to . _ACEOF ac_status=$? fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d "$ac_dir" || { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } || continue ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } # Check for guested configure. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive elif test -f "$ac_srcdir/configure"; then echo && $SHELL "$ac_srcdir/configure" --help=recursive else $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF profisis configure 1.0.11 generated by GNU Autoconf 2.69 Copyright (C) 2012 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit fi ## ------------------------ ## ## Autoconf initialization. ## ## ------------------------ ## cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by profisis $as_me 1.0.11, which was generated by GNU Autoconf 2.69. Invocation command line was $ $0 $@ _ACEOF exec 5>>config.log { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` /usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. $as_echo "PATH: $as_dir" done IFS=$as_save_IFS } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) as_fn_append ac_configure_args0 " '$ac_arg'" ;; 2) as_fn_append ac_configure_args1 " '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi as_fn_append ac_configure_args " '$ac_arg'" ;; esac done done { ac_configure_args0=; unset ac_configure_args0;} { ac_configure_args1=; unset ac_configure_args1;} # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo $as_echo "## ---------------- ## ## Cache variables. ## ## ---------------- ##" echo # The following way of writing the cache mishandles newlines in values, ( for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( *${as_nl}ac_space=\ *) sed -n \ "s/'\''/'\''\\\\'\'''\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" ;; #( *) sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) echo $as_echo "## ----------------- ## ## Output variables. ## ## ----------------- ##" echo for ac_var in $ac_subst_vars do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then $as_echo "## ------------------- ## ## File substitutions. ## ## ------------------- ##" echo for ac_var in $ac_subst_files do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then $as_echo "## ----------- ## ## confdefs.h. ## ## ----------- ##" echo cat confdefs.h echo fi test "$ac_signal" != 0 && $as_echo "$as_me: caught signal $ac_signal" $as_echo "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; as_fn_exit 1' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h $as_echo "/* confdefs.h */" > confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_URL "$PACKAGE_URL" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer an explicitly selected file to automatically selected ones. ac_site_file1=NONE ac_site_file2=NONE if test -n "$CONFIG_SITE"; then # We do not want a PATH search for config.site. case $CONFIG_SITE in #(( -*) ac_site_file1=./$CONFIG_SITE;; */*) ac_site_file1=$CONFIG_SITE;; *) ac_site_file1=./$CONFIG_SITE;; esac elif test "x$prefix" != xNONE; then ac_site_file1=$prefix/share/config.site ac_site_file2=$prefix/etc/config.site else ac_site_file1=$ac_default_prefix/share/config.site ac_site_file2=$ac_default_prefix/etc/config.site fi for ac_site_file in "$ac_site_file1" "$ac_site_file2" do test "x$ac_site_file" = xNONE && continue if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5 $as_echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" \ || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "failed to load site script $ac_site_file See \`config.log' for more details" "$LINENO" 5; } fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special files # actually), so we avoid doing that. DJGPP emulates it as a regular file. if test /dev/null != "$cache_file" && test -f "$cache_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5 $as_echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5 $as_echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in $ac_precious_vars; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val=\$ac_cv_env_${ac_var}_value eval ac_new_val=\$ac_env_${ac_var}_value case $ac_old_set,$ac_new_set in set,) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then # differences in whitespace do not lead to failure. ac_old_val_w=`echo x $ac_old_val` ac_new_val_w=`echo x $ac_new_val` if test "$ac_old_val_w" != "$ac_new_val_w"; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5 $as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} ac_cache_corrupted=: else { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 $as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} eval $ac_var=\$ac_old_val fi { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5 $as_echo "$as_me: former value: \`$ac_old_val'" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5 $as_echo "$as_me: current value: \`$ac_new_val'" >&2;} fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) as_fn_append ac_configure_args " '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5 $as_echo "$as_me: error: changes in the environment can compromise the build" >&2;} as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5 fi ## -------------------- ## ## Main body of script. ## ## -------------------- ## ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu am__api_version='1.11' ac_aux_dir= for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do if test -f "$ac_dir/install-sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f "$ac_dir/install.sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f "$ac_dir/shtool"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5 fi # These three variables are undocumented and unsupported, # and are intended to be withdrawn in a future Autoconf release. # They can cause serious problems if a builder's source tree is in a directory # whose full name contains unusual characters. ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. # Reject install programs that cannot install multiple files. { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5 $as_echo_n "checking for a BSD-compatible install... " >&6; } if test -z "$INSTALL"; then if ${ac_cv_path_install+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in #(( ./ | .// | /[cC]/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else rm -rf conftest.one conftest.two conftest.dir echo one > conftest.one echo two > conftest.two mkdir conftest.dir if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" && test -s conftest.one && test -s conftest.two && test -s conftest.dir/conftest.one && test -s conftest.dir/conftest.two then ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi fi done done ;; esac done IFS=$as_save_IFS rm -rf conftest.one conftest.two conftest.dir fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5 $as_echo "$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether build environment is sane" >&5 $as_echo_n "checking whether build environment is sane... " >&6; } # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[\\\"\#\$\&\'\`$am_lf]*) as_fn_error $? "unsafe absolute working directory name" "$LINENO" 5;; esac case $srcdir in *[\\\"\#\$\&\'\`$am_lf\ \ ]*) as_fn_error $? "unsafe srcdir value: \`$srcdir'" "$LINENO" 5;; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$*" != "X $srcdir/configure conftest.file" \ && test "$*" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". as_fn_error $? "ls -t appears to fail. Make sure there is not a broken alias in your environment" "$LINENO" 5 fi test "$2" = conftest.file ) then # Ok. : else as_fn_error $? "newly created file is older than distributed files! Check your system clock" "$LINENO" 5 fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } test "$program_prefix" != NONE && program_transform_name="s&^&$program_prefix&;$program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s&\$&$program_suffix&;$program_transform_name" # Double any \ or $. # By default was `s,x,x', remove it if useless. ac_script='s/[\\$]/&&/g;s/;s,x,x,$//' program_transform_name=`$as_echo "$program_transform_name" | sed "$ac_script"` # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: \`missing' script is too old or missing" >&5 $as_echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;} fi if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. if test "$cross_compiling" != no; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $STRIP" >&5 $as_echo "$STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_ac_ct_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_STRIP="strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_STRIP" >&5 $as_echo "$ac_ct_STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_ct_STRIP" = x; then STRIP=":" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac STRIP=$ac_ct_STRIP fi else STRIP="$ac_cv_prog_STRIP" fi fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a thread-safe mkdir -p" >&5 $as_echo_n "checking for a thread-safe mkdir -p... " >&6; } if test -z "$MKDIR_P"; then if ${ac_cv_path_mkdir+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in mkdir gmkdir; do for ac_exec_ext in '' $ac_executable_extensions; do as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext" || continue case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #( 'mkdir (GNU coreutils) '* | \ 'mkdir (coreutils) '* | \ 'mkdir (fileutils) '4.1*) ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext break 3;; esac done done done IFS=$as_save_IFS fi test -d ./--version && rmdir ./--version if test "${ac_cv_path_mkdir+set}" = set; then MKDIR_P="$ac_cv_path_mkdir -p" else # As a last resort, use the slow shell script. Don't cache a # value for MKDIR_P within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. MKDIR_P="$ac_install_sh -d" fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $MKDIR_P" >&5 $as_echo "$MKDIR_P" >&6; } mkdir_p="$MKDIR_P" case $mkdir_p in [\\/$]* | ?:[\\/]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac for ac_prog in gawk mawk nawk awk do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_AWK+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$AWK"; then ac_cv_prog_AWK="$AWK" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_AWK="$ac_prog" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi AWK=$ac_cv_prog_AWK if test -n "$AWK"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $AWK" >&5 $as_echo "$AWK" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi test -n "$AWK" && break done { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5 $as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } set x ${MAKE-make} ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then : $as_echo_n "(cached) " >&6 else cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @echo '@@@%%%=$(MAKE)=@@@%%%' _ACEOF # GNU make sometimes prints "make[1]: Entering ...", which would confuse us. case `${MAKE-make} -f conftest.make 2>/dev/null` in *@@@%%%=?*=@@@%%%*) eval ac_cv_prog_make_${ac_make}_set=yes;; *) eval ac_cv_prog_make_${ac_make}_set=no;; esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } SET_MAKE= else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." am__isrc=' -I$(srcdir)' # test to see if srcdir already configured if test -f $srcdir/config.status; then as_fn_error $? "source directory already configured; run \"make distclean\" there first" "$LINENO" 5 fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi # Define the identity of the package. PACKAGE='profisis' VERSION='1.0.11' cat >>confdefs.h <<_ACEOF #define PACKAGE "$PACKAGE" _ACEOF cat >>confdefs.h <<_ACEOF #define VERSION "$VERSION" _ACEOF # Some tools Automake needs. ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"} AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"} AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"} AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"} MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"} # We need awk for the "check" target. The system "awk" is bad on # some platforms. # Always define AMTAR for backward compatibility. Yes, it's still used # in the wild :-( We should find a proper way to deprecate it ... AMTAR='$${TAR-tar}' am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -' ac_config_files="$ac_config_files Makefile examples/Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, we kill variables containing newlines. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. ( for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space=' '; set) 2>&1` in #( *${as_nl}ac_space=\ *) # `set' does not quote correctly, so add quotes: double-quote # substitution turns \\\\ into \\, and sed turns \\ into \. sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; #( *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) | sed ' /^ac_cv_env_/b end t clear :clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then if test "x$cache_file" != "x/dev/null"; then { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5 $as_echo "$as_me: updating cache $cache_file" >&6;} if test ! -f "$cache_file" || test -h "$cache_file"; then cat confcache >"$cache_file" else case $cache_file in #( */* | ?:*) mv -f confcache "$cache_file"$$ && mv -f "$cache_file"$$ "$cache_file" ;; #( *) mv -f confcache "$cache_file" ;; esac fi fi else { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5 $as_echo "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' # Transform confdefs.h into DEFS. # Protect against shell expansion while executing Makefile rules. # Protect against Makefile macro expansion. # # If the first sed substitution is executed (which looks for macros that # take arguments), then branch to the quote section. Otherwise, # look for a macro that doesn't take arguments. ac_script=' :mline /\\$/{ N s,\\\n,, b mline } t clear :clear s/^[ ]*#[ ]*define[ ][ ]*\([^ (][^ (]*([^)]*)\)[ ]*\(.*\)/-D\1=\2/g t quote s/^[ ]*#[ ]*define[ ][ ]*\([^ ][^ ]*\)[ ]*\(.*\)/-D\1=\2/g t quote b any :quote s/[ `~#$^&*(){}\\|;'\''"<>?]/\\&/g s/\[/\\&/g s/\]/\\&/g s/\$/$$/g H :any ${ g s/^\n// s/\n/ /g p } ' DEFS=`sed -n "$ac_script" confdefs.h` ac_libobjs= ac_ltlibobjs= U= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' ac_i=`$as_echo "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext" as_fn_append ac_ltlibobjs " \${LIBOBJDIR}$ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs : "${CONFIG_STATUS=./config.status}" ac_write_fail=0 ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5 $as_echo "$as_me: creating $CONFIG_STATUS" >&6;} as_write_fail=0 cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1 #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} export SHELL _ASEOF cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1 ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -pR'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -pR' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -pR' fi else as_ln_s='cp -pR' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi # as_fn_executable_p FILE # ----------------------- # Test if FILE is an executable regular file. as_fn_executable_p () { test -f "$1" && test -x "$1" } # as_fn_executable_p as_test_x='test -x' as_executable_p=as_fn_executable_p # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 ## ----------------------------------- ## ## Main body of $CONFIG_STATUS script. ## ## ----------------------------------- ## _ASEOF test $as_write_fail = 0 && chmod +x $CONFIG_STATUS || ac_write_fail=1 cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Save the log message, to keep $0 and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by profisis $as_me 1.0.11, which was generated by GNU Autoconf 2.69. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " _ACEOF case $ac_config_files in *" "*) set x $ac_config_files; shift; ac_config_files=$*;; esac cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 # Files that config.status was made for. config_files="$ac_config_files" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 ac_cs_usage="\ \`$as_me' instantiates files and other configuration actions from templates according to the current configuration. Unless the files and actions are specified as TAGs, all are instantiated by default. Usage: $0 [OPTION]... [TAG]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit --config print configuration, then exit -q, --quiet, --silent do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE Configuration files: $config_files Report bugs to ." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`" ac_cs_version="\\ profisis config.status 1.0.11 configured by $0, generated by GNU Autoconf 2.69, with options \\"\$ac_cs_config\\" Copyright (C) 2012 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='$ac_pwd' srcdir='$srcdir' INSTALL='$INSTALL' MKDIR_P='$MKDIR_P' AWK='$AWK' test -n "\$AWK" || AWK=awk _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # The default lists apply if the user does not specify any file. ac_need_defaults=: while test $# != 0 do case $1 in --*=?*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; --*=) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg= ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) $as_echo "$ac_cs_version"; exit ;; --config | --confi | --conf | --con | --co | --c ) $as_echo "$ac_cs_config"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; '') as_fn_error $? "missing file argument" ;; esac as_fn_append CONFIG_FILES " '$ac_optarg'" ac_need_defaults=false;; --he | --h | --help | --hel | -h ) $as_echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) as_fn_error $? "unrecognized option: \`$1' Try \`$0 --help' for more information." ;; *) as_fn_append ac_config_targets " $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 if \$ac_cs_recheck; then set X $SHELL '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion shift \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6 CONFIG_SHELL='$SHELL' export CONFIG_SHELL exec "\$@" fi _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX $as_echo "$ac_log" } >&5 _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; "examples/Makefile") CONFIG_FILES="$CONFIG_FILES examples/Makefile" ;; *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5;; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= ac_tmp= trap 'exit_status=$? : "${ac_tmp:=$tmp}" { test ! -d "$ac_tmp" || rm -fr "$ac_tmp"; } && exit $exit_status ' 0 trap 'as_fn_exit 1' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5 ac_tmp=$tmp # Set up the scripts for CONFIG_FILES section. # No need to generate them if there are no CONFIG_FILES. # This happens for instance with `./config.status config.h'. if test -n "$CONFIG_FILES"; then ac_cr=`echo X | tr X '\015'` # On cygwin, bash can eat \r inside `` if the user requested igncr. # But we know of no other shell where ac_cr would be empty at this # point, so we can use a bashism as a fallback. if test "x$ac_cr" = x; then eval ac_cr=\$\'\\r\' fi ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' /dev/null` if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then ac_cs_awk_cr='\\r' else ac_cs_awk_cr=$ac_cr fi echo 'BEGIN {' >"$ac_tmp/subs1.awk" && _ACEOF { echo "cat >conf$$subs.awk <<_ACEOF" && echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' && echo "_ACEOF" } >conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_num=`echo "$ac_subst_vars" | grep -c '^'` ac_delim='%!_!# ' for ac_last_try in false false false false false :; do . ./conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X` if test $ac_delim_n = $ac_delim_num; then break elif $ac_last_try; then as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done rm -f conf$$subs.sh cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 cat >>"\$ac_tmp/subs1.awk" <<\\_ACAWK && _ACEOF sed -n ' h s/^/S["/; s/!.*/"]=/ p g s/^[^!]*!// :repl t repl s/'"$ac_delim"'$// t delim :nl h s/\(.\{148\}\)..*/\1/ t more1 s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/ p n b repl :more1 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t nl :delim h s/\(.\{148\}\)..*/\1/ t more2 s/["\\]/\\&/g; s/^/"/; s/$/"/ p b :more2 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t delim ' >$CONFIG_STATUS || ac_write_fail=1 rm -f conf$$subs.awk cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACAWK cat >>"\$ac_tmp/subs1.awk" <<_ACAWK && for (key in S) S_is_set[key] = 1 FS = "" } { line = $ 0 nfields = split(line, field, "@") substed = 0 len = length(field[1]) for (i = 2; i < nfields; i++) { key = field[i] keylen = length(key) if (S_is_set[key]) { value = S[key] line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3) len += length(value) + length(field[++i]) substed = 1 } else len += 1 + keylen } print line } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g" else cat fi < "$ac_tmp/subs1.awk" > "$ac_tmp/subs.awk" \ || as_fn_error $? "could not setup config files machinery" "$LINENO" 5 _ACEOF # VPATH may cause trouble with some makes, so we remove sole $(srcdir), # ${srcdir} and @srcdir@ entries from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=[ ]*/{ h s/// s/^/:/ s/[ ]*$/:/ s/:\$(srcdir):/:/g s/:\${srcdir}:/:/g s/:@srcdir@:/:/g s/^:*// s/:*$// x s/\(=[ ]*\).*/\1/ G s/\n// s/^[^=]*=[ ]*$// }' fi cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 fi # test -n "$CONFIG_FILES" eval set X " :F $CONFIG_FILES " shift for ac_tag do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5;; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$ac_tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;; esac case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac as_fn_append ac_file_inputs " '$ac_f'" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 $as_echo "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) ac_sed_conf_input=`$as_echo "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac case $ac_tag in *:-:* | *:-) cat >"$ac_tmp/stdin" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir="$ac_dir"; as_fn_mkdir_p ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac ac_MKDIR_P=$MKDIR_P case $MKDIR_P in [\\/$]* | ?:[\\/]* ) ;; */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;; esac _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= ac_sed_dataroot=' /datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 $as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_datarootdir_hack=' s&@datadir@&$datadir&g s&@docdir@&$docdir&g s&@infodir@&$infodir&g s&@localedir@&$localedir&g s&@mandir@&$mandir&g s&\\\${datarootdir}&$datarootdir&g' ;; esac _ACEOF # Neutralize VPATH when `$srcdir' = `.'. # Shell code in configure.ac might set extrasub. # FIXME: do we really want to maintain this feature? cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_sed_extra="$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s|@configure_input@|$ac_sed_conf_input|;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@top_build_prefix@&$ac_top_build_prefix&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t s&@MKDIR_P@&$ac_MKDIR_P&;t t $ac_datarootdir_hack " eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$ac_tmp/subs.awk" \ >$ac_tmp/out || as_fn_error $? "could not create $ac_file" "$LINENO" 5 test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \ "$ac_tmp/out"`; test -z "$ac_out"; } && { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&5 $as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&2;} rm -f "$ac_tmp/stdin" case $ac_file in -) cat "$ac_tmp/out" && rm -f "$ac_tmp/out";; *) rm -f "$ac_file" && mv "$ac_tmp/out" "$ac_file";; esac \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac done # for ac_tag as_fn_exit 0 _ACEOF ac_clean_files=$ac_clean_files_save test $ac_write_fail = 0 || as_fn_error $? "write failure creating $CONFIG_STATUS" "$LINENO" 5 # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || as_fn_exit 1 fi if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} fi profisis-1.0.11/AUTHORS0000644015075101507510000000003211777007367011447 00000000000000Yanay Ofran Burkhard Rost profisis-1.0.11/COPYING0000644015075101507510000010451311777007617011441 00000000000000 GNU GENERAL PUBLIC LICENSE Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such measures. When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a) The work must carry prominent notices stating that you modified it, and giving a relevant date. b) The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c) You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d) If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a) Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b) Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c) Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d) Limiting the use for publicity purposes of names of licensors or authors of the material; or e) Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f) Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of this License. Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively state the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . Also add information on how to contact you by electronic and paper mail. If the program does terminal interaction, make it output a short notice like this when it starts in an interactive mode: Copyright (C) This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, your program's commands might be different; for a GUI interface, you would use an "about box". You should also get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply and follow the GNU GPL, see . The GNU General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Lesser General Public License instead of this License. But first, please read . profisis-1.0.11/ChangeLog0000644015075101507510000000364312012405573012144 00000000000000profisis (1.0.11) unstable; urgency=low * Described how to generate HSSP files on man page. * Replaced non-free example HSSP file with free version. -- Laszlo Kajan Tue, 14 Aug 2012 10:24:25 +0200 profisis (1.0.10) unstable; urgency=low * Added succint mode -- only showing per residue annotation without confidence value -- Guy Yachdav Mon, 06 Aug 2012 21:27:27 +0200 profisis (1.0.9) unstable; urgency=low * examples -> $(docdir)/examples/ -- Laszlo Kajan Thu, 12 Jul 2012 18:43:44 +0200 profisis (1.0.8) unstable; urgency=low * Fixed license on man page. -- Laszlo Kajan Wed, 11 Jul 2012 15:38:10 +0200 profisis (1.0.7) unstable; urgency=low * Release under GPL. -- Laszlo Kajan Tue, 10 Jul 2012 13:16:55 +0200 profisis (1.0.6) unstable; urgency=low * Debianization removed from this package. -- Laszlo Kajan Tue, 03 Jul 2012 19:37:07 +0200 profisis (1.0.5) stable; urgency=low * warn if pp-popcon is not installed -- Laszlo Kajan Mon, 28 Feb 2011 18:17:50 +0100 profisis (1.0.4) stable; urgency=low * Debian native now * bugzilla url * popularity contest -- Laszlo Kajan Fri, 18 Feb 2011 22:35:59 +0100 profisis (1.0.3) * profrdb -> rdbProf for consistency - second attempt -- Laszlo Kajan Fri, 07 May 2010 14:09:13 +0200 profisis (1.0.2) * Corrected man page environment variable * profrdb -> rdbprof for consistency -- Laszlo Kajan Fri, 07 May 2010 14:09:13 +0200 profisis (1.0.1) * Updated manpage with example and other sections * Examples are now installed -- Laszlo Kajan Sat, 24 Apr 2010 20:30:53 +0200 profisis (1.0.0) * Initial packaged version -- Laszlo Kajan Sat, 24 Apr 2010 20:30:53 +0200 profisis-1.0.11/INSTALL0000644015075101507510000003660011777007367011442 00000000000000Installation Instructions ************************* Copyright (C) 1994-1996, 1999-2002, 2004-2011 Free Software Foundation, Inc. Copying and distribution of this file, with or without modification, are permitted in any medium without royalty provided the copyright notice and this notice are preserved. This file is offered as-is, without warranty of any kind. Basic Installation ================== Briefly, the shell commands `./configure; make; make install' should configure, build, and install this package. The following more-detailed instructions are generic; see the `README' file for instructions specific to this package. Some packages provide this `INSTALL' file but do not implement all of the features documented below. The lack of an optional feature in a given package is not necessarily a bug. More recommendations for GNU packages can be found in *note Makefile Conventions: (standards)Makefile Conventions. The `configure' shell script attempts to guess correct values for various system-dependent variables used during compilation. It uses those values to create a `Makefile' in each directory of the package. It may also create one or more `.h' files containing system-dependent definitions. Finally, it creates a shell script `config.status' that you can run in the future to recreate the current configuration, and a file `config.log' containing compiler output (useful mainly for debugging `configure'). It can also use an optional file (typically called `config.cache' and enabled with `--cache-file=config.cache' or simply `-C') that saves the results of its tests to speed up reconfiguring. Caching is disabled by default to prevent problems with accidental use of stale cache files. If you need to do unusual things to compile the package, please try to figure out how `configure' could check whether to do them, and mail diffs or instructions to the address given in the `README' so they can be considered for the next release. If you are using the cache, and at some point `config.cache' contains results you don't want to keep, you may remove or edit it. The file `configure.ac' (or `configure.in') is used to create `configure' by a program called `autoconf'. You need `configure.ac' if you want to change it or regenerate `configure' using a newer version of `autoconf'. The simplest way to compile this package is: 1. `cd' to the directory containing the package's source code and type `./configure' to configure the package for your system. Running `configure' might take a while. While running, it prints some messages telling which features it is checking for. 2. Type `make' to compile the package. 3. Optionally, type `make check' to run any self-tests that come with the package, generally using the just-built uninstalled binaries. 4. Type `make install' to install the programs and any data files and documentation. When installing into a prefix owned by root, it is recommended that the package be configured and built as a regular user, and only the `make install' phase executed with root privileges. 5. Optionally, type `make installcheck' to repeat any self-tests, but this time using the binaries in their final installed location. This target does not install anything. Running this target as a regular user, particularly if the prior `make install' required root privileges, verifies that the installation completed correctly. 6. You can remove the program binaries and object files from the source code directory by typing `make clean'. To also remove the files that `configure' created (so you can compile the package for a different kind of computer), type `make distclean'. There is also a `make maintainer-clean' target, but that is intended mainly for the package's developers. If you use it, you may have to get all sorts of other programs in order to regenerate files that came with the distribution. 7. Often, you can also type `make uninstall' to remove the installed files again. In practice, not all packages have tested that uninstallation works correctly, even though it is required by the GNU Coding Standards. 8. Some packages, particularly those that use Automake, provide `make distcheck', which can by used by developers to test that all other targets like `make install' and `make uninstall' work correctly. This target is generally not run by end users. Compilers and Options ===================== Some systems require unusual options for compilation or linking that the `configure' script does not know about. Run `./configure --help' for details on some of the pertinent environment variables. You can give `configure' initial values for configuration parameters by setting variables in the command line or in the environment. Here is an example: ./configure CC=c99 CFLAGS=-g LIBS=-lposix *Note Defining Variables::, for more details. Compiling For Multiple Architectures ==================================== You can compile the package for more than one kind of computer at the same time, by placing the object files for each architecture in their own directory. To do this, you can use GNU `make'. `cd' to the directory where you want the object files and executables to go and run the `configure' script. `configure' automatically checks for the source code in the directory that `configure' is in and in `..'. This is known as a "VPATH" build. With a non-GNU `make', it is safer to compile the package for one architecture at a time in the source code directory. After you have installed the package for one architecture, use `make distclean' before reconfiguring for another architecture. On MacOS X 10.5 and later systems, you can create libraries and executables that work on multiple system types--known as "fat" or "universal" binaries--by specifying multiple `-arch' options to the compiler but only a single `-arch' option to the preprocessor. Like this: ./configure CC="gcc -arch i386 -arch x86_64 -arch ppc -arch ppc64" \ CXX="g++ -arch i386 -arch x86_64 -arch ppc -arch ppc64" \ CPP="gcc -E" CXXCPP="g++ -E" This is not guaranteed to produce working output in all cases, you may have to build one architecture at a time and combine the results using the `lipo' tool if you have problems. Installation Names ================== By default, `make install' installs the package's commands under `/usr/local/bin', include files under `/usr/local/include', etc. You can specify an installation prefix other than `/usr/local' by giving `configure' the option `--prefix=PREFIX', where PREFIX must be an absolute file name. You can specify separate installation prefixes for architecture-specific files and architecture-independent files. If you pass the option `--exec-prefix=PREFIX' to `configure', the package uses PREFIX as the prefix for installing programs and libraries. Documentation and other data files still use the regular prefix. In addition, if you use an unusual directory layout you can give options like `--bindir=DIR' to specify different values for particular kinds of files. Run `configure --help' for a list of the directories you can set and what kinds of files go in them. In general, the default for these options is expressed in terms of `${prefix}', so that specifying just `--prefix' will affect all of the other directory specifications that were not explicitly provided. The most portable way to affect installation locations is to pass the correct locations to `configure'; however, many packages provide one or both of the following shortcuts of passing variable assignments to the `make install' command line to change installation locations without having to reconfigure or recompile. The first method involves providing an override variable for each affected directory. For example, `make install prefix=/alternate/directory' will choose an alternate location for all directory configuration variables that were expressed in terms of `${prefix}'. Any directories that were specified during `configure', but not in terms of `${prefix}', must each be overridden at install time for the entire installation to be relocated. The approach of makefile variable overrides for each directory variable is required by the GNU Coding Standards, and ideally causes no recompilation. However, some platforms have known limitations with the semantics of shared libraries that end up requiring recompilation when using this method, particularly noticeable in packages that use GNU Libtool. The second method involves providing the `DESTDIR' variable. For example, `make install DESTDIR=/alternate/directory' will prepend `/alternate/directory' before all installation names. The approach of `DESTDIR' overrides is not required by the GNU Coding Standards, and does not work on platforms that have drive letters. On the other hand, it does better at avoiding recompilation issues, and works well even when some directory options were not specified in terms of `${prefix}' at `configure' time. Optional Features ================= If the package supports it, you can cause programs to be installed with an extra prefix or suffix on their names by giving `configure' the option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'. Some packages pay attention to `--enable-FEATURE' options to `configure', where FEATURE indicates an optional part of the package. They may also pay attention to `--with-PACKAGE' options, where PACKAGE is something like `gnu-as' or `x' (for the X Window System). The `README' should mention any `--enable-' and `--with-' options that the package recognizes. For packages that use the X Window System, `configure' can usually find the X include and library files automatically, but if it doesn't, you can use the `configure' options `--x-includes=DIR' and `--x-libraries=DIR' to specify their locations. Some packages offer the ability to configure how verbose the execution of `make' will be. For these packages, running `./configure --enable-silent-rules' sets the default to minimal output, which can be overridden with `make V=1'; while running `./configure --disable-silent-rules' sets the default to verbose, which can be overridden with `make V=0'. Particular systems ================== On HP-UX, the default C compiler is not ANSI C compatible. If GNU CC is not installed, it is recommended to use the following options in order to use an ANSI C compiler: ./configure CC="cc -Ae -D_XOPEN_SOURCE=500" and if that doesn't work, install pre-built binaries of GCC for HP-UX. HP-UX `make' updates targets which have the same time stamps as their prerequisites, which makes it generally unusable when shipped generated files such as `configure' are involved. Use GNU `make' instead. On OSF/1 a.k.a. Tru64, some versions of the default C compiler cannot parse its `' header file. The option `-nodtk' can be used as a workaround. If GNU CC is not installed, it is therefore recommended to try ./configure CC="cc" and if that doesn't work, try ./configure CC="cc -nodtk" On Solaris, don't put `/usr/ucb' early in your `PATH'. This directory contains several dysfunctional programs; working variants of these programs are available in `/usr/bin'. So, if you need `/usr/ucb' in your `PATH', put it _after_ `/usr/bin'. On Haiku, software installed for all users goes in `/boot/common', not `/usr/local'. It is recommended to use the following options: ./configure --prefix=/boot/common Specifying the System Type ========================== There may be some features `configure' cannot figure out automatically, but needs to determine by the type of machine the package will run on. Usually, assuming the package is built to be run on the _same_ architectures, `configure' can figure that out, but if it prints a message saying it cannot guess the machine type, give it the `--build=TYPE' option. TYPE can either be a short name for the system type, such as `sun4', or a canonical name which has the form: CPU-COMPANY-SYSTEM where SYSTEM can have one of these forms: OS KERNEL-OS See the file `config.sub' for the possible values of each field. If `config.sub' isn't included in this package, then this package doesn't need to know the machine type. If you are _building_ compiler tools for cross-compiling, you should use the option `--target=TYPE' to select the type of system they will produce code for. If you want to _use_ a cross compiler, that generates code for a platform different from the build platform, you should specify the "host" platform (i.e., that on which the generated programs will eventually be run) with `--host=TYPE'. Sharing Defaults ================ If you want to set default values for `configure' scripts to share, you can create a site shell script called `config.site' that gives default values for variables like `CC', `cache_file', and `prefix'. `configure' looks for `PREFIX/share/config.site' if it exists, then `PREFIX/etc/config.site' if it exists. Or, you can set the `CONFIG_SITE' environment variable to the location of the site script. A warning: not all `configure' scripts look for a site script. Defining Variables ================== Variables not defined in a site shell script can be set in the environment passed to `configure'. However, some packages may run configure again during the build, and the customized values of these variables may be lost. In order to avoid this problem, you should set them in the `configure' command line, using `VAR=value'. For example: ./configure CC=/usr/local2/bin/gcc causes the specified `gcc' to be used as the C compiler (unless it is overridden in the site shell script). Unfortunately, this technique does not work for `CONFIG_SHELL' due to an Autoconf bug. Until the bug is fixed you can use this workaround: CONFIG_SHELL=/bin/bash /bin/bash ./configure CONFIG_SHELL=/bin/bash `configure' Invocation ====================== `configure' recognizes the following options to control how it operates. `--help' `-h' Print a summary of all of the options to `configure', and exit. `--help=short' `--help=recursive' Print a summary of the options unique to this package's `configure', and exit. The `short' variant lists options used only in the top level, while the `recursive' variant lists options also present in any nested packages. `--version' `-V' Print the version of Autoconf used to generate the `configure' script, and exit. `--cache-file=FILE' Enable the cache: use and save the results of the tests in FILE, traditionally `config.cache'. FILE defaults to `/dev/null' to disable caching. `--config-cache' `-C' Alias for `--cache-file=config.cache'. `--quiet' `--silent' `-q' Do not print messages saying which checks are being made. To suppress all normal output, redirect it to `/dev/null' (any error messages will still be shown). `--srcdir=DIR' Look for the package's source code in directory DIR. Usually `configure' can determine that directory automatically. `--prefix=DIR' Use DIR as the installation prefix. *note Installation Names:: for more details, including other options available for fine-tuning the installation locations. `--no-create' `-n' Run the configure checks, but stop before creating any output files. `configure' also accepts some other, not widely useful, options. Run `configure --help' for more details. profisis-1.0.11/NEWS0000644015075101507510000000000011777007366011070 00000000000000profisis-1.0.11/install-sh0000755015075101507510000003325611777007617012417 00000000000000#!/bin/sh # install - install a program, script, or datafile scriptversion=2011-01-19.21; # UTC # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit=${DOITPROG-} if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. chgrpprog=${CHGRPPROG-chgrp} chmodprog=${CHMODPROG-chmod} chownprog=${CHOWNPROG-chown} cmpprog=${CMPPROG-cmp} cpprog=${CPPROG-cp} mkdirprog=${MKDIRPROG-mkdir} mvprog=${MVPROG-mv} rmprog=${RMPROG-rm} stripprog=${STRIPPROG-strip} posix_glob='?' initialize_posix_glob=' test "$posix_glob" != "?" || { if (set -f) 2>/dev/null; then posix_glob= else posix_glob=: fi } ' posix_mkdir= # Desired mode of installed file. mode=0755 chgrpcmd= chmodcmd=$chmodprog chowncmd= mvcmd=$mvprog rmcmd="$rmprog -f" stripcmd= src= dst= dir_arg= dst_arg= copy_on_change=false no_target_directory= usage="\ Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: --help display this help and exit. --version display version info and exit. -c (ignored) -C install only if different (preserve the last data modification time) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) ;; -C) copy_on_change=true;; -d) dir_arg=true;; -g) chgrpcmd="$chgrpprog $2" shift;; --help) echo "$usage"; exit $?;; -m) mode=$2 case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac shift;; -o) chowncmd="$chownprog $2" shift;; -s) stripcmd=$stripprog;; -t) dst_arg=$2 # Protect names problematic for `test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac shift;; -T) no_target_directory=true;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac shift done if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dst_arg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dst_arg" shift # fnord fi shift # arg dst_arg=$arg # Protect names problematic for `test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call `install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then do_exit='(exit $ret); exit $ret' trap "ret=129; $do_exit" 1 trap "ret=130; $do_exit" 2 trap "ret=141; $do_exit" 13 trap "ret=143; $do_exit" 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names problematic for `test' and other utilities. case $src in -* | [=\(\)!]) src=./$src;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dst_arg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dst_arg # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dst_arg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writeable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix='/';; [-=\(\)!]*) prefix='./';; *) prefix='';; esac eval "$initialize_posix_glob" oIFS=$IFS IFS=/ $posix_glob set -f set fnord $dstdir shift $posix_glob set +f IFS=$oIFS prefixes= for d do test X"$d" = X && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # If -C, don't bother to copy if it wouldn't change the file. if $copy_on_change && old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && eval "$initialize_posix_glob" && $posix_glob set -f && set X $old && old=:$2:$4:$5:$6 && set X $new && new=:$2:$4:$5:$6 && $posix_glob set +f && test "$old" = "$new" && $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 then rm -f "$dsttmp" else # Rename the file to the real destination. $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. { # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { test ! -f "$dst" || $doit $rmcmd -f "$dst" 2>/dev/null || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; } } || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } fi || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: profisis-1.0.11/missing0000755015075101507510000002415211777007617012005 00000000000000#! /bin/sh # Common stub for a few missing GNU programs while installing. scriptversion=2012-01-06.13; # UTC # Copyright (C) 1996, 1997, 1999, 2000, 2002, 2003, 2004, 2005, 2006, # 2008, 2009, 2010, 2011, 2012 Free Software Foundation, Inc. # Originally by Fran,cois Pinard , 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program. If not, see . # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi run=: sed_output='s/.* --output[ =]\([^ ]*\).*/\1/p' sed_minuso='s/.* -o \([^ ]*\).*/\1/p' # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.ac; then configure_ac=configure.ac else configure_ac=configure.in fi msg="missing on your system" case $1 in --run) # Try to run requested program, and just exit if it succeeds. run= shift "$@" && exit 0 # Exit code 63 means version mismatch. This often happens # when the user try to use an ancient version of a tool on # a file that requires a minimum version. In this case we # we should proceed has if the program had been absent, or # if --run hadn't been passed. if test $? = 63; then run=: msg="probably too old" fi ;; -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit --run try to run the given command, and emulate it if it fails Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' autom4te touch the output file, or create a stub one automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c help2man touch the output file lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file yacc create \`y.tab.[ch]', if possible, from existing .[ch] Version suffixes to PROGRAM as well as the prefixes \`gnu-', \`gnu', and \`g' are ignored when checking the name. Send bug reports to ." exit $? ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing $scriptversion (GNU Automake)" exit $? ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; esac # normalize program name to check for. program=`echo "$1" | sed ' s/^gnu-//; t s/^gnu//; t s/^g//; t'` # Now exit if we have it, but it failed. Also exit now if we # don't have it and --version was passed (most likely to detect # the program). This is about non-GNU programs, so use $1 not # $program. case $1 in lex*|yacc*) # Not GNU programs, they don't have --version. ;; *) if test -z "$run" && ($1 --version) > /dev/null 2>&1; then # We have it, but it failed. exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then # Could not run --version or --help. This is probably someone # running `$TOOL --version' or `$TOOL --help' to check whether # $TOOL exists and not knowing $TOOL uses missing. exit 1 fi ;; esac # If it does not exist, or fails to run (possibly an outdated version), # try to emulate it. case $program in aclocal*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acconfig.h' or \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}` test -z "$files" && files="config.h" touch_files= for f in $files; do case $f in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; autom4te*) echo 1>&2 "\ WARNING: \`$1' is needed, but is $msg. You might have modified some files without having the proper tools for further handling them. You can get \`$1' as part of \`Autoconf' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo "#! /bin/sh" echo "# Created by GNU Automake missing as a replacement of" echo "# $ $@" echo "exit 0" chmod +x $file exit 1 fi ;; bison*|yacc*) echo 1>&2 "\ WARNING: \`$1' $msg. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if test $# -ne 1; then eval LASTARG=\${$#} case $LASTARG in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.h fi ;; esac fi if test ! -f y.tab.h; then echo >y.tab.h fi if test ! -f y.tab.c; then echo 'main() { return 0; }' >y.tab.c fi ;; lex*|flex*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if test $# -ne 1; then eval LASTARG=\${$#} case $LASTARG in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if test ! -f lex.yy.c; then echo 'main() { return 0; }' >lex.yy.c fi ;; help2man*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a dependency of a manual page. You may need the \`Help2man' package in order for those modifications to take effect. You can get \`Help2man' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo ".ab help2man is required to generate this page" exit $? fi ;; makeinfo*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." # The file to touch is that specified with -o ... file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -z "$file"; then # ... or it is the one specified with @setfilename ... infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n ' /^@setfilename/{ s/.* \([^ ]*\) *$/\1/ p q }' $infile` # ... or it is derived from the source name (dir/f.texi becomes f.info) test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info fi # If the file does not exist, the user really needs makeinfo; # let's fail without touching anything. test -f $file || exit 1 touch $file ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and is $msg. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequisites for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: profisis-1.0.11/examples/0000755015075101507510000000000012012425016012254 500000000000000profisis-1.0.11/examples/3A1P_A.fasta0000644015075101507510000000030211777007367014141 00000000000000>3A1P:A|PDBID|CHAIN|SEQUENCE MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGWRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVAD LPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDVLIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGL FD profisis-1.0.11/examples/3A1P_A.hssp0000644015075101507510000027250012012424753014014 00000000000000HSSP HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 1.0 1991 PDBID query DATE file generated on 14-Aug-12 SEQBASE /tmp/vTLvpw7EVw/COPF-tmp14677.msf_tmp PARAMETER CONVERTSEQ of query THRESHOLD according to: ALL REFERENCE Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991). HEADER COMPND SOURCE AUTHOR SEQLENGTH 162 NCHAIN 1 chain(s) in query data set NALIGN 190 NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry NOTATION : %IDE: percentage of residue identity of the alignment NOTATION : %SIM (%WSIM): (weighted) similarity of the alignment NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein NOTATION : LALI: length of the alignment excluding insertions and deletions NOTATION : NGAP: number of insertions and deletions in the alignment NOTATION : LGAP: total length of all insertions and deletions NOTATION : LSEQ2: length of the entire sequence of the aligned protein NOTATION : ACCESSION: SwissProt accession number NOTATION : PROTEIN: one-line description of aligned protein NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983) NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of INSERTION IN THIS sequence NOTATION : dots (....) in the alignend SEQUENCE INDICATE POINTS of deletion in this sequence NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their NOTATION : acid/amide form in proportion to their database frequencies NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence) NOTATION : NDEL: number of sequences with a deletion in the test protein at this position NOTATION : NINS: number of sequences with an insertion in the test protein at this position NOTATION : ENTROPY: entropy measure of sequence variability at this position NOTATION : RELENT: relative entropy, i.e. entropy normalized to the range 0-100 NOTATION : WEIGHT: conservation weight ## PROTEINS : EMBL/SWISSPROT identifier and alignment statistics NR. ID STRID %IDE %SIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCESSION PROTEIN 1 : C6CBA6|C6CBA 0.26 0.00 1 160 1 160 160 0 0 160 2 : C5BGG1|C5BGG 0.27 0.00 4 160 1 157 157 0 0 157 3 : C1MA90|C1MA9 0.30 0.00 1 160 1 160 160 0 0 160 4 : C4LD26|RIMM_ 0.31 0.00 4 160 1 157 157 0 0 157 5 : Q5QUU9|RIMM_ 0.26 0.00 4 157 1 154 154 0 0 154 6 : Q7N799|RIMM_ 0.25 0.00 1 160 1 160 160 0 0 160 7 : F4HBT4|F4HBT 0.28 0.00 5 160 1 156 156 0 0 156 8 : pdb|pdb|3h9n 0.28 0.00 5 162 1 158 158 0 0 158 9 : Q3IEC8|RIMM_ 0.30 0.00 4 160 1 157 157 0 0 157 10 : A5F9A8|RIMM_ 0.27 0.00 2 158 1 157 157 0 0 157 11 : Q6LMV8|RIMM_ 0.30 0.00 2 160 1 159 159 0 0 159 12 : E0M4J0|E0M4J 0.29 0.00 1 160 1 160 160 0 0 160 13 : A1S3Z1|RIMM_ 0.27 0.00 4 158 1 155 155 0 0 155 14 : B1YIM5|RIMM_ 0.28 0.00 1 162 1 157 162 1 5 157 15 : H2G0C4|H2G0C 0.28 0.00 2 158 1 157 157 0 0 157 16 : A3WN85|A3WN8 0.29 0.00 4 157 1 154 154 0 0 154 17 : E1SRY2|E1SRY 0.29 0.00 2 158 1 157 157 0 0 157 18 : I1DWU4|I1DWU 0.31 0.00 2 158 1 157 157 0 0 157 19 : B1KI69|RIMM_ 0.25 0.00 2 158 1 157 157 0 0 157 20 : Q9KA14|RIMM_ 0.24 0.00 2 162 1 157 161 1 4 157 21 : Q2NVK3|RIMM_ 0.28 0.00 1 160 1 160 160 0 0 160 22 : C0AXQ7|C0AXQ 0.30 0.00 1 160 1 159 160 1 1 159 23 : Q47WU9|RIMM_ 0.33 0.00 2 160 1 159 159 0 0 159 24 : D0I4G3|D0I4G 0.28 0.00 2 160 1 159 159 0 0 159 25 : G4QKE4|G4QKE 0.30 0.00 2 160 1 158 159 1 1 158 26 : A0KG24|RIMM_ 0.27 0.00 4 160 1 157 157 0 0 157 27 : F5ZDK6|F5ZDK 0.27 0.00 2 160 1 159 159 0 0 159 28 : F7S0S9|F7S0S 0.31 0.00 4 157 1 154 154 0 0 154 29 : D3FT61|D3FT6 0.24 0.00 2 162 1 157 161 1 4 157 30 : A1HN73|A1HN7 0.28 0.00 2 158 1 151 157 1 6 151 31 : A4XXT6|RIMM_ 0.28 0.00 2 157 1 155 156 1 1 155 32 : Q15VI8|RIMM_ 0.28 0.00 2 158 1 157 157 0 0 157 33 : E1VLY2|E1VLY 0.33 0.00 2 158 1 156 157 1 1 156 34 : Q5L0P5|RIMM_ 0.26 0.00 2 162 1 154 161 2 7 154 35 : G4EJJ1|G4EJJ 0.21 0.00 2 161 1 153 160 2 7 153 36 : C0ZFN2|C0ZFN 0.24 0.00 6 161 1 150 156 1 6 150 37 : A9FF85|A9FF8 0.27 0.00 1 161 1 157 161 1 4 157 38 : Q8DK05|RIMM_ 0.32 0.00 2 161 1 157 160 2 3 157 39 : A0NX77|A0NX7 0.26 0.00 2 158 1 152 157 1 5 152 40 : A1U2Y8|RIMM_ 0.31 0.00 5 158 1 153 154 1 1 153 41 : H3ZBU1|H3ZBU 0.27 0.00 2 158 1 157 157 0 0 157 42 : D5X8L6|D5X8L 0.27 0.00 2 162 1 157 161 1 4 157 43 : H6NQ83|H6NQ8 0.23 0.00 2 162 1 156 161 1 5 156 44 : Q0FR75|Q0FR7 0.27 0.00 4 162 1 155 159 1 4 155 45 : F9U154|F9U15 0.32 0.00 1 158 1 151 158 1 7 151 46 : A1SZY7|RIMM_ 0.30 0.00 2 156 1 154 155 1 1 154 47 : F3KHL1|F3KHL 0.29 0.00 2 158 1 156 157 1 1 156 48 : A6FH90|A6FH9 0.32 0.00 5 158 1 153 154 1 1 153 49 : D1AB16|D1AB1 0.37 0.00 2 162 1 155 161 2 6 155 50 : F9DPD6|F9DPD 0.21 0.00 1 161 1 156 161 1 5 156 51 : C4L602|RIMM_ 0.26 0.00 1 162 1 157 162 1 5 157 52 : B2J3X9|RIMM_ 0.35 0.00 2 162 1 158 161 2 3 158 53 : G2RJF3|G2RJF 0.24 0.00 1 162 1 156 162 1 6 156 54 : G2SXN1|G2SXN 0.24 0.00 2 162 1 156 161 1 5 156 55 : H5TBI9|H5TBI 0.28 0.00 2 158 1 156 157 1 1 156 56 : F5L7S1|F5L7S 0.24 0.00 1 162 1 156 162 2 6 156 57 : A5KJ02|A5KJ0 0.24 0.00 2 161 1 155 160 1 5 155 58 : C6LCN4|C6LCN 0.23 0.00 2 161 1 155 160 1 5 155 59 : C9L8M8|C9L8M 0.26 0.00 2 160 1 154 159 1 5 154 60 : G9QMP1|G9QMP 0.24 0.00 2 161 1 155 160 1 5 155 61 : B6EGC0|RIMM_ 0.28 0.00 4 160 1 156 157 1 1 156 62 : Q48LV9|RIMM_ 0.26 0.00 2 157 1 155 156 1 1 155 63 : H0S9H9|H0S9H 0.26 0.00 2 158 1 152 157 1 5 152 64 : D2U029|D2U02 0.25 0.00 1 160 1 160 160 0 0 160 65 : A3TY66|A3TY6 0.27 0.00 1 161 1 157 161 1 4 157 66 : A1B8V4|RIMM_ 0.32 0.00 1 158 1 154 158 1 4 154 67 : C0D9Z2|C0D9Z 0.24 0.00 2 162 1 156 161 1 5 156 68 : A3J9U4|A3J9U 0.32 0.00 5 158 1 153 154 1 1 153 69 : H1M4J9|H1M4J 0.24 0.00 1 162 1 154 162 2 8 154 70 : C3B6S5|C3B6S 0.22 0.00 1 161 1 156 161 1 5 156 71 : F2IZA9|F2IZA 0.26 0.00 2 158 1 152 157 1 5 152 72 : C6WZ27|C6WZ2 0.31 0.00 2 158 1 157 157 0 0 157 73 : F3KZH2|F3KZH 0.31 0.00 2 158 1 156 157 1 1 156 74 : B3E5S5|RIMM_ 0.29 0.00 2 162 1 157 161 1 4 157 75 : G2TJN3|G2TJN 0.23 0.00 1 161 1 156 161 1 5 156 76 : Q3SGC3|RIMM_ 0.35 0.00 3 156 1 147 154 1 7 147 77 : I1K454|I1K45 0.28 0.00 3 162 1 159 160 1 1 159 78 : A8LMB6|RIMM_ 0.30 0.00 2 161 1 156 160 1 4 156 79 : G9A2H2|G9A2H 0.29 0.00 2 162 1 156 161 1 5 156 80 : C6XA89|C6XA8 0.35 0.00 3 158 1 151 156 1 5 151 81 : E8SG49|E8SG4 0.26 0.00 4 161 1 151 158 1 7 151 82 : B9QVP2|B9QVP 0.26 0.00 1 158 1 153 158 1 5 153 83 : D5BYB7|D5BYB 0.37 0.00 2 158 1 150 157 1 7 150 84 : A6W1U1|RIMM_ 0.32 0.00 4 158 1 154 155 1 1 154 85 : H3NF15|H3NF1 0.28 0.00 3 162 1 155 160 1 5 155 86 : E6M831|E6M83 0.22 0.00 4 162 1 152 159 1 7 152 87 : Q31KY0|RIMM_ 0.34 0.00 3 162 1 152 160 3 8 152 88 : E6TSY9|E6TSY 0.21 0.00 1 162 1 159 162 1 3 159 89 : A3W771|A3W77 0.31 0.00 2 161 1 156 160 1 4 156 90 : F0ENW5|F0ENW 0.23 0.00 1 162 1 157 162 1 5 157 91 : C7RAD0|C7RAD 0.30 0.00 4 156 1 148 153 1 5 148 92 : C3X506|C3X50 0.33 0.00 2 156 1 154 155 1 1 154 93 : H0DIW3|H0DIW 0.28 0.00 4 162 1 152 159 1 7 152 94 : F6DTK3|F6DTK 0.27 0.00 2 161 1 153 160 2 7 153 95 : A7B0P1|A7B0P 0.21 0.00 2 162 1 156 161 1 5 156 96 : F5SCP8|F5SCP 0.23 0.00 2 160 1 154 159 1 5 154 97 : F0YYS7|F0YYS 0.25 0.00 2 161 1 155 160 1 5 155 98 : H5YDY6|H5YDY 0.30 0.00 2 157 1 151 156 1 5 151 99 : B6BEB1|B6BEB 0.29 0.00 2 161 1 156 160 1 4 156 100 : C8WWB1|C8WWB 0.26 0.00 3 162 1 155 160 1 5 155 101 : F7SQS5|F7SQS 0.32 0.00 4 158 1 154 155 1 1 154 102 : B7GGE0|B7GGE 0.24 0.00 1 162 1 157 162 1 5 157 103 : E5YZY7|E5YZY 0.19 0.00 2 161 1 155 160 1 5 155 104 : C4Z0D8|C4Z0D 0.21 0.00 2 162 1 156 161 1 5 156 105 : A5VKN5|RIMM_ 0.24 0.00 1 160 1 155 160 1 5 155 106 : C9A126|C9A12 0.23 0.00 1 162 1 155 162 2 7 155 107 : G6FWR1|G6FWR 0.37 0.00 2 162 1 154 161 3 7 154 108 : F7NTV2|F7NTV 0.34 0.00 2 158 1 157 157 0 0 157 109 : E0WU65|E0WU6 0.25 0.00 2 156 1 155 155 0 0 155 110 : Q833P4|RIMM_ 0.23 0.00 1 162 1 157 162 1 5 157 111 : Q8YTB1|RIMM_ 0.32 0.00 2 162 1 158 161 2 3 158 112 : Q65JP7|RIMM_ 0.24 0.00 2 162 1 156 161 1 5 156 113 : D6V148|D6V14 0.27 0.00 2 157 1 151 156 1 5 151 114 : C1DDY6|RIMM_ 0.34 0.00 3 157 1 154 155 1 1 154 115 : H0JE16|H0JE1 0.29 0.00 2 157 1 155 156 1 1 155 116 : C8P925|C8P92 0.26 0.00 1 160 1 155 160 1 5 155 117 : A3YI43|A3YI4 0.35 0.00 4 158 1 154 155 1 1 154 118 : E1V974|E1V97 0.34 0.00 4 158 1 155 155 0 0 155 119 : D7GW96|D7GW9 0.22 0.00 2 162 1 156 161 1 5 156 120 : E4MGI2|E4MGI 0.28 0.00 2 162 1 156 161 1 5 156 121 : Q1GYT7|RIMM_ 0.33 0.00 2 158 1 150 157 1 7 150 122 : E2CFW4|E2CFW 0.27 0.00 3 158 1 151 156 1 5 151 123 : A9KLM3|RIMM_ 0.25 0.00 2 162 1 156 161 1 5 156 124 : A4VIT6|RIMM_ 0.30 0.00 2 157 1 155 156 1 1 155 125 : Q1I5Y9|RIMM_ 0.27 0.00 2 157 1 155 156 1 1 155 126 : F3AJD1|F3AJD 0.23 0.00 4 160 1 152 157 1 5 152 127 : Q044E4|RIMM_ 0.23 0.00 1 162 1 157 162 1 5 157 128 : F3LHE9|F3LHE 0.28 0.00 2 158 1 156 157 1 1 156 129 : Q2SL57|RIMM_ 0.35 0.00 2 158 1 156 157 1 1 156 130 : B5CR92|B5CR9 0.23 0.00 2 161 1 155 160 1 5 155 131 : Q07UU6|RIMM_ 0.28 0.00 1 157 1 152 157 1 5 152 132 : Q1QT49|RIMM_ 0.33 0.00 4 158 1 154 155 1 1 154 133 : H1FZT4|H1FZT 0.32 0.00 2 158 1 150 157 1 7 150 134 : C1DBF9|C1DBF 0.25 0.00 2 160 1 153 159 1 6 153 135 : B9KNX9|B9KNX 0.29 0.00 1 160 1 156 160 1 4 156 136 : A5ZPU7|A5ZPU 0.22 0.00 2 161 1 155 160 1 5 155 137 : A8RTK3|A8RTK 0.22 0.00 2 162 1 156 161 1 5 156 138 : Q5WFN5|RIMM_ 0.26 0.00 1 162 1 155 162 2 7 155 139 : C9LQK3|C9LQK 0.34 0.00 2 158 1 151 157 2 6 151 140 : Q8EQZ8|RIMM_ 0.25 0.00 4 162 1 154 159 1 5 154 141 : E1T5S4|E1T5S 0.31 0.00 4 156 1 153 153 0 0 153 142 : F3YAG7|F3YAG 0.23 0.00 1 162 1 155 162 2 7 155 143 : A4BQ86|A4BQ8 0.35 0.00 2 158 1 150 157 1 7 150 144 : E7RHR7|E7RHR 0.20 0.00 1 161 1 156 161 1 5 156 145 : D7AUB8|D7AUB 0.34 0.00 3 162 1 154 160 2 6 154 146 : C6D2Z7|C6D2Z 0.24 0.00 2 161 1 153 160 2 7 153 147 : B0NCZ6|B0NCZ 0.22 0.00 2 160 1 154 159 1 5 154 148 : Q7NRV6|RIMM_ 0.35 0.00 2 160 1 151 159 3 8 151 149 : Q0KD80|RIMM_ 0.35 0.00 2 160 1 156 159 2 3 156 150 : C0BCP7|C0BCP 0.23 0.00 2 161 1 155 160 1 5 155 151 : B8I7T4|RIMM_ 0.28 0.00 2 162 1 156 161 1 5 156 152 : D4RWL1|D4RWL 0.23 0.00 2 162 1 156 161 1 5 156 153 : C8N6Y0|C8N6Y 0.26 0.00 4 156 1 149 153 1 4 149 154 : D3LSM1|D3LSM 0.32 0.00 2 158 1 151 157 2 6 151 155 : A3KA82|A3KA8 0.28 0.00 4 162 1 155 159 1 4 155 156 : Q8EH71|RIMM_ 0.26 0.00 4 158 1 155 155 0 0 155 157 : D7UVK2|D7UVK 0.25 0.00 2 161 1 155 160 1 5 155 158 : F7PY15|F7PY1 0.26 0.00 2 162 1 155 161 2 6 155 159 : B6R649|B6R64 0.27 0.00 2 162 1 156 161 1 5 156 160 : A6BID2|A6BID 0.21 0.00 2 161 1 155 160 1 5 155 161 : B7K5W1|RIMM_ 0.32 0.00 3 162 1 157 160 2 3 157 162 : Q2BR82|Q2BR8 0.30 0.00 4 158 1 154 155 1 1 154 163 : C5NX51|C5NX5 0.25 0.00 3 162 1 155 160 1 5 155 164 : Q2JUD0|RIMM_ 0.39 0.00 3 162 1 152 160 3 8 152 165 : A5WBW9|RIMM_ 0.26 0.00 3 156 1 153 154 1 1 153 166 : E6LCF5|E6LCF 0.23 0.00 1 162 1 157 162 1 5 157 167 : Q5HPV2|RIMM_ 0.26 0.00 4 162 1 152 159 1 7 152 168 : A5Z6E4|A5Z6E 0.21 0.00 2 162 1 156 161 1 5 156 169 : G0AJ66|G0AJ6 0.30 0.00 2 160 1 157 159 1 2 157 170 : D3ATW8|D3ATW 0.22 0.00 2 162 1 156 161 1 5 156 171 : B9Z1Z3|B9Z1Z 0.27 0.00 2 156 1 149 155 1 6 149 172 : Q3DV49|Q3DV4 0.24 0.00 1 162 1 156 162 2 6 156 173 : E8JTI5|E8JTI 0.26 0.00 1 162 1 155 162 2 7 155 174 : F4Y0S4|F4Y0S 0.39 0.00 2 162 1 158 161 2 3 158 175 : A6FTD5|A6FTD 0.34 0.00 3 161 1 155 159 1 4 155 176 : Q5YS37|RIMM_ 0.34 0.00 1 162 1 157 162 2 5 157 177 : F0DLN7|F0DLN 0.23 0.00 2 161 1 155 160 1 5 155 178 : C8NFU4|C8NFU 0.24 0.00 3 162 1 155 160 1 5 155 179 : D7WTH5|D7WTH 0.26 0.00 1 161 1 154 161 2 7 154 180 : D5WPA7|D5WPA 0.28 0.00 3 162 1 155 160 1 5 155 181 : Q2CDP1|Q2CDP 0.29 0.00 3 161 1 155 159 1 4 155 182 : H7F484|H7F48 0.22 0.00 2 162 1 156 161 1 5 156 183 : Q5LNF0|RIMM_ 0.31 0.00 2 161 1 156 160 1 4 156 184 : C5T285|C5T28 0.30 0.00 4 158 1 153 155 1 2 153 185 : E3E0I9|E3E0I 0.23 0.00 2 162 1 156 161 1 5 156 186 : Q2J398|RIMM_ 0.31 0.00 4 157 1 149 154 1 5 149 187 : H0K5A9|H0K5A 0.30 0.00 1 162 1 159 162 2 3 159 188 : G4T226|G4T22 0.30 0.00 2 158 1 150 157 1 7 150 189 : C0BWQ4|C0BWQ 0.22 0.00 2 161 1 155 160 1 5 155 190 : C2EWA6|C2EWA 0.25 0.00 1 160 1 155 160 1 5 155 ## ALIGNMENTS 1 - 70 SeqNo PDBNo AA STRUCTURE BP1 BP2 ACC NOCC VAR ....:....1....:....2....:....3....:....4....:....5....:....6....:....7 1 1 M 0 0 0 41 32 V V V V M VV T T MM M T VTT MT 2 2 R 0 0 0 139 27 N E N EDN EE EDEKEEKED D DDDDNRK EEQ DKK RED DEDNKDDKQQDK DKNEED EK 3 3 L 0 0 0 155 39 P P P KLP WP LLPWPPKKT I LLLTWWW QWK FLL RPL QWWWWLIYFYLW LLPTRM .W 4 4 V 0 0 0 185 22 IVIIII ILVIVLVLIVVLVIIVIVVVLVILVFL ILV VIYIIIV VFLLFLLYLLLFIIIIVVL VF 5 5 E 0 0 0 188 49 VVVVVVVVVVVVVEIVVVVNVVIVIVVVKAVVVNK CCLVVATCVVVVVNYEKQITQQQNVVCVCCRVEN 6 6 I 0 0 0 191 12 LLLVVLVVVVVLVVVVVLLVVMLVVLVVVILMVVVVVIMILIVVLILVVVVIVVIVVVVIVIVLVVVIVV 7 7 G 0 0 0 191 4 GGGGGGGGGGGGGAGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGG 8 8 R 0 0 0 191 37 KKKRRKKKKKKKKKRHRKKKKKKKKTKTKKKKRKRKAQKRKKKTRKQRRKKKKVSKAVVKKKKKAAVRQK 9 9 F 0 0 0 191 11 ILMLILLLLLLMIILILFIIMLVLILIIIIIIFILLIIIIFIIIIFILIIIIIIIIIVIIFIILIIIIII 10 10 G 0 0 0 191 37 GGGGGGGGGGGGGAGGGGGVGGGGGGGGVVVGAVVVSVGTGIVAAGGGGVAVVTGVTSTVGYGGAATTVV 11 11 A 0 0 0 191 34 SSSAASSSASAASNAASASNSSAAATAANASASNNNGGASANNGGAAARNNSNTANSSTNASASGGSANN 12 12 P 0 0 0 191 34 TASVVTTTPSTATTVVAVSTAPVSPVPVTPVPPTTTSAAVVTTAVVAVPTTPTTPTTTTTSVAASAPVTT 13 13 Y 0 0 0 191 29 YYYYYYYYYYYYYHYYYYHHYYYYYYYYHHHYYHHHYHHFYHHFYHYYHHHQHHYHHHHHYHHHYFHFHH 14 14 A 0 0 0 191 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 15 15 L 0 0 0 191 13 IIIIVIIIIIIIVLIVIIIVIIIIVIVIVVVVVIILVLIVIHIVVIIIVILLVVVIIIIIIVVIVVVIIV 16 16 K 0 0 0 191 20 RRRKKRRRKRKRKKKKRNKRRRKRKKKKRRRKKRRRRRRKNKRNRKKKRKKSKRKRRRRKRRRRRRRKKR 17 17 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 18 18 G 0 0 0 191 50 WWWWWWWWWWWWWEWWWWWEWWWWWWWWEDEWWEEEEEEWWEEEWWWWEEEEEEWEEEEEWEEWEEEWEE 19 19 L 0 0 0 191 14 LLLLLLLLLLLLMLLLLLLVLLLLVLVVIVVVLVVVVVVLLVLVVLVMVVVLVVVVVVVVLVVLVVVLVI 20 20 R 0 0 0 191 15 KRRKKRRRKKKKKKKKKKKRRRKKKKKRRRKKKRKRRKRKKKKRRKKKTRKKRKKRKKKRKKRRRRKKKR 21 21 F 0 0 0 191 10 VVVVVVVIVVVVILVIVVIVVVIVIVIIVIVILVVVLVVVIVILVVIIVVIVIVVVVVVVVVLVLLVVVV 22 22 R 0 0 0 190 47 FFFNQFYYHFFFTLNQNNTLFFHFNNNNIIYTYILTKKKFNFVKFHNNTMTYVFNIFYFLVFWFKKFYKI 23 23 G 0 0 0 185 25 SSSSSSSSSSSSAASSAATSSSSSSSSASPSSSSPPSPDSSPPSSSSSDSD.SPS.PPPSSSTSSSPSSS 24 24 E 0 0 0 186 51 SSSFFSSSFYYSYSFFFYYTSSFYFFYYSLFYHRSTFFDYYLEFEYHFDTF.TTF.TTTRFFFSFFTFFR 25 25 P 0 0 0 191 16 TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTESPTTTTTTTTTPTPPTTTTTTTTTTTTETTTTT 26 26 V 0 0 0 191 18 EEEDDDEEDDEEDDEDDDEDEEDEDDQEDDDDEDDDDDLDDDDADDEDDDEVDDQVDDDDDDEDADDDDD 27 27 V 0 0 0 190 32 IIIFIIIIFIIIIFFIIFIFIIIIIIIIFFVIIFFFIFSIFDFAIIIIAFFSFFISFFFFILDIIIFVTF 28 28 L 0 0 0 180 53 FFFDFFFFDFFFFPDFFFFEFFLFFFFFPPLFG..LE.FLDEPELFFFRPKDAKFDKKDPFLPFAAKLRP 29 29 H 0 0 0 181 44 DDDYEADDFDANDEYDEDDDDEDSGDEDDEDSE..YD.ANYEEYHEDNFDKFDKDFKKYEDDYEEGTHFE 30 30 L 0 0 0 189 51 YYYAYYYYSYYYYGQYYYYDYYYYYYYYCLYYYPPLYPDYTLSAYYYYAEGPGLYKLLLEYYGYYYLYQL 31 31 E 0 0 0 190 44 QQQPSQQQPSQQSNPTSTSRQQFSSNLSEKRTPEGFSEYRPEKPSKDSPRNENKADKKKRKKPQGSKRPY 32 32 R 0 0 0 191 50 PPPWPPPPWPPPPEWPPPPYPPPPPPPPLTHPEEEHPRGDWKLLQPGPGYTRKNPKKESYPTLPPPQNGI 33 33 V 0 0 0 191 44 WWWFWWWWLWWWWVLWWWWVWWWWWWWWWAWWLRRPLFIWQVLTWLWWAILFLVWRVVVLLWTWLLVWEW 34 34 Y 0 0 0 191 40 FFFILFFFIYLFFFITLFLMFFSFRLFLIYTLWYFTTTLTVYFTLLFLVFFEYIHYIFLFLTTFTYVTVH 35 35 V 0 0 0 191 36 IIIMLILLGIIILLKLVQIRIILILILIVFLVVKALEVTLKFVELMIILMLVILIQLALLILKIGTLLLD 36 36 E 0 0 0 190 40 QQQDKQNKQDKQKEDQLGKPKQKKNNGGDDRGSKPSDPDLFEDDPKKEDPDPFDSPDEDPKRDQDDDVQK 37 37 G 0 0 0 191 41 NQKKTRIIQQVRESGGHNENRRGVGQEHADRQGGGEGGGLQSPGESSQTKVGKTGGTGTGVRGRNGTQIG 38 38 H 0 0 0 191 41 KAAGEGKKGKKAHNKNQWQQAHNRNNENNGDESNSPSCKDGTESAKGKDSDKEGNNGNGQKESSGNGDET 39 39 G 0 0 0 191 42 GGGMRRKGKGGGGGGAGQGNRGNGGGNGTTGGKKRLQRRGNRKRRGRGGKGRKKQKKVKTDGRGARKGKE 40 40 W 0 0 0 190 47 QKWWEWPEWEEWEIWAEPEEWTTEEEEEKREEPEEKTWSKWEPSPQPEPYEWEEVPRPEEEESQSSEKAP 41 41 R 0 0 0 191 38 VIQRMQVIQYIQVYRRMVVRQIQFIIYIKLVILVVLYLFRQLQFRFVVLVMLVLLLQLLLFKLLYFLRLL 42 42 A 0 0 0 191 41 EEQEKHEETKQQKTEQKQKTPETSQQQEVSKVVTEKTRERTTIEKQKATTTQTEKTEADVSQEESTEKTS 43 43 I 0 0 0 191 13 ILVIVIILLVIVVIVVVVVVIIVLIVIVVVLVLVVIIVVLVIVVLIVLVVILVIVVIIIVVVVLVIILVV 44 44 E 0 0 0 191 40 EEETVEEEEEEESSTVASTAEEEEDSDSAEADEKAATTEETKEQCAAEEATLAADAQEENEEAETREETK 45 45 D 0 0 0 191 43 SSSGEAGNDGSGQSGQDSQSSSDDESQQNSSQKSSSLLRESQSIEDADRSTTSGQSSQRSSSKGLLHESS 46 46 L 0 0 0 191 54 WWWWWWWWWWWWWYWWWWWHWWWWWWWWHAGWVHARVLAGWVATGWSFAHYGHVWHVVVHWGAWTTVGYH 47 47 Y 0 0 0 191 18 RRKKRKRRRKKKRRKRRKRRKKRKRKRRRRRRQRRRRRRRKRRRKKRKRRRRRKRRRKKRKRRKRRKRRR 48 48 R 0 0 0 191 52 YSHRRHHYRRKHFKRRRRFKRHKRARTWVQLTFVEPAPVRRYDSRRQRWKPYKFYTFFYTRLEHPPFRTQ 49 49 V 0 0 0 191 34 HHHHHHHHHHHHHHHHHHQHHHHHQHHHHHQHHHHHIRQQHHHVHHHHHHHNHFHHFFFHHQAHIVFQHH 50 50 G 0 0 0 191 33 NNNNNNSNNNGNGKNNNSGKNNNNGNGNKKGNGKKKKAKGSKKKGSGGVKKKKKAKKKKKKSKNKTKGKK 51 51 E 0 0 0 191 36 QQQNNQQHKKQQKQKNNNKNQQKQKKKKNQKKKSGNNETQNNTGKNKKGNQNNNKQQNQSGKDQNGNQGT 52 52 E 0 0 0 190 50 SDDGGDDEGGGDAFSGGGAFDDVGGGGDFFVGGFLFGQVGGFMGGGGGRFFLFMSFFMYF.FHDGGMGFF 53 53 L 0 0 0 191 39 LWLLLMLIFWMLVILLILVDLILYLLLLDILLLDYEFFVILVYFLFLLLNHYDVLDVVVDLLLIFLVIHD 54 54 V 0 0 0 191 21 IVIIIIIIIVVIVMIIIIVLIIIVVIVVLLVVVLIITVIVIIIAVVIILLLVLIVLIIILVVVIAGIVML 55 55 V 0 0 0 191 35 IVICAIVVAVAIAVCACAALIVVGACAALLAAALVVAVTVALVAAAAALLVILLALVLLLCAAIAALILL 56 56 H 0 0 0 191 33 KKKKRKKKKKKKETKQRKSCKKKKKKKRTKKKKSKSRTKRKSRRRKQKRTTKTKKAKKKSKKSKRRKRKT 57 57 L 0 0 0 191 12 IILILIILFLLVLFLLLLLFVLVLLLILFFLLIFFFIFFLLFFLLILLFFFLFFLFFFFFLLFILLFLFF 58 58 A 0 0 0 191 37 KKKDEKKKAQEKEKAEADEERKAKVDVAEKKVKEKHGAKKTEKSEVEATEKAEKEEKKKEEKKKGSKKEE 59 59 G 0 0 0 191 11 HGGGGGGGQGGGGGDGGGGGDGGGGGGDGGGGGGQGGEGGDEGGGGGGGGGGGGGDGGDGGGGHGGGGGG 60 60 V 0 0 0 191 29 VIVVIIVVVLLIVMIIVIVYIIILVIVIYLLVCYYFIIIIIIFVCFCIVYFVYIVHIIVYLLVIVVYVIY 61 61 T 0 0 0 191 32 DDDDSDDDNDDESQDNENEPEDDDDDDQDQDEDDDEESTDNKTRDDDDDPDEQDEHDDDEEDTDAEDDEN 62 62 D 0 0 0 191 32 DDDSDDDDDVIDNHQDDDTSDDDQSVNDSDDTDSNHTDDDVDNSDVDIDTNNNDDSNNDSVDDDTTNDNN 63 63 R 0 0 0 191 38 RRRRRLRRRRRRRIRRRRRIRRRRRRRRIRRRRIIIKRRRRMIKRRRRRIICVIRIIIIIRRRRKRIRIV 64 64 T 0 0 0 191 25 DDDEDDEEDEEDENEENDDNEDDEDEDNNNEDTNNNETNEENNEDENETNNDNNNNNNNNEENSEENDND 65 65 L 0 0 0 191 35 AASDEAQAEDDAQDDLQLQDAAEDDDDTQAIDMDQDQAQVQAEEQEAEADLQDDADDDDDEEAAEQDVDE 66 66 A 0 0 0 191 26 AAAAAAAAAAAAAVAAAAAVAAAAAAAAVVAAAVVIAAAAAAVAAAAAAVIAVVAVVVIVAAAAAAIAIV 67 67 E 0 0 0 191 26 NNNQANQQVHQAQEQAEQQETNQQELEQEEREEELEDEERQEEDAQEQEEEEEEEEEEEEQRENDEEQEE 68 68 A 0 0 0 191 45 LTLARSTIALIQMKATQQMALFAAHARQENTSSRPKAAETALKAAALSKKKAQKLQQKPKALRSAAKRYK 69 69 L 0 0 0 191 24 LMLLLLLLYLFLLYLKYYLFLLLLVLIFFLYIHFYYLLLYYLYLLLLLLLYLYYIYYYYFYLLMLLYYLL 70 70 V 0 0 0 191 39 TVTTTTAATTTTTKTTIVTKTTVTKTKTKRAKVKKKKKNCVKKRVVKTRRKRKRKKKRKKTSNTKKRCKK 71 71 G 0 0 0 191 22 NNNGGNNNHNNNNGGGNNNGNNGNNNNGGGGNGGGGGGGGNNGGGGNGGDGGNKNGGGGGNGGNGGSGGG 72 72 L 0 0 0 191 50 CRCAACIVAFACCLALCACGCFSAAVLLSKFLCAWGIAIAAGWTQLAATGLCCKAGSCKALYLCVVKAAS 73 73 R 0 0 0 191 43 EEEDDEEEEEEEEKDSDEEREEEEEEDETLEDEMTEREDEEELGEEEEWIKKESQWSPSMEEEEQTDDVS 74 74 V 0 0 0 191 15 IIIIIIIIIIVIILIIVIILIIIIIIIILVIILLILLILIIILLILIILVLLVLILLLLLIILILLLILI 75 75 Y 0 0 0 191 51 VVVACIGGSAAQGYACAAAQVVLASGNAYKCSAKKKFLFRACKYALAAVKYMKYSKFLYKACYIFWLHYK 76 76 A 0 0 0 191 17 VVVVIVVVMIVVIVVIIVVVVVTIVVIVVVVIIVVIAVIVVIVAIVIIVVVVIVIIVVVIVVVVAAIVQV 77 77 E 0 0 0 191 40 DDDLTDDDDDHDLHSNLASPDNNNPASPSPPKPPPPPPDPATEPTDKNDSHPPTEPSTTPKPPDPDRPEP 78 78 V 0 0 0 191 40 SESSASLLSPASAPAAPSAIAAEATAAVKRRAREAARARTAKERRSSATEAAERAERRREARRSRRRTRE 79 79 A 0 0 0 191 31 TSSDDENSAADTEEEEADEESSAESDSADKSQGSSEDSDENDQDDDDDGKESEESDEEESDNDADDEEDE 80 80 D 0 0 0 191 35 QQQQEQQVQSQQQAAKQAQDQQAVVLQKQDEQQQQARDQQAEYRQKQQDEHDQNQENNFQALRQRKQQEQ 81 81 L 0 0 0 191 30 LLLLLLLFLLLLMLLLLLMRLLLLLLLLLLLLLLRLLRLLLLLLLLLLLLVRLALRAAAQLFLLLLALDL 82 82 P 0 0 0 191 34 PPPPPPPPPPPPPQPPEPQPPPPPPPPPSVPPPGVMPPPPPRSPPPPPPTHPTVPEVVVHPPPPPPVAIG 83 83 P 0 0 0 191 35 ESAAAEEEEEASEESEASEEDEEEEADEDPDQAEPESPEEASETPNEAPEDQDKEPSKPEEDEVAAEEEE 84 84 L 0 0 0 191 17 LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLPLLLLLPLLLLLLLLLLLLLLLLLTLTLLLLL 85 85 E 0 0 0 189 33 DDEPADDEPSSEPGPAPEPGD.SSEPGADPEDPAAEPAEPDPPPRED.EEDAEKDPEAKESDDEEPEPEA 86 86 E 0 0 0 191 19 DDDKDTEEQEGEEEADEEEESEEDEEDEEEEGEEEEDAEEDEEDAESEDEEEDKNEEPEEEDDGEDEKEE 87 87 G 0 0 0 191 22 GGGGDGGGGDEGDHDDDGDGGGDEDGDDGGGDGGGDDNDGGGDDDDGDDNHDGDDGNGNGDGNNDDDGNG 88 88 R 0 0 0 188 13 EDSDEDEDEEEDEEEEEEEEEEDE.EGEEHEEDEEEEEEEESEEE.EEEEEEEE.EEEEEEEEEEEEDEE 89 89 Y 0 0 0 191 3 FYYYFYFYFFFYFFFFFYFFYYFFFFIFFYFFYYYFYYFFYYFFFFFFFFFYFYFYYYYYFYYYFFYYFY 90 90 Y 0 0 0 191 6 YYYYYYYYYYYYYYYYYYYFYYYYYYYYYYYYYYYYYHYYYYYYYYYYHYYHYFYYYFYYYYYYYYFYYY 91 91 Y 0 0 0 191 37 WWWWWWWWWWWWWYWWWWWYWWWWWWWWYIWWWFFIHLYWWIHHWWWWDYYVFIWFILIFWWHWHHIWYY 92 92 F 0 0 0 191 48 KKKRRKHHRRRKRHRRRKRHKKRRKRRRHFYRSHHHTMSHKFHTCRSRHHHLHAKDACAHRYAKAAAYSH 93 93 A 0 0 0 191 13 DDDDDDDDDEEDDEDDDDDEDDDEDDEDEEQEQEDQDDDQDDEDDDQDEEEDEDDQDDDQEQDDDDDQDE 94 94 L 0 0 0 191 11 LLLLLLLLLLLLLILLLLLILLLLLLLLIILLLIILLLLLLIILLLLLLIILILLILLLILLLLLLLLII 95 95 I 0 0 0 191 22 IMMIIIIIIFYMIIVIVMIILMIYIITVIIQVEIIVMITEMILIEIEIIIIIIIVIIIIIFEIIIIIEII 96 96 G 0 0 0 191 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGEGGGQGGGGGGGGGGGGGGGGGGGGGGGGG 97 97 L 0 0 0 191 39 CCCCMCCCMMMCCCCLCMCCCCMMMCMLCLLMLCCCLLLLLLCLLCLCLCCLCMMCMLMCMLLCLLLLCC 98 98 P 0 0 0 191 42 DQQARQRTSQSQETRRTAESQHSEQSKREKKQSTTVEADDKNTAEQSSTREETKQEESEQEKAQRSAETK 99 99 V 0 0 0 191 6 VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVAVVVVVVVVVVVAVVVVVVV 100 100 Y 0 0 0 191 38 VVVVVIIVVVVVLFNVVITVVEVTVVVVYYIVYVVVYYLFVFVFTTVETIVFKTIVFTYKVITIVYVFFV 101 101 V 0 0 0 190 32 TTTTTTNNTTTNTDTNTNTTTTTTTTTTTDDTNTTDDHDTNTDDTDTTTTVMTDTTTDLTTDTTDDTTDT 102 102 E 0 0 0 191 29 SSEKNAQEDNEEKGQQQEKAGDNKDKQENDQEEEEEGQQEEEEGENNDDEDQEEDDETEEQQAKGTDEDE 103 103 G 0 0 0 191 11 GGGGGGGGGGGGGEGGGGGGGGGGGGGNNGGGGGGGGGGGGGGGGGEGGGGGGGGGEGGGGGGGGGGDQG 104 104 R 0 0 0 191 49 YYYYYYYYYYYYYDYYYYYEYYYYYYYYEAQYCEEETEEEYREAQYVYTEEEVEYQGEKDYQAYTGEEQE 105 105 Q 0 0 0 191 48 EADQDNDTDDDENEDDDHNEQDDNDDDDHYLNFTEELRTCDYEESDLTPDVLEEEMHEHSGLPSEAACPD 106 106 V 0 0 0 190 12 LLLLMLMXLLLMLILMMLMLLLLLLLLMLLLLLILLLVLLLLLLLLLLVIIVVLMLFLFVLLLLILLLIL 107 107 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 108 E 0 0 0 191 43 KKKTVTVTIVKKKVVVKEKKEVVKVKVTQKVVKARKTEKKVETRRVKKTTVTTTVTITTIIKRFTKTTRT 109 109 V 0 0 0 191 11 VVVVVVVVVVVVVVVVVVVVVVVVIVVVIVVVVVIIVVIVVIIVIVVVVVVVVLVVVLLVVIVVIVVMII 110 110 V 0 0 0 191 43 ITVSENSTDTTIDSSETTQKITTTKTKSKTDKDKSVKVIHTTSKSTNTRTDVKSKEKTMTDDLQRRKHTK 111 111 D 0 0 0 191 30 DADEQDEEDDDDQEQQGDEEDDDDDEEHEDHEHEEDSGAHDDEAHEHDDEDDEDDTDEDEDHADAADHSE 112 112 I 0 0 0 190 17 MMMLIMLXLMIMIILILMIILMMIMLVLIVLLLIIVVLVLLVIVLILMIIIIIVMIVVVIILILVIVMII 113 113 L 0 0 0 190 23 MMMMMMMXMMLMLLMMLMVLMMMLFMFLIMFFVLLMQVQLMILLFMLMLIFILMFLMIMLFLHMMYMLFL 114 114 D 0 0 0 191 32 EEEEPEEEEEEEEEEPEEESEEEEEENSEQEEETRQNNDEEQSNAEAEHEEPTQETERETEENEDDEEES 115 115 A 0 0 0 191 34 TTTTTTTTTTTTTTTTTTTPTTTTTTTTTTTTTPPPHAFTTTPHTTTTYTTAPTTPTTTPTTFTHHTTSP 116 116 G 0 0 0 189 2 GGGGAGGGGGGGGGGAGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGG.GGGGGGGGGGGGGGGGGGGGG 117 117 A 0 0 0 183 14 SSSSSSSSSSSSSASASSSASSASASAAASAAAAAAA.ASSAAAASSSAAA.AAAAAAAASSASAAAAAA 118 118 Q 0 0 0 191 15 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNGNNNNTNNNNQNNNNNNNNNNNNNGNGGNNNN 119 119 D 0 0 0 191 5 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDD 120 120 V 0 0 0 191 9 VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVLLLVVVVLVVVVLVVLVVVVVVVVVVIVLIVVVV 121 121 L 0 0 0 191 27 LLILLMLLLLLLLWLLLLLWLMLLMLVLWYMMMWWWLLLLLYWLLLLLLWWLWYMWYYYWLMILLLYLWW 122 122 I 0 0 0 191 29 VVVVVVVVVVVVMTVVEVLVVVVVLVHVVVVLVVVVEEEVVEVEVVVVVTVEVVLVIVVVVVEVEEIVVV 123 123 I 0 0 0 191 7 VVIVVVVVVVVVVIVVVVVVVIVVVVVVIVVIVVVVIVVVVVVLVVVIIVIVVIVVIVVVVVIIIIVVVI 124 124 R 0 0 0 185 34 RKKQKKQKKKKKKKKTEKKQKKKQKEKTREKKKREKTQRHKRKTKKRKRTKKK.KKDKHKKKAKKFEQKK 125 125 G 0 0 0 177 43 AAAAAAAAAAAAARAAAAACAAAAAAAARDAAPRRGILPAA.RAGAGARPRL..ASSTLDAPPAGG.AGR 126 126 V 0 0 0 167 42 NNNNNNNNNNNNNPNNKNN.NNNNKNNNACCNAEP.PL.TN.PPENCNEAPH..KPDKESNCPNPP.SDP 127 127 G 0 0 0 132 43 LLLLSLGTSLLLAGASSRA.LLLPTVVNGDALA...AD.AR..G.SEAT.GP..IG.NANLASLGG.P.. 128 128 E 0 0 0 98 45 KKKNNKKKKKKKK.NNNTK.KKKKNKGN.RGKG....P.GT..Q.NGT..KS..NR.E..KG.KLR.A.. 129 129 R 0 0 0 90 36 DDDDDDDDDDDDD.DDDDD.DDDDDDDD.PSDS....A.SDD.S.DSD..SF.SD.....DS.D.R.S.. 130 130 L 0 0 0 86 42 AAAAGAAAAAAAA.AAAAGRAAGAAAAA..LAV....P.IAS...ALA...T.MA.....AL.A.QMI.. 131 131 R 0 0 0 87 54 YFFFFFFFFFFFF.FFFFFRFFFFFFFF..DFD....KK.FK...F.F...TKTF.....FD.F.VK... 132 132 D 0 0 0 121 31 GGGGGGAGGGGGG.GGGGGGGGSGGGGGG.DGDDKKDARDGSK..GDG.E.DGDG.V...GD.G..DD.K 133 133 R 0 0 0 152 41 VMIMKVKKQQQAKKQKKQKGIIKQQAQKG..Q.GGRSPGQKGG..QKKGG.KGGQKH.GGK.GIK.GQ.G 134 134 A 0 0 0 175 34 KKKKSKQQAKKQTKRSRKAKQGKKKKKRK.RKRSRGKQRRGKKKRKRKGK.KKEKKGKKNKRSKN.RRKQ 135 135 E 0 0 0 184 21 EEEEEEEEEEEEEDEEEEEDEEEEEEEED.EEEEPETSSEEHPTEEEEEPDTEEEEEEEEEETET.EEED 136 136 R 0 0 0 191 45 RRRRRRRRRRRRRVRRRRRLRRRRRRRRILRRRAVIVVFRRYLVRRRRAHAVVVRIVVVYRRLRVLLRYL 137 137 L 0 0 0 191 7 LLLLLLLLLLLLMLLLLLMLLLLLLLLLLLLMWLLLLYYLLLLLLLLLLYLLLLLLLLLYLLMLLLLLLL 138 138 V 0 0 0 191 13 IIVIIIIIIIIIIIIIILIIIVIILIIIIILVLIILLIIIIILLIILVVIIIIILIVIIIILLILLLIII 139 139 P 0 0 0 191 0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 140 140 L 0 0 0 191 25 FFFFFFYFFFFFYYFFFFFYFFYFFFFFYAYYYYYYFFFYYAYFFFLYFYYFYAFYANAYFYFFFFAYYY 141 141 Q 0 0 0 191 19 VVVIIVIVVVLLLIVVVVVVVVVVVVVLIVTVVIIITVTVVIITVIVVVVVVIIVVITIIITVVTTILVI 142 142 A 0 0 0 191 38 IIIDVIDVIIDDPEIVTIVVIIIIVIVIEVDVVDADVVVVIVDVVDVIVVVEDRVVKKKVDEVVVVGPVD 143 143 P 0 0 0 191 41 KKKETKAKIKEEDQKLEKLKKKEKLKQVDKQKLEDEPPPQKKEPKKKIPKQPDDLKQEDKEQPKPPDDKD 144 144 Y 0 0 0 191 48 HKKQAKVREVQKEVSDENEQNKSSSNEKVECKQVVETVEQQSVTQQQSEDEVVDSECEEKVCTNTTDEDI 145 145 V 0 0 0 191 4 IVVVVVVVVVVVVVVVVIVVVVVIVIVVVIVVVVVVVVIVVIVVVVIVVIIVVVVVVVVVIVVVVVVVVV 146 146 R 0 0 0 190 9 DDDDDDDDKDDDKDNDDDNDDDSDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDDDDSDDDDDDDDNDDN 147 147 V 0 0 0 191 27 LLLIKLLLHRRLLVINTLLLLLIRKLRALLLRLPVILLLLLTILFILIVIVLIVKVVLVIRMLLLLLLVI 148 148 E 0 0 0 191 33 STATEASTDQTSSEQELTTEASESQTEEEAAEEEETAAEKTEEAATDTAEDKEEDDEEEDEATTAADAEE 149 149 E 0 0 0 191 36 AATAATTTAAATEADKGEEKAANAAAAEEQAANRANAANGAKASASAAGGASEQGQNKNEAAGTGAENNN 150 150 G 0 0 0 191 36 RKRRKKKKRQQGKKRQKRKQHKKQKRKGNGGKQKKKGRGSKKKGGKKQGKKNKGKKGNGKQGGKGGGKKK 151 151 S 0 0 0 191 43 RSTLQTVTERRVQRIQKRQQIKQRSTVRKRETRTRRRRRRQEKRRLVKRVRREQTRKTKIRERIKRRRTL 152 152 I 0 0 0 191 17 IIIIIIIIIIIIIIIIIIIIIIIIIIIIVMMIMIVVIIVMIMVIVIIIIIVIIMIIMMMIIMVIVIMMVV 153 153 H 0 0 0 191 45 EEEEQEEETEEEIQEQVILTEICETEKTIVRQLITVIECVTITVEQKIVTVEVCTTQTVIEKIEVVTVIT 154 154 V 0 0 0 191 14 VVVVVVVVVVVVVIVVVVVIVVVVVVVVIIVVVIICAIVVVIVAVVVVIIIIIVVIIVVIVVIVAAVVII 155 155 D 0 0 0 191 30 DDDDEDDDDDDDDTEDDDDEDDDDDDDDDKDDDRHHDDSDDCHDDNDNDETTTHDHRHHHDDEDDDHDTH 156 156 P 0 0 0 191 48 WWWWWWWWWWWWWPWWWWWPWWWWWWWWPPWWWPLLPPLWWPIPWWWWPLPPVLWVLLLPWWLWPPVWPV 157 157 I 0 0 0 179 46 DDDDPDDDDDDDDLDPDDDMDDDDDDDPMQDDDMMMPPPDDMMPD DDPMIPMLDILLLMDDPDPPLDMM 158 158 P 0 0 0 166 32 PPPP PAAPPPPPPP PPPEPPPPPPP EE PPEEEELEPPEEEP PPPEPPEPPEEEKEP DPEEDPEE 159 159 G 0 0 0 126 0 GGGG GGGG GG G GGGGGGGG G GGGGG GGG GGGGGG GGGGGG GG G GG 160 160 L 0 0 0 126 4 FFFF FFFF FF L LFFFFFFF L LLLLL LLL LLMLLL LLLLLF FL L LL 161 161 F 0 0 0 96 21 L I L V LILFL LLL LLILLL LIL L F M LL 162 162 D 0 0 0 65 8 E E E E E EDE D DEDD D D D ## ALIGNMENTS 71 - 144 SeqNo PDBNo AA STRUCTURE BP1 BP2 ACC NOCC VAR ....:....8....:....9....:....0....:....1....:....2....:....3....:....4 1 1 M 0 0 0 41 32 T T T T V MT T M T T T T 2 2 R 0 0 0 139 27 DNDNQ DN QR DDE D QQDQQD KKDEENDQDEQQ DQ KQE DED EDEQK DDDDNNK 3 3 L 0 0 0 155 39 RMLLWWFRPM KY Y WWRY L YFLFLLY WLMYFWLKYWWKLLF YYLLLLL YLKFR WLRLMWW 4 4 V 0 0 0 185 22 IVIIFVVVIVVVVLVVLLILLVVILLLVIYVFFLYLIVILLFIIVYLVLLVVLVIFFLVLIVIVVLLYIF 5 5 E 0 0 0 188 49 LVTANVNCLVELLVNEANCNIEETQTQCCTVHTRNNEVVNQNCVVNAVRKILRVVQENCQCVIVCKRNTN 6 6 I 0 0 0 191 12 MMVVVMIVMMVMIVVVIVVVVVVVVVVVVVLVVVVVILVVIVVLLVVLVIMMVIVVVVIVVLLMVVVVVI 7 7 G 0 0 0 191 4 AGGGGGGGAGGAGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGAGGGGGGGGAGGGGGGGGAGGGGGGGGG 8 8 R 0 0 0 191 37 RRRRKRYATRKKRRKQQKAKKHEEVRVRAVKKKVKKTKKKKKKKKKRKVVRRVKKVKRKVRRRYAVVRRK 9 9 F 0 0 0 191 11 IIVIIVIVIVIIIIIIIIIILVIIIIIIIVLIIIIIIFMIIIIIIIILIIIIIIIIIIIIILIVIIILII 10 10 G 0 0 0 191 37 GVLSVSSAGVVGSTVVVVGVNGVVSASGATTVVTVVVGGVVVGTVVTTTTVGSVFSLTVSGTASATTVVV 11 11 A 0 0 0 191 34 AAGGNASGAANAGSNNANGNGGNNSGSAGKSNNSNNAASNSNASSNSSSTAASSSSSSGSASGGGTSNAN 12 12 P 0 0 0 191 34 APATTPVAAPTAVVTTPTATAATTTTTPSPPTTTTTPVTTATAVVTVPPTPATVVTPVVTPPVAATATPT 13 13 Y 0 0 0 191 29 HYHHHFHFQYHHYYHHQHFHSYHQHHHHFHHHHHHHQYYQQHHHFHYYHHYHHHHHHFYHHYYFFHHHHH 14 14 A 0 0 0 191 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 15 15 L 0 0 0 191 13 VVVIIVIVLIIVIVIILVVIIIIIIIIVVLIIIIVILIVILVVVVIVVVVVIIVVVLIVLVVVVVVIVVI 16 16 K 0 0 0 191 20 RYKRRKQRRYKRQKKKRRRRKRKRRRRRRRKRRRRRRNRKSKRRRRKKRRYRKRRRKKKRRKKRKRKRRR 17 17 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 18 18 G 0 0 0 191 50 EWWQEWEEEWEEWWEEEEEEWWEEEEEAEEWEEEEEEWWEEEEEEEWWEEWEEDEEEWWEAWWWEEEEDE 19 19 L 0 0 0 191 14 VLVLVVILVLVVVVVVMVVVVVVVVVVVVVLVVVVVMLLVVVVVLVVLVVVVVVVVVVLVLLVVVVVVLV 20 20 R 0 0 0 191 15 RKRRRKRRRKKRRKRKRRRRKRKRKRKKRRKRKKRRRKRRRRRKKRKRKKKRKKKKKKKKKKKRRKKRRK 21 21 F 0 0 0 191 10 VVILVVVIVIVVVLVVVVLVVIVVVVVLLVVVVVVVVVLVVVLVIVIVVVVVVVVVVVVVLVLILVVVVV 22 22 R 0 0 0 190 47 KVRHIQKKKQQKYYIK.IKIFKKLFHFWKYYIMFLIYNFIYIWYYLYYYFQKFYYFNHRFWYFQKYFLLT 23 23 G 0 0 0 185 25 PPSSSPPSSPSDSSSS.SSSSPSPPSPTSPSSPPAS.SSS.SPSSPSSPPPAPSSPASSPPSSASPPSPD 24 24 E 0 0 0 186 51 FDFYQFAFFDHDYHDFNRFQYYFTTRTFFRYRHTTQ.YSK.RFFFTHYTTAFTFFTTQFTFYEDFTTNEF 25 25 P 0 0 0 191 16 GTTSTSTETTSPTTTTPTTTTSTTTTTTETTTTTTTPTTTPTTTTTTTTTTGTTTTTTTTTTTTTTTTTE 26 26 V 0 0 0 191 18 DEDGDEDDDEDLEEDDSDDDDADDDDDEEDSDDDDDDDEDDDEDDDDSDDEDDDDDDEMDESEEDDDDED 27 27 V 0 0 0 190 32 AFLNFLFIDLFSIIFTSFIFILV.FYFDIFIFFFFFSFIFSFDLLFFIFFLTFLLFFILFLIILIFFFFR 28 28 L 0 0 0 180 53 DDFLKMPAPFTFLFPRDPAPLLR.KPKPEPMAAKI.DDFPDPLDLVKLKLFDKLLKPFRQDFVFALK.KF 29 29 H 0 0 0 181 44 YYEENDRSDDETRDEFFESENAFYKESFDEEEDKD.FYDEFEYYDKYDKDDYKDDKENYTYEDDSDE.KD 30 30 L 0 0 0 189 51 GDYLTFLYYYLDYYAQPEYAYVQPLLLAYGYESLGPPTYEPEGRYQSYLLYGLYYLGYALGHYYYLLPLP 31 31 E 0 0 0 190 44 PSAILE.NGDQYEKEPERSESKQEKRKVSSPRKKNEEPQRERPFRQHGDDGEKRPKSQNKPADPGEKEKN 32 32 R 0 0 0 191 50 LWPRYSRPNNAGPHLGRYPLPEGRKHQRPREYLKTERWPYRYLWTKWEKERLMRRHRPWELEPTPYEEKT 33 33 V 0 0 0 191 44 EWLFLWFLLWEVWWVEFALTWWEFVPVSLLWIFCLRFQWLFLSTWLWWVVWIVWWVLWEVTWLWLVVRLV 34 34 Y 0 0 0 191 40 TLYPFRSSHWYLYWWVLITLYWVLISIYSWWFIVYYEIFFEFTLTYLVIMMTTTTLFYLITVSWTLIYFY 35 35 V 0 0 0 191 36 AGLALVTFSLQTLLLLITEFLLLRLLLKELVMVILRVQIQVLKRLLKLLLLKLLLLILVLQLIIELLALL 36 36 E 0 0 0 190 40 DKMGPGPEDGGDQKGNPDDRKDEDEEDDDRREPDQKPVQEPEDRRDTRDCGSDRRDKKRDDSQGKDDN.Q 37 37 G 0 0 0 191 41 GGQGGRGDDRQGQTDDGVGELGEQTETGGPRNDGQGGQRKGGGGRGRHEKRGEGHTNGETGKIRGTTGGD 38 38 H 0 0 0 191 41 SDRTRGRGGDTKNPSNPRTNDSTRKGGKSPGKKKSQKGAKTKADEPTRTNGDQDEGSVDGSRGEDGGSGN 39 39 G 0 0 0 191 42 RDGRDERRRQLQGGEVRTRKGRVLKRKRKGEPGRGRRNGARDREGLGGRGDTKEGKQKGKRGGQRKKVRK 40 40 W 0 0 0 190 47 RWKQEQWEVELSKWTEWPQEWEEEEPEQTESPEEEEWWWEWEQREEWREKPTEVKEEPNEREEESEELTE 41 41 R 0 0 0 191 38 FRFIVYLTFYLFRKLLLVFLQVLYLIHFYLLVAQLLLRQLLVFRVLQYLHKFLKVLLIRLFRLYFLHKYL 42 42 A 0 0 0 191 41 EVEQTAKTEPTERTTTEEDIQKVTETEESETETTTTEQSVPTEQKTARKEEEEQKEIEKEEKKRRRETDV 43 43 I 0 0 0 191 13 VVVLIVLLVVVVLVVVLIIVVVVIVVIVLVVVVVIVVMIVIVVIVVILIIVVIVLVVLLIVLVVVIIVVI 44 44 E 0 0 0 191 40 VEEKEEERLEKVLEATETSSILTEQVQATRIKDSEAEQEKESAELEEAREEEEEVEDARQESEVTKERRA 45 45 D 0 0 0 191 43 GTAKSAELEASSEQSSRSLGNQSKGRGTISQSTSSGRIRSRARRGGQQQNKRNLSQGDSSTQTELNHSST 46 46 L 0 0 0 191 54 AARAHVGTIAHAGGHYGWTHGAHVVAVATGGHSVTHIFWHYHAGGAGGVVAAVVGVAWGVAGGGTVVHSH 47 47 Y 0 0 0 191 18 RKKARQRGRKRRRRRRRRGRRRRWKRKRRRRRRKRRIKKRLRRRRRRRKKKRKRRKRRKRRRRKRRKRRR 48 48 R 0 0 0 191 52 VISYVDEQEVMVTLQIAKQKEWVPFPFAPQRVFFQKERHKELAPMQLLFFVIFLGFRAPFEPAAPFFTPV 49 49 V 0 0 0 191 34 QHLHHHHIAHHQQQHHGHTHQQHHFHFAIHQHHFHHGHHHNHAQHHQHFFHQFQSFHHQFAHHQVFFHHH 50 50 G 0 0 0 191 33 KNTSKGPKKGKKGGKKKKTKGGKKKKKKKQGKKKKKKGNKKKKGGKGGKKNKKGQKKGGKKGGPAKKKKK 51 51 E 0 0 0 191 36 TDKGQKKNNKGTKRQGNQNNKAGQQDQDNNKSNQGNNNHNNQDRKGRKNNDTQKKQQKKQDKKKGNNNNG 52 52 E 0 0 0 190 50 VVGKFSSGVTLVGGFFLFGFTDLFFFFHGLGFMFFFLGDFLFHLVFGGMQLVFIGFFGGFHGGGGLMFVF 53 53 L 0 0 0 191 39 VIWFDLWLVLHVILDHYDFDVVHIVWVLFWLDYVVDYLLDYHLLLILLVVLVVLLAYFIVLLVVLVVDYD 54 54 V 0 0 0 191 21 IVSLLVISILMVVVLMILTLVVMIILIVAIVLVILLVIIIVLVVTLVVIILVIVVILVVIVVVVGIILIL 55 55 V 0 0 0 191 35 TVVLLALGVVLTVAVLVLAVAALVVVVAAVVLLLVLVVILLLAAVVAALLVTLAVLVAIVAAAAALLLIL 56 56 H 0 0 0 191 33 RKKTKKKRRKTKASKKQTHTQCKKKQKTLGQTKKKTKKKSQQTRRKARKKKKKSKKKQAKTSKQRKKTHQ 57 57 L 0 0 0 191 12 FLLLFLFLFLFFLVFFLFLFLLFFFFFFLFLFFFFFLLIFLFLLLFVLFLLFFLLFFILFLLLLLFFFLF 58 58 A 0 0 0 191 37 KVKEEVRTRVEKDKEEAKSEEAEAKEKKEKKEKKVEAAKEAKKKQAKEDSQKKKKKEVAKKEEESDREAK 59 59 G 0 0 0 191 11 GGGGGGGGGGGEGGSGGGGGGGGEGEGGGGGGEEGGGDSGGEGGGGGGGGGGGGGGEGGGGGGGDGGGGG 60 60 V 0 0 0 191 29 IILFFIIVIIYVIYYFILIYCVRIIWIVVYVYLFYYVVVHVVVILYYVVIIIILLIIIVIVIIVVIYYVY 61 61 T 0 0 0 191 32 DDDDDDDSNDTTDTPDTDAPNSNPDTDTEHDDHDDPDADPEEAEDDTDDTDNDTDDDDDDASDDTDDNEG 62 62 D 0 0 0 191 32 DDDTSDTNDDNDDDTNSNTNDDNDNNNTTADNGDNTDDDNNTDDDNDGTSDDNDDNGDDDSSDDTNNSDN 63 63 R 0 0 0 191 38 RRRIIRVKRRIRRRIIRLKIRRILIIIRKIRIIIIIRRQIRLRRRIRRMMRRIRRIIRRIRRRRKIIIRI 64 64 T 0 0 0 191 25 TDNEEDEETDNNDDNNENENNDNNNNNDESTNNNNNNDGNSTDDENDDNNDNNEDNDNNNDEDDENNNNN 65 65 L 0 0 0 191 35 AAAKEAQAAADRVQEDQEADTADADQDEDDALDDDDQQSDQEAGEALQEDQADVEDQALDDLAVEDEEGE 66 66 A 0 0 0 191 26 AAAAAAAAAAIAAVAVAVAVAAVAIAVAAVAVAIVVAAAVSAAAAVVAVAAAIAAIAAAIAAAAAIIVAV 67 67 E 0 0 0 191 26 EFEQEFKDEFEETKEEEEDEEEEEEEEEDEEEEEEEEQSEEEERREKEEEFEERREEEKEVEACDEEEEE 68 68 A 0 0 0 191 45 AALEKAMAAAHEQDSSAKAPSAHKQPKRASAPKKQPELQKEKRALGESGLSEKTLKKLSKRQAAAKKCPA 69 69 L 0 0 0 191 24 LCLLWLLLLALLWILFLFLFYLLMYFYLIWLFYYFLLYLYLLLLMFILWYCLYYLYVLYYLWLLLYYFLF 70 70 V 0 0 0 191 39 NKKAKRIRNKKNICVKRKRRRRKKKKKNKRAKKTRRRVTRRKNAARCARRKNKASKCCVKNAIRRKKKVK 71 71 G 0 0 0 191 22 GGGGGGGGGGGGGGGGGGGNGGGGGGGGGGQGGKDDGNNDGNGDGGGGQNGGGDGGGPGGGGGGGGSGGG 72 72 L 0 0 0 191 50 LKVAGQAALKTTRMGDCSTGVAEACGKILYTASCHGSACGCAIFFHMAKWMVKFHKKVCKIAACVRRSTL 73 73 R 0 0 0 191 43 DQDEMETREQHEEDTYELRIEVTLSLREREDILDEIKDEIMLEEEEDEDEYEDEESEDQSEDSEGDDYPM 74 74 V 0 0 0 191 15 LIILLVLLLVLLIVLLLLLLIVLLLLLLLLIILLLLLIILLILVILIVLIVLLIILLIILLIIVLLLLVL 75 75 Y 0 0 0 191 51 YATLKSLYFSYYAYNYLQYKARYQFRLYFCLKKLMKLAVKFKYCCMYLLFAFLCCLYAEFYLGAYWLYES 76 76 A 0 0 0 191 17 VVMLVVVAIVQIVIVQVIAVIIQIVVVVAVMIIVVVVVVVVVIVVVILIIVVIVIVVIIVILIIVIIVII 77 77 E 0 0 0 191 40 PPPQSATPEPEDHDTEPHLTDSETSSDARPPPKSSSCEDAPPSPPSEPTPYHSPSDAEEADPRPDPTSPD 78 78 V 0 0 0 191 40 RRSREKDRRRRRRAERAQRKERRRRRRRREKEARAKARSKAERIRAATRRRRRRRREKSRRKRRRRREVE 79 79 A 0 0 0 191 31 EAAEESEDDEDDEAADSNADSRDKEEEEDDETDEDDSSTDSDDASAQADEDDESSKTDSEDQESAEDDAD 80 80 D 0 0 0 191 35 RQVQQADRNQEQQEDEDDQDQHEEDEDKQMAQLDDEDAQNDQAQEDDEQEEQNELDDKENQAQAREQQEQ 81 81 L 0 0 0 191 30 LLLLLLRLLLALLLLGRALLLFDLAAALLLLLQAQLRLLLRLLLLQLLAGLLALLAQLLALLLLLAALLL 82 82 P 0 0 0 191 34 PPPPDPPPPPIPPPAIPDPVPPIVVVVPPHPQEVQSPPPAPSPPPQPPIVPPVPPVQSPVPPEPPQVSPT 83 83 P 0 0 0 191 35 EEEPEPERDEEEPETEEENDQAEAAESALPTPEKPEQQVEEQERQPDEPDEEDANKEAAEEAPESEDEKD 84 84 L 0 0 0 191 17 PPLPLPLLLALTPLLLLLLLLPLLLPLTLLLLLLLLLLLLLLTLLLLLLLPLLLLLLLLLTLLTLLLLLL 85 85 E 0 0 0 189 33 GDADGEEPDEDDEEDADSPAEDAPEEEDPPSNPEDTGASAGADDGEDPEEEEADAKPDEEDAPGGDEDPE 86 86 E 0 0 0 191 19 DEEAEEEDEEEEEEDEEEDEEEEKEEEEDEDEDPDEEETEEEDEADEEEDEDEDTKEDEEEPEDDEPEEE 87 87 G 0 0 0 191 22 DNDDNNGDEGHDGGDHGGDNGGNDDDDGDGDGNGGNDGNDDDGGGGGDDDGDGGDDGGGDGGGNDDDHGD 88 88 R 0 0 0 188 13 EEEEEEEEEEEEEDTEEEEEEEENEAEEEAEEEEQEEDDEEEEEDQDDEEEEEEEESEEEEDEEEEEEEA 89 89 Y 0 0 0 191 3 FYFYFFFFFYFFYYFFFFYFYYYYYFYYFYYYYYYYYFYFYYYFYYYFFYYFFYYYYFYYYYYFFYYYYY 90 90 Y 0 0 0 191 6 YYYYYYYYFYYYYYYYHYYYYYYYFYYYYYYYYFYYHYYYHYYYYYYYFYYYFYYFYYYYYYYYYYFYYY 91 91 Y 0 0 0 191 37 HWWWFWTHYWYYWWWYVYHYWWYIILIHHYWFFIYYVWWYVFHWWYWWIQWHIWWIFWWIHWWWHIIYYY 92 92 F 0 0 0 191 48 ASRHHSHAASSSASHSLHAHRVSFAHATAHHHHCHHLRKHVHAHHHSYTASDFYYAKHRGAYAAAATHFH 93 93 A 0 0 0 191 13 DDDDEDDDDDDDDQDDDEDEDDDDDEDDDQEEEDQEDDDQDEDQQQQQDDDDDQQDDQQDDQDDDDDEQE 94 94 L 0 0 0 191 11 LLLLILLLLLILLLIILILILLILLILLLLLIILIILLLILILLLILLLLLLLLLMILLLLLLLLLLILI 95 95 I 0 0 0 191 22 IVILIIIIEIINIEVIIIIIVIIVIVIIIVEIIIIIIMIIIIIEEIEEIIIVIQVILEEIIEVIILIIIV 96 96 G 0 0 0 191 3 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNGGGGGGGGGGGGG 97 97 L 0 0 0 191 39 LLMLCLMLLLCLLLLCLSLLLLCLMAMLLLLCCLLLLMCAMCLLLLLLLLLMLLLMCLLMLLLMLMLCLC 98 98 P 0 0 0 191 42 ERTSETRAERTDRRTTSTEETATKERKAEETTKDDTSAQTEDARKAKSNTQAQKKHPRTDAREAEKTTTK 99 99 V 0 0 0 191 6 AVVVVVVVAVVVVVAVVVVVVVVVVVVVVVVVVVVVVVVVVVAVVVVVVVVVAVVVVVVVAVVVVVVVVV 100 100 Y 0 0 0 191 38 VTVVVMFHVSFKIIYFIYFVVFFYYVYTYIFVLITIFVIYFFIVIKIVVYRTELIFYIFYVEISRLVVVV 101 101 V 0 0 0 190 32 DNTTTNEDDNDDTTDNDLDENNNETTTTDDTTTDTDMNTDLSDDNTTTDNNDENNTDNTTTTNNDLDDDT 102 102 E 0 0 0 191 29 AQKETENGGQGQQEEGQQGEAQEEDEEAGEQEDEDEQENEQEQEEAEEEEQEEQQETQEDADEATEQETE 103 103 G 0 0 0 191 11 AGGGGGGGGQDGGGGEAGGGGGDGEGEGGGGGDGGAGGGGGGGGGGGGGGQGGGDGGSGEGGAGGGGGGG 104 104 R 0 0 0 191 49 AVVQEVKTKVREVVAITETTDDEREEGDTEEEEKRREYYSDDARQEVVESETNQEAEYVEEEVTGSATDE 105 105 Q 0 0 0 191 48 SDLAKELLSDPLELEPPVLIECPELPEALPRPEHHELHQELLSLWELATEDDSLHEKDNRPCSAAEEKTE 106 106 V 0 0 0 190 12 FFLLVLVLYFILLLIILLLIMLLLFVFLLLLILLLLVLLLVILFLLLLLFFLLLLFLFIFLLLFLFLLVL 107 107 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 108 E 0 0 0 191 43 TVEITKTKSTRKRKQRIHRKTTRETVMRTVQETVKKTEKKAKTKVRKRTVQKEQKTVIRVKQWVRTTKTK 109 109 V 0 0 0 191 11 VIVIVVVVVVVIVVVVVVVVVVVLLILVVLVIILIIVVIIVVVVVIVVLLVVLVILLVVLVVVVVLLILV 110 110 V 0 0 0 191 43 VTSKKDVATVTVESKIRKKKEKTVKTKLKASKSKKKVVIKVKTDDKAETKVVTDDRAKSKANDDHKKKTK 111 111 D 0 0 0 191 30 AENDESNAGDEARQENDEAEKGEQDEDASEYEEDEEDDDEDEAHHEQYDEDMEHHDNKHDAYHSANDDEE 112 112 I 0 0 0 190 17 VVMIILVVVVIVLLIIVIVIMLIVVIVIVVLIIVIIVMMIVIILLIMLVIVVVLLVIILVILLLVVVIII 113 113 L 0 0 0 190 23 QFLLLMFHFFFQLMLIVLLLMMFLILIHQWFLLLLLIMMLILHLLLMFMIFQLLLLELIMHFMMHMLIIL 114 114 D 0 0 0 191 32 DEEETENNDEEDEESESSNSEDEKEQENNTETTESSAEESPTNEEAEEEEADQEEETPEENEEQNEEEES 115 115 A 0 0 0 191 34 FTTTPSSHFTTFTTSTAPHPTNTTTPTFHPTPPTPPATTPAPFTTPTTTTTFTTTTPTTTFTTTHTTTTP 116 116 G 0 0 0 189 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 117 A 0 0 0 183 14 AAAAAAAAAAAAAAAA.AAAAAAAAAAAAAAAAAAA.SSA.AAAAAAAAAAAAAAAAAAAAAAAAAAAAA 118 118 Q 0 0 0 191 15 GNNNNHNGGNNGNNNNNNSNNHNNNNNGSNNNNNNNNNNNNNGNNNNNNNNGNNNNNNNNGNNNGNNNNN 119 119 D 0 0 0 191 5 DDDDDDDDDDDDDDDDDDDDDPDDEDEDDDDDDNDDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDND 120 120 V 0 0 0 191 9 LVVVVLLLLVVLVVVVLVLVVVVVVVVILVVVVVVVLVVVLVIVVVVVVVVLVVVVIVVVIVVVIVVVVV 121 121 L 0 0 0 191 27 LLLYWLLLLVWFLIWWLWLWLLWYYWYILYMWWYWWLLMWLWILMWLMYYLLFLLYWLLYILLLLYYWYW 122 122 I 0 0 0 191 29 EVVLVVQEEVVEVVVVVVEVVQVVLVVEEVVVVEVVEVVVEVEVVVVVCVVEVVVIEVVIEVVVEIVVAV 123 123 I 0 0 0 191 7 IVVVVVILLVVIVVIVVVIVVIVIVIVIIVVVVVVVVVVVVVIVVVVIVVVVIVVIIVVVIIVVVVVVVV 124 124 R 0 0 0 185 34 RKKRKKKRKKKRQRSKEQHQKEQKEREAHRRKKEEQKKKQSAARKERKKKKRKKKDKVIQARSRA..DKQ 125 125 G 0 0 0 177 43 PPSDTGSGGDGPGARG.SGRTTGP.KSPGKGRTARRLAARLRPPPRAGTTGPTPPTPGG.P.G.G..RTR 126 126 V 0 0 0 167 42 DDTDA.RPPDD.ECHD.NPKA.DP.DPPPPD.PDPKHNDPHPKCCPCRPQD..CC.EDS.PPD.A..QA. 127 127 G 0 0 0 132 43 .AEAQ.SGGA...EG..TGGSG...G.QGGN.QN.GQKL.EGSTAGED.T...AA.HEA.SS..A..Q.. 128 128 E 0 0 0 98 45 .LGTQ.ALR....GQ..KL..M......LQ......QSK.P.GGGKGG.....GG..QE..E..G..... 129 129 R 0 0 0 90 36 .VS...E.R....S....S..P.......PD.....QDD.V.PSSTSE.....SS..SS..A..RDA... 130 130 L 0 0 0 86 42 .KV...D.P.......L.A..E..S.....A.....TAA.T.SLL.LS.....LL..IIS.S..ESM... 131 131 R 0 0 0 87 54 .P....A....K.F..T....D..K.....IK....AFF.S..DD..I...KKDDT...E.L.DGVK..M 132 132 D 0 0 0 121 31 RDD...S....R.D..DG...K.ET.D...DK..E..GGKD..DD.DDE..RQDDD.DDR.D.G.ED.EN 133 133 R 0 0 0 152 41 GPEK.RDK.G.G.R..GK.KKK.GHGHGK.KGGGKK.KIKKK....RAGH.GG..GGQKYGE.K.HGRGA 134 134 A 0 0 0 175 34 RQQRKRQG.RKKREKKRK.KERKKGGGTA.RGKERK.TKKKK.RR.ERKGRPKRRKKSRGPRRQ.GKKKK 135 135 E 0 0 0 184 21 SEEEEELS.EETEEDEEDTDEEEDEEETTDEDESDD.EEDTD.EEDEEEEETEEEESEEETEEQ.EEDED 136 136 R 0 0 0 191 45 FRRYAHVVVRHFRRLYVMVALLYLVVVMVLRVVYLAVRRLVALRRLRRLVRFIRRVFRRVLRRTLVLLIL 137 137 L 0 0 0 191 7 YLLLLLLLLLLYLLLMYLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLYLLLLWLLLLLLLLLMLYL 138 138 V 0 0 0 191 13 VIIIIIVLIVIIIILIIILIIIILIIILLLLILILIILILIILLLLILLIVMILLVIIILLLIILLLLLI 139 139 P 0 0 0 191 0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 140 140 L 0 0 0 191 25 FFFAYFFFFFYFFYYYFYFYYFYAAFAFFAFYAVVYFFYYFYFYYVYFAAFFYYYANYYAFFYFFAAYAY 141 141 Q 0 0 0 191 19 TVLIIVVVTTVTIAIVVITVVVVVIIIVTIVIIIIVVVVVVVVTLIVVIIVSITTIVVLIVLVVVIIIIV 142 142 A 0 0 0 191 38 VAVAVAVVVVVKVVDVVDVVPEVVRDHVVRIDPDDVKIVVKVVDPDPVRKVVDDGKVVIHVPIKVKGVVV 143 143 P 0 0 0 191 41 PDLSKAPPLPKEKLDKPDPHERQKQDDPPDVDDQEKPKKTPKPQDDDRDDLPDHQQNSEEPDQAPEDKLK 144 144 Y 0 0 0 191 48 TVGVKFDTEEEFQNVDVVTTYHEECVDETVEVVCVQTERKVETCQVNEDDEECCCCKDNETDEFTDCESQ 145 145 V 0 0 0 191 4 VVVVVVVVIVVVVIVVVVVIVVVIVVVVVVIVVIVIVVVVVIVVVVVVVVVIVVVVVIIVVVIVVVVVVV 146 146 R 0 0 0 190 9 DDDNDDDDDNDNDDDDDDDDDDDDDDNDDDSDDDDDDNNDDNDDDDDDDNDDDDDDDDDDDDDDDDDDQD 147 147 V 0 0 0 191 27 LLRIKLMLLVILLLLILVLLLIVLVPVLLLLVKLLLLNVVLVLLLLLLLITILLLILLLPLLLLLILVPI 148 148 E 0 0 0 191 33 AEAHKAKDEEEDEEAEAKAEEEEEKSETTEEEEDDDEADEQAAAADKEDEDENDEEAADEEDEQAEEEEE 149 149 E 0 0 0 191 36 AASTEGKAAAGSQQENQSSNSNGRAAEGQADNAKKKAEDNTDAAKQQAKEGNESAENNKEGAAAATQNEN 150 150 G 0 0 0 191 36 GKNGKGRGGGRGGQGKGKGGKRRGQKQGGRGKKKNGRRKQRKGGGGGGEGKRKGGQKGNKGGGRGNGKKK 151 151 S 0 0 0 191 43 RSTTRTERKTRFLETMRKRQQKQKKQTRRRRTLTFERRRRRTHEELQREHTVKEVKRVLKRRIRRTRRTI 152 152 I 0 0 0 191 17 VMIMIVMILMIVLMIIIVIVIMIMMVMVIMMIVIVVIIVIIIVIMVMMMMMVLMMMIMMMVMILIMMIMI 153 153 H 0 0 0 191 45 VLETVEHVLLVVRVTMEVITTTHEQIKVITVTRTTHELEDEKIRQTLVLTLKVQRTETVTVIRTVTERTK 154 154 V 0 0 0 191 14 LVVIIVIAVVIAVVVIIIAVVVIVVIVIAVVIVVVIIVVVIIVVVVVVVVVAVVVIVVVVIVVVAVVVVV 155 155 D 0 0 0 191 30 DDDTEDTDDDTDDDHTTHDEDDTKHRHADHNHHHEETDDDTHEDDENDHHDDHDEHTDDHEDDDDHHHHQ 156 156 P 0 0 0 191 48 LWWPPWPPPWPLWWVPPPPIWWPLLWLLPLWVLILIPWWIPILWWLWWVLWLLWWLLWWLMWWWPLVILL 157 157 I 0 0 0 179 46 PDDLM PPVDLPDDLLPMPP MPLMLPPLDMMLMPPD PPMPDDMDDLMDPIDDLLDDMPDDEPMLMPM 158 158 P 0 0 0 166 32 DEPEE KEAPEEPPEEPEDE EDNEE DPPEEPEEPP EPE EPPPPPDP EEPPE PPAEKEEEE 159 159 G 0 0 0 126 0 GG GGG G GGGGGG GGGGG GG GGGGGG GGG G GG G GG G GGGGG G 160 160 L 0 0 0 126 4 LL LLL L LLLLLL LLLLL LL LLLLLL LLL L LI L LL L FLLLL M 161 161 F 0 0 0 96 21 LL LFV L DLLLIL LIL I FR LLL LL ILL LL V R I LMD L 162 162 D 0 0 0 65 8 D E D DDED D D D D D D DE DED DD E D DD D ## ALIGNMENTS 145 - 190 SeqNo PDBNo AA STRUCTURE BP1 BP2 ACC NOCC VAR ....:....5....:....6....:....7....:....8....:....9....:....0....:....1 1 1 M 0 0 0 41 32 T M T MM M M M M 2 2 R 0 0 0 139 27 ERQ KEDDDED E KDDE E EDQDEND EE E KD R QQKK 3 3 L 0 0 0 155 39 YRWRYLLLYYL L MYRLW RWLY LLLLYYWRLFFWMRML W FYMF 4 4 V 0 0 0 185 22 VLIFLYLVVLLLIFIVYLILLLLLMLVFVLVFFLIVIYFYVFIVFVVILY 5 5 E 0 0 0 188 49 ENINVNQVEQIRITCVKYLQEIKLKNERVRLNNEC.TKNTVNCENC.LKN 6 6 I 0 0 0 191 12 VVIVVVVMVVVVVIVLVVMVIVVVIVVVVVMVVILVVVVVVVVVVVVVVV 7 7 G 0 0 0 191 4 GGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGG 8 8 R 0 0 0 191 37 AKRKRKVFYVQVRKAKKKQVRSKQQKQVYVYKKRAREKRVSKSRKRREVK 9 9 F 0 0 0 191 11 IIIIILIVIILIIIILIIIIIIIVLIIIIIVIIIIVIIIVIIVIIIVIII 10 10 G 0 0 0 191 37 VVVVGVTRGTITVVAGVAGTVTVVKVVSTSRVVVAAVVVVAVAAVGVSTV 11 11 A 0 0 0 191 34 DNGNRNSGASNSGAGSNNASASNAKNNNGSGNNSGKNNNGGNGDNAKGSN 12 12 P 0 0 0 191 34 ATATATTAATTPVPACTTATAVTAPTTTATATTPASTTTTATSATPPVTT 13 13 Y 0 0 0 191 29 YQYHHHHFYHHHHHFHHHHHQYHHYHHHYHFQQHFHQQHHFHFWHHHFHH 14 14 A 0 0 0 191 1 GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 15 15 L 0 0 0 191 13 LIVIVLIIIIVIIVVILLIVLVLLIIIIIVVLLLVVILILVLVVIVILII 16 16 K 0 0 0 191 20 KKLRRRRKRKKARRQKMKRRKKKRKRKRNKRQQKHRRRRRRMRKKRRKRR 17 17 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 18 18 G 0 0 0 191 50 WEWEDEEWWEEEQDEWEEEEEWEWWEEEWEWEEEEEEEEEEEEWEAEWEE 19 19 L 0 0 0 191 14 VVVVVVVVIVLVVVALVLVVLVVLLVVVVVVMMLLLVVVVVVVFVMLVVV 20 20 R 0 0 0 191 15 KRKRAKKKKKKKKRRKRKRKKKKRWRKKRKKRRRRVRRRRRRRKRRAKKR 21 21 F 0 0 0 191 10 VVIVVVVIVVAVVILIVIVVVIVVVVVVIVIVVVLVVVVILVLVVLVIVV 22 22 R 0 0 0 190 47 AIRLTLFHLFTYHYKTIKKFMFIKFIKYKFHLLYKTLILFKIKLIWTFFI 23 23 G 0 0 0 185 25 ASSSDPPAPPSPSPSASSPPSSSCSSSPPPASS.SDPSSPSSSSSSDSPP 24 24 E 0 0 0 186 51 HQYRDQTDHTQTDDFYTDFTSNSWEQNTYTDVV.FDTTTRDRFHKFSYTT 25 25 P 0 0 0 191 16 ATTTPTTTATTTETTTTTGTSTTSTTSTDTTTTPPPTTTTPTPSTTPTTT 26 26 V 0 0 0 191 18 DDRDADDEDDDDSDADDDDDDDDDEDDDADSDDSEDDDDDIDEADAEEDD 27 27 V 0 0 0 190 32 LFVFAFFLLFFFLFIIFFDFFIFFIFFFLFLFFSDAFFFFAFDLFDEIFF 28 28 L 0 0 0 180 53 L.FPR.RFLRKKFLEFAKDK.AE.FATDLKFV.DIRPAEPDAIFADRLKV 29 29 H 0 0 0 181 44 S.EEF.EDHAKNQQDDAEYS.NE.SLEDHKDE.FAFEEEEYDESEYFSVD 30 30 L 0 0 0 189 51 APYEAALYALLLYMYYEGGLPYSPYETLALY.APAATE.GTEMSEGDYLE 31 31 E 0 0 0 190 44 KEHRDEKPRKKKRKASRSKKESEESREKKKPEEEYEKRESPRYKRPPSKR 32 32 R 0 0 0 191 50 REQGGSDTRDWEQYPPYKLHRPLRPYQETQVRERGGKYRVLYSRYLGAQK 33 33 V 0 0 0 191 44 WRWLSRVWWVVCFGLWVLEVFWLLWVLVWVWFRFPTIIFLHLPWLSVWVL 34 34 Y 0 0 0 191 40 WYLFVFMWWVYIIYTLYYSLELITWLLIWIWLFELVFFTWTYLYFTVQIY 35 35 V 0 0 0 191 36 LKVTLALLLLILAITIVLELKLTEMFVLLLLFKEELLKVLELTLMKLLLL 36 36 E 0 0 0 190 40 LRGPASDGDDDKRAEKPSDDPKRPKRKDNDGDKPTRGDKDDKDQSDTRDA 37 37 G 0 0 0 191 41 KGRDTGTKATKSQGDEKSGTGVGGGEHTRTREGGEGQGKGGNEGGGGKTN 38 38 H 0 0 0 191 41 GAPADSGNSGNSNKGNTGSGTDNPFNNGQGDKNQDRREPGRESTSTRNGQ 39 39 G 0 0 0 191 42 RKGKGKKGRKGRGRRGGDRRRGKRKQNKNKGNKRGRRTTTTNGAKRRGKQ 40 40 W 0 0 0 190 47 EEPKPEEPAESER.SEPEKEWPEWPTTEAEQQLWAEQFWEIERLESPEQE 41 41 R 0 0 0 191 38 RLAVLVLYQLLLLYFVLLFLLLVLLLYLPLYFVLRFLVVLALYLVFLLLL 42 42 A 0 0 0 191 41 HVEKTEEAKEEHQEGKTEKEEEVQTTTHEERVEKSTTTTRQTPQTETKET 43 43 I 0 0 0 191 13 SILIVVIFIIIVLILVIVVVVVVIVIVVLIFIIVFVIVIVVIIIVIVLII 44 44 E 0 0 0 191 40 AKAAVTEEAENALTNIKAKQEDEETDDTHEEAAEEENAEEVRVRQAAKEE 45 45 D 0 0 0 191 43 QSDSSGGNQGGGRAIQSTRGLSSQQTSSQGDSSLSSRSSKISLQTTAENS 46 46 L 0 0 0 191 54 AHWHTAVGSVVVGATWHHAVVVYFWYYVAVGHHLGAAHVATHTAHAVGVS 47 47 Y 0 0 0 191 18 RRRRRRKARKKKQRRRRRRKRKRFRRRKKKLRRWQRWRRRGRRKRRRQKR 48 48 R 0 0 0 191 52 TKRQREFVEFFFTFEYQVVFPKTPRRIYNFVKKPSEERRKEVADLAPRFP 49 49 V 0 0 0 191 34 HHHHHHFQHFFQSHIQHHQFGHHAQHHFHFQQAGAHHHHHTHIHHAHQFH 50 50 G 0 0 0 191 33 SKGKSKKPSKKKGKAGKKKKKGKKGKKKSKPKKKKSKKKKKKKSKKGGKK 51 51 E 0 0 0 191 36 DNKNGGQKGQQNKHNKTNNQNKNGTNGNGNKNNAGGQNNNGNNDQDGKQG 52 52 E 0 0 0 190 50 SFSFRMFATYFLGVGAFYVFLGNLGFFMDMAFFLGRFFFVAFGTFHRNFS 53 53 L 0 0 0 191 39 VDWELFVLVVIVLIFVDDVVYLLYIDHVIVLDDYLLIDIFLDFVHLLVVI 54 54 V 0 0 0 191 21 VILLLIIAVIIIVLAVLLVIVILLVLMIVIAIIVILILLIILAVLVLVIL 55 55 V 0 0 0 191 35 ALALVLLAALILAMVALVTLIAVVALLLALAIIVAVLLLVALAALVVALV 56 56 H 0 0 0 191 33 HSKTRKKKQKKKAKRETKKKKKKRQSRKRKKKKQRSKTTQRTHWQTRHKK 57 57 L 0 0 0 191 12 LFLFFLFLAFFFFFLLFFFFLLFLFFFFLFLFLLLLFFFFLFLAFLFLFF 58 58 A 0 0 0 191 37 GEEEEKKESKQKTATEEKEKAVVEEEEKMKEKKKSADEEADEGQKKREKV 59 59 G 0 0 0 191 11 GNGGGGGGGGGEGGGGGGGGEGGGQGGEGGGGGGGGEGGGGGGGEGETGG 60 60 V 0 0 0 191 29 IHVYVYIVVIVFIVVVYLVIIVIIVYIFVYVMMVVVVMMFIYVIRVVVIY 61 61 T 0 0 0 191 32 APAPANDDADDNNQATTDNDADDPPPNDADGYYDTDANNHANEDPTPDDD 62 62 D 0 0 0 191 32 DSGNDDNDDNSNDDTTGNDNDDTDDSNNGTSHHNTDDRNSTGTDSTDDNN 63 63 R 0 0 0 191 38 RIRIRIIRRIIIRRKRIIRIRRIRRIIIRIRIIRKRMIIIKIKRLRRRII 64 64 T 0 0 0 191 25 DNDNDNNDNNENDNEENNNNTDETNNNNDEENNDESSENQENEDNDTDNN 65 65 L 0 0 0 191 35 ADQDAEDALDEEQAERQDEDQVEAVQDDADADDQQAEDLAQQEADEAVDD 66 66 A 0 0 0 191 26 AVAVAVVAAIAVAAAAVVAIAAAAAVIIAIAIIAAAAVVVAVAAVAAAVV 67 67 E 0 0 0 191 26 LEREEEEEEEEELEDQEEEEEREEEEEIEEEEEEDDEEEEDEDEEVEEEE 68 68 A 0 0 0 191 45 ANAPGKRAAKKKAAAMHQARTNKATSHPAKAKKAAAKKPPAKAAERESRN 69 69 L 0 0 0 191 24 LYRFLYYLLYLYLLLLLYLYLFFWMFLYMYMYFLLLLYLWLMLLLLALYF 70 70 V 0 0 0 191 39 RRTKRKKRKRKRGVKTKKNKRCKVNRKKKKRKRRRRKKKKRKKRKNRIKR 71 71 G 0 0 0 191 22 GDGEGGRGGKGQGNGNEGGRDGNGGDGGGGGGDGGGGEEGGEGGNGGGRN 72 72 L 0 0 0 191 50 SGCSTWCTRMFAYHVCGCLCYMLAVGDMSKMFFYVTGCGRTGLAALLWCR 73 73 R 0 0 0 191 43 RIDYATPQRPYETEREVTKPTDQKSIYDVDQTSQRLLLMEAIRRIETEAE 74 74 V 0 0 0 191 15 VLILLLLIVLILLLLILVLLLIIVILILVIILLLLFLLLLLLLIILLILL 75 75 Y 0 0 0 191 51 YKARLKFAWLKYYQYGKHYLLLKLWKYLHLAKKLYVQKKKHKYFKYLYLR 76 76 A 0 0 0 191 17 VVIIVIVIIVVVIVAIVVIVVVIVIVQVIVIVVVTVVVVVAVTVVVIIVV 77 77 E 0 0 0 191 40 SKPADGNPRSDTSPPLTHPEPNDPDAETPTPAAPEDPATPAPQPPPDEES 78 78 V 0 0 0 191 40 RKRESERRRRRRRRRPEERRSASAKKRRRRREETRSREKERERRERARRE 79 79 A 0 0 0 191 31 SSAHEEESAEAEDEDQSSEKSDDSDEDESDSDESDATEDSDEDSEDDDQE 80 80 D 0 0 0 191 35 EQLDDEDEDNNNQDRQQQRDDLNQSDQNHQEQDDREEQQARARSDAEQDD 81 81 L 0 0 0 191 30 FLLLILALFAAALLLMLLLARLIRLRDAFAFLLRLLLLMLLLLFLLLLAQ 82 82 P 0 0 0 191 34 PSPTPEVPPVVVPMPNQDPVPPGLPVIIPVPSAPPPTTSMPSPPGPPPVQ 83 83 P 0 0 0 191 35 ADPEPQEEAEKKAPSAPEEEQAEPSEEPAKEDDEAPDEDPSESSEPPTPP 84 84 L 0 0 0 191 17 LLLLLLLAPLLLPLLLLLTLLLLLTLLLLLTLLLLSLLLLLLLTLTILLL 85 85 E 0 0 0 189 33 QPPEEDEGEEPEQKPPEDEENEEEEAGEAGAKEEPDPEEPPEPTDEDAEE 86 86 E 0 0 0 191 19 AEAEDDEDEEEEDPDEEDEEEEEPEEEEDPDDDEDDKDEEDEDEADDKDE 87 87 G 0 0 0 191 22 DNGNDGDGDDNGGGDDNGDDGGNEDNHGDDDGGDEDDDNGDNDDGDDDGG 88 88 R 0 0 0 188 13 EEEAEEEEEESEEREEADEEEEEEEEEEEEEEEEEECEEREAEEEEEEES 89 89 Y 0 0 0 191 3 FFYFFYYYFYFYYYFFYYFYYFFYYFYYFNYFFYYFYFFYFYFYYYFYYY 90 90 Y 0 0 0 191 6 YYYYHYFYYYFFYYYYYYYFHYYHYYYYYFYYYHYYYYFYYYYYYYYYFY 91 91 Y 0 0 0 191 37 WYWHDYIWWMIIWIHWFYHIVWFYWYYIWIWYYIHDIYFIHFHWFHDWVY 92 92 F 0 0 0 191 48 VHAHHHAAVASCAFTRHNSASSHSSYSAVVSHHLAHFHHHAHTVHAHAAH 93 93 A 0 0 0 191 13 DEDEEEDDDDDDDDDDEDDDDQEDDEDDDDDEEDDEEEEQDEDDEDQDDQ 94 94 L 0 0 0 191 11 LILILIMLLIILLLLLILLMLLILLIIILLLIILLLIIILLILLILLLMI 95 95 I 0 0 0 191 22 LIILIIIIIIIIIIIIIIIIIEIIVIIIIIIIIIIEVIIVLIIIIIEVLI 96 96 G 0 0 0 191 3 GGGGGGGGGGGGGGGGGGGGNNGGGGGGGGGGGDGGGGGGGGGGGGGGGG 97 97 L 0 0 0 191 39 LLLCLCMLCMLLLILCCSLILLCLLACSMLLLLLLLLLCCLCLLCLLLML 98 98 P 0 0 0 191 42 DTRAARKSTDKKRPSETAKETLKASETKMKDDEEESKETRPNEQEPRNKT 99 99 V 0 0 0 191 6 VVVVAVVVVVVVVVVVVVAVVVVVVVVVVVVVVVVVVVVVVVVVVAAVVV 100 100 Y 0 0 0 191 38 VIQYVLIVSYYIEYFIVYLVYYFYIVFIEVVYYFYRITIVYRFVYILIQK 101 101 V 0 0 0 190 32 NDTTTTDNNTDDNDDTT.DTHTDHNTDDNTNEENDDDDEDDTDNTTTTTT 102 102 E 0 0 0 191 29 ADEETEEQEEEEQQGTEGEEQEEQQEDEQEDGNQGTEEEEGDGEESDKED 103 103 G 0 0 0 191 11 GGGGGGGGGGNGGNGGGNNDGDNGDGDDGGGEDGGGGGGGGGGGGGGGGG 104 104 R 0 0 0 191 49 EQVQEEEEEEQKITVYEDKKEQNREKTKEEQEVETAQEERGLTVEETVER 105 105 Q 0 0 0 191 48 NKEEPEETLKLTTYENTYEPELKLCVPIQPRLLALVEVTWTVLARPAKLE 106 106 V 0 0 0 190 12 LILLVLFLLFLILLLMLIIFILLLLIILLFFILVLLLLILLLLLILVLFL 107 107 G 0 0 0 191 0 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 108 E 0 0 0 191 43 KHRKTTTKEVEERIKIEITTVKEHTKRTVTQKTVRTKKVETEKLVRTMTK 109 109 V 0 0 0 191 11 VIVIVILVVLLLVLVVIVVLVVIVVVVLVLVIIVVVVVVLVIVVIVVILI 110 110 V 0 0 0 191 43 AKDTASKDSEKTSTKDKKLKTVASKKITATAKKVKTATASKTIRRLRDAK 111 111 D 0 0 0 191 30 GEHEDDDSGDDDEEAQEDADDREAEENDDDEEEDAEDEDEAESEEAEHDE 112 112 I 0 0 0 190 17 MILIVIVLLIVVLVVIIVLVMLIILIIVLVLIIVVVVIIVVIVLIIVLVI 113 113 L 0 0 0 190 23 ILLLLLMLIMIIFLLVLLLMLMLWFLFLMIMLLILLLLLLHLQMLHVFML 114 114 D 0 0 0 191 32 DSEEHREEDEQQEKNETNDESETAESEQDKEQQPNHRSQQDTNSTNHEES 115 115 A 0 0 0 191 34 NPTTHPTTNTTTTTHTPHFTATPATPTTNTTPPAHSTPTPHPHTPFSTTP 116 116 G 0 0 0 189 2 GGGG.GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGGPGGG 117 117 A 0 0 0 183 14 AAAAAAAAAASAASASAAAA.AA.AAAAAAAAA.AAASAAAAAPAAGAAA 118 118 Q 0 0 0 191 15 HNNNQNNNHNNNNNTNNSGNNNNQHNNNHNNNNNGGNNNNGNAQNGGNNN 119 119 D 0 0 0 191 5 SDDDDDDDQDDDDDDDDDDDDDDDPDDDPDDDDDDEDDDDDDDTDDEDDD 120 120 V 0 0 0 191 9 VVVVLVVVIVVVIVLVVLLVLVVVIVVVIVVVVLILVVVVLVLVVILVVV 121 121 L 0 0 0 191 27 LWLWLWYLLYYYLYLLWLIYLLWLMWWYLYLWWLLLYWWYLWLLWILLYW 122 122 I 0 0 0 191 29 RVVEVVVVQVVEVVELVVEVEVVEKVIVREVVVKESVVVVEVEVVESVVV 123 123 I 0 0 0 191 7 VVVVVVIVVVVVVVLVVIIIVVIIVVVVIVVVVVLMVVVVVVILVIVVIV 124 124 R 0 0 0 185 34 EK.TTDRKASRTKRHKEKADQRKA.QKKTKREKKHRKKKRHKGAEA.SAQ 125 125 G 0 0 0 177 43 YQ.PTMRGCTDTATAATRPTLGATVRGTVT.RRAGARQGRGPGYRP.GSR 126 126 V 0 0 0 167 42 PN.EPPAGVESPDDTNAEKDNTEPPKE.PA.HKKQADKTPPEAEKADDPP 127 127 G 0 0 0 132 43 A.......LA..NNGAASS.TAT.SG..A..GGGGEQG.GG.GQGSV.AH 128 128 E 0 0 0 98 45 A.......PH..S.KK....LD..Q...A....KL....AL.LDQ.G..Q 129 129 R 0 0 0 90 36 D.......DT....SD....NS..D...A....KT.....K.K...E..A 130 130 L 0 0 0 86 42 K.......G......S....SI..S...D....ES.....S.S...P... 131 131 R 0 0 0 87 54 S.I.....K......F....S...I..KQ.E..P........PG..G... 132 132 D 0 0 0 121 31 GDGKDKDDA.DE...G...EED.DD..DDEG..Q.D.....R.K..S... 133 133 R 0 0 0 152 41 KGDGGKGGG.SRKG.KKKGHNQGKDK.GKGKKKP.GGKK..G.A.GP.H. 134 134 A 0 0 0 175 34 ATRKAKGQ..KKAEGVKKKGKKKREKKKAKRRRA.RKKKK.K.LKPRRG. 135 135 E 0 0 0 184 21 EEEKEQEQEEEKEETEEESEKEEQPDEEEEEDDTTEDEEDTE.EDTEEED 136 136 R 0 0 0 191 45 RLRHVLVRRVIYIQVRIVLVVRIVRAYVLVWLLVVIILHLVMVRALVRVL 137 137 L 0 0 0 191 7 LLLYYLLLLLLLLLLMLMLLLLLLMLLLLLLLLLLLLLYLLLLMLLLLLL 138 138 V 0 0 0 191 13 ILIIVLIIILIFIILVIIFVILIIILILVFILLILIIIIVLILIILVIVL 139 139 P 0 0 0 191 0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 140 140 L 0 0 0 191 25 FYFYFVAFFAAVFSFFYFFAFYYFWYYSFAFYYFFFAFYAFYFFYFFFAD 141 141 Q 0 0 0 191 19 VIVIVIIVVIVIVVTVVVVIVVIVHIVIVIVIIVTVVIIVIVTVIVVVIV 142 142 A 0 0 0 191 38 VDVVVDKDDHVKVVVIVEVRVIEVVDVEERGPPKVVVEVVVVVVVVVVRV 143 143 P 0 0 0 191 41 KQVKPDEQADKEEKPLKEPEPKDPDKKEQEQPPPPPKPKKPKPDKPPLEK 144 144 Y 0 0 0 191 48 TSMEEVDYFDECAETKTFVDVEVVVEDCFCFEVVTTKVDRTKTKDTHECK 145 145 V 0 0 0 191 4 VVVVVVVVVVVVIIVVIVIVVIVVVVIIVVVVVVVVIVIVVIVVIVVVIV 146 146 R 0 0 0 190 9 DDDDDDD.DDSDDNDDDDNDDNDDDDDDDDNDDDDSDDDSDDDDDDDDDD 147 147 V 0 0 0 191 27 QLLIVVILTTILLLLVILLILLVLLVIIQLLLILLVVKVVLILLVLLLIL 148 148 E 0 0 0 191 33 ATDDATPEAEEDADTQPEKEVETEATEEAETSEEAAPEMEAAEPTAADED 149 149 E 0 0 0 191 36 ANAEGNGEGNEENEAGTKENNTNKAANNAADNQNAEAEDDANQEEAEGQN 150 150 G 0 0 0 191 36 KKAKGKRGKRGGGHGKKKGQKGKGGQKKKGKQGGGGGKKRGKRKKGGKGG 151 151 S 0 0 0 191 43 QSLKRTLRRKKILKRQTEFKRTRERKTIKVRRRRRYLKKLRDRRKQRCMV 152 152 I 0 0 0 191 17 IVIVIVMIIMIVMIIIIIVMIMILMIIVIVIVVIIVMAIMIIIIIVILMV 153 153 H 0 0 0 191 45 TQRIVTKLVTSTRIVLTKEKERDQVIKKTTTQDEVVQYVVVVVTQIVTTE 154 154 V 0 0 0 191 14 VVVIIVIVVVVVVLAVIIVIIVIVVVIVVVVVVIAIVIIVAIAVIILVIV 155 155 D 0 0 0 191 30 DIDEDRHDDHIHDNDDENHHNDEQDETHDHDEETDDEHHSDEDDHEDDHE 156 156 P 0 0 0 191 48 WIWVPLVWWLLIWPPWVEALPWVPWIPIWIWLIPPPLLVLPPPWLLPWLL 157 157 I 0 0 0 179 46 PDIPLM..MPM PPDMIPMPDMP PMM.M MPPPPPLMPPLPQMPPDML 158 158 P 0 0 0 166 32 EPEPEA..DKK EEPEEEDVPEP EEK.D EEPEEEEEEEEEPE EPEE 159 159 G 0 0 0 126 0 G GGGGGGGGG G GGGGG GG GGGGG GGGGGGGGGGGG G G GG 160 160 L 0 0 0 126 4 L LLLLLLLLL L LLFLL LL LLLLL LLLLLLLLLLLL L L LL 161 161 F 0 0 0 96 21 I LLI ILL L LIYIL IV LLL L DDLFLIILEFLF I L I 162 162 D 0 0 0 65 8 D D DD D DE E DE DDD D DDE D D E D D D ## SEQUENCE PROFILE AND ENTROPY SeqNo PDBNo V L I M F W Y G A P S T C H R K Q E N D NOCC NDEL NINS ENTROPY RELENT WEIGHT 1 1 20 0 0 37 0 0 0 0 0 0 0 44 0 0 0 0 0 0 0 0 41 0 0 1.048 35 0.93 2 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 14 14 25 9 33 139 0 0 1.621 54 1.04 3 3 0 29 1 6 8 19 14 0 0 7 0 2 0 0 8 5 1 0 0 0 155 1 0 2.044 68 0.81 4 4 31 28 24 1 11 0 6 0 0 0 0 0 0 0 0 0 0 0 0 0 185 0 0 1.498 50 1.14 5 5 30 5 6 0 0 0 1 0 3 0 0 6 10 1 4 5 6 9 15 0 188 2 0 2.206 74 0.63 6 6 67 12 13 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.989 33 1.32 7 7 0 0 0 0 0 0 0 94 6 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.235 8 1.49 8 8 12 0 0 0 1 0 3 0 6 0 2 3 0 1 21 45 5 2 0 0 191 0 0 1.692 56 0.85 9 9 8 14 72 2 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.916 31 1.35 10 10 35 1 1 0 1 0 1 28 10 0 8 14 0 0 1 1 0 0 1 0 191 0 0 1.679 56 0.86 11 11 0 0 0 0 0 0 0 16 24 0 27 3 0 0 1 2 0 0 26 1 191 0 0 1.610 54 0.92 12 12 16 0 0 0 0 0 0 0 20 17 5 40 1 0 0 0 0 0 0 0 191 0 0 1.471 49 0.90 13 13 0 0 0 0 10 1 29 0 0 0 1 0 0 53 0 0 7 0 0 0 191 0 0 1.161 39 1.00 14 14 0 0 0 0 0 0 0 99 1 0 1 0 0 0 0 0 0 0 0 0 191 0 0 0.065 2 1.55 15 15 39 14 47 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 191 0 0 1.027 34 1.32 16 16 0 1 0 1 0 0 2 0 1 0 1 0 0 1 54 35 3 0 3 0 191 0 0 1.132 38 1.17 17 17 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.000 0 1.56 18 18 0 0 0 0 0 36 0 1 2 0 0 0 0 0 0 0 1 58 0 3 191 0 0 0.919 31 0.60 19 19 64 29 2 4 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.903 30 1.30 20 20 1 0 0 0 0 1 0 0 1 0 0 1 0 0 45 53 0 0 0 0 191 0 0 0.827 28 1.26 21 21 70 12 17 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.856 29 1.37 22 22 2 9 11 2 21 3 14 0 1 0 0 6 0 5 2 15 4 0 7 0 190 1 0 2.323 78 0.66 23 23 0 0 0 0 0 0 0 1 7 27 59 2 1 0 0 0 0 0 0 4 185 6 0 1.111 37 1.08 24 24 1 1 0 0 26 1 13 0 1 0 9 19 0 5 6 1 4 3 2 8 186 5 0 2.215 74 0.59 25 25 0 0 0 0 0 0 0 2 1 8 5 81 0 0 0 0 0 3 0 1 191 0 0 0.774 26 1.25 26 26 2 1 1 1 0 0 0 1 4 0 4 0 0 0 1 0 1 20 0 66 191 0 0 1.117 37 1.21 27 27 3 11 28 0 43 0 1 0 3 0 4 2 0 0 1 0 0 1 1 5 190 1 0 1.614 54 0.95 28 28 2 13 2 1 26 0 0 1 8 12 0 1 0 0 6 12 1 4 0 12 180 11 0 2.186 73 0.57 29 29 1 1 0 0 8 0 11 1 4 0 6 2 0 3 1 7 1 23 4 27 181 10 0 2.139 71 0.71 30 30 1 17 0 1 1 0 36 8 8 8 3 3 1 1 1 1 3 7 0 3 189 2 0 2.086 70 0.58 31 31 1 1 1 0 2 0 3 3 2 12 13 2 0 1 12 18 8 15 4 4 190 1 0 2.391 80 0.72 32 32 1 8 1 1 0 5 8 6 1 24 2 5 0 3 12 6 4 9 2 2 191 0 0 2.485 83 0.59 33 33 16 19 3 0 8 34 0 1 2 2 2 3 1 1 4 0 1 4 0 0 191 0 0 2.028 68 0.72 34 34 7 17 10 2 18 8 14 0 0 1 4 14 0 2 1 0 1 3 0 0 191 0 0 2.243 75 0.79 35 35 9 41 15 3 3 0 0 2 4 0 1 5 0 0 2 7 3 5 0 1 191 0 0 1.999 67 0.86 36 36 1 2 0 1 1 0 0 8 2 10 4 2 1 0 9 15 8 7 3 28 190 1 0 2.267 76 0.79 37 37 3 1 2 0 0 0 0 34 1 1 3 10 0 3 9 7 8 8 4 5 191 0 0 2.237 75 0.77 38 38 1 0 0 0 1 1 0 18 5 4 11 7 1 2 6 12 5 6 14 9 191 0 0 2.416 81 0.77 39 39 2 2 0 1 0 0 0 29 2 1 0 5 0 0 24 19 5 3 5 3 191 0 0 1.964 66 0.76 40 40 2 2 1 0 1 13 1 0 3 12 6 5 0 0 4 6 6 39 1 0 190 1 0 2.039 68 0.67 41 41 14 36 6 2 11 0 9 0 2 1 0 1 0 2 8 3 7 0 0 0 191 0 0 2.025 68 0.83 42 42 6 0 2 0 0 0 0 1 3 2 4 23 0 2 5 13 10 28 0 2 191 0 0 2.066 69 0.78 43 43 51 15 31 1 2 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 191 0 0 1.108 37 1.30 44 44 5 3 2 0 0 0 0 0 16 0 5 9 1 1 5 6 4 36 2 5 191 0 0 2.099 70 0.79 45 45 0 6 3 0 0 0 0 12 4 0 31 6 0 1 7 3 13 5 4 5 191 0 0 2.229 74 0.73 46 46 17 2 1 0 2 20 4 14 16 0 3 6 0 15 1 0 0 0 0 0 191 0 0 2.101 70 0.57 47 47 0 1 1 0 1 2 1 2 1 0 0 0 0 0 65 26 3 0 0 0 191 0 0 1.033 34 1.20 48 48 8 4 2 1 14 2 5 1 5 9 2 5 0 4 15 8 6 7 1 2 191 0 0 2.646 88 0.57 49 49 2 1 3 0 12 0 0 2 5 0 1 1 0 58 1 0 15 0 1 0 191 0 0 1.461 49 0.90 50 50 1 0 0 0 0 0 0 19 2 2 6 2 0 0 0 54 1 0 13 0 191 0 0 1.386 46 0.92 51 51 0 0 0 0 0 0 0 13 1 0 2 4 0 2 2 21 20 1 29 5 191 0 0 1.856 62 0.88 52 52 7 8 1 5 28 0 2 25 3 0 4 2 0 3 2 1 1 1 1 6 190 1 0 2.184 73 0.60 53 53 21 31 10 1 7 4 7 0 1 0 0 0 0 4 0 0 0 1 1 13 191 0 0 1.966 66 0.81 54 54 31 23 36 3 0 0 0 1 4 0 1 2 0 0 0 0 0 0 0 0 191 0 0 1.458 49 1.16 55 55 26 29 8 1 0 0 0 1 30 0 0 3 3 0 0 0 0 0 0 0 191 0 0 1.536 51 0.90 56 56 0 1 0 0 0 1 0 1 3 0 7 12 1 3 14 49 8 1 0 0 191 0 0 1.653 55 0.93 57 57 3 43 6 0 47 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 191 0 0 1.035 35 1.34 58 58 6 0 0 1 0 0 0 2 12 0 4 3 0 1 3 35 3 29 0 4 191 0 0 1.825 61 0.84 59 59 0 0 0 0 0 0 0 83 0 0 1 1 0 1 0 0 2 8 1 4 191 0 0 0.701 23 1.34 60 60 32 7 31 3 6 1 15 0 0 0 0 0 2 2 1 0 0 0 0 0 191 0 0 1.688 56 1.01 61 61 0 0 0 0 0 0 1 1 7 7 3 9 0 2 1 1 3 10 9 46 191 0 0 1.852 62 0.95 62 62 3 0 1 0 0 0 0 4 1 0 10 13 0 2 1 0 1 0 23 43 191 0 0 1.644 55 0.95 63 63 2 3 35 2 0 0 0 0 0 0 0 0 1 0 52 6 1 0 0 0 191 0 0 1.167 39 0.84 64 64 0 0 0 0 0 0 0 1 0 0 3 6 0 0 0 0 1 23 43 25 191 0 0 1.358 45 1.08 65 65 4 5 1 1 0 0 0 1 22 0 1 1 0 0 1 1 16 17 0 30 191 0 0 1.849 62 0.88 66 66 24 0 10 0 0 0 0 0 65 0 1 0 0 0 0 0 0 0 0 0 191 0 0 0.887 30 1.07 67 67 2 2 1 0 2 0 0 0 3 0 1 1 1 1 5 2 10 62 3 6 191 0 0 1.512 50 1.05 68 68 0 7 1 2 1 0 1 2 27 6 7 4 1 3 6 19 7 5 2 1 191 0 0 2.339 78 0.70 69 69 1 49 3 4 11 4 25 0 1 0 0 0 1 1 1 1 0 0 0 0 191 0 0 1.527 51 1.10 70 70 7 0 3 0 0 0 0 1 5 0 1 13 4 0 23 38 0 0 6 0 191 0 0 1.781 59 0.81 71 71 0 0 0 0 0 0 0 66 0 1 1 0 0 1 2 2 2 3 19 5 191 0 0 1.141 38 1.14 72 72 6 10 3 4 5 3 3 9 17 0 6 6 14 2 4 7 1 1 0 1 191 0 0 2.600 87 0.60 73 73 2 5 5 3 0 1 3 1 2 3 6 6 0 1 7 3 5 35 0 14 191 0 0 2.293 77 0.73 74 74 10 52 37 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.972 32 1.27 75 75 4 15 1 2 7 2 18 3 13 0 4 1 5 2 3 16 3 1 1 0 191 0 0 2.452 82 0.58 76 76 57 2 30 2 0 0 0 0 5 0 0 2 0 0 0 0 3 0 0 0 191 0 0 1.128 38 1.24 77 77 0 3 0 0 0 0 1 1 7 30 12 9 1 4 2 3 1 9 4 16 191 0 0 2.168 72 0.79 78 78 2 1 1 0 0 0 0 0 17 2 9 3 0 0 42 7 1 15 0 1 191 0 0 1.753 59 0.78 79 79 0 0 0 0 0 0 0 1 11 0 19 3 0 1 1 3 3 26 2 30 191 0 0 1.770 59 0.96 80 80 2 3 0 1 1 0 1 0 8 0 2 0 0 2 6 3 34 15 6 18 191 0 0 2.022 67 0.89 81 81 1 66 1 2 4 0 0 1 13 0 0 0 0 0 7 0 3 0 0 2 191 0 0 1.231 41 1.00 82 82 14 1 4 2 0 0 0 2 2 57 5 3 0 2 1 0 5 3 1 2 191 0 0 1.658 55 0.92 83 83 1 1 0 0 0 0 0 0 14 15 7 2 0 0 1 4 5 39 2 10 191 0 0 1.892 63 0.89 84 84 0 85 1 0 0 0 0 0 1 6 1 6 0 0 0 0 0 0 0 0 191 0 0 0.586 20 1.24 85 85 0 0 0 0 0 0 0 7 12 20 4 1 0 0 1 3 1 32 1 19 189 2 0 1.842 61 0.92 86 86 0 0 0 0 0 0 0 2 4 4 1 2 0 0 0 4 1 58 1 26 191 0 0 1.275 43 1.19 87 87 0 0 0 0 0 0 0 40 0 0 0 0 0 3 0 0 0 3 13 41 191 0 0 1.196 40 1.14 88 88 0 0 0 0 0 0 0 1 3 0 3 1 1 1 2 0 1 80 1 9 188 3 0 0.846 28 1.32 89 89 0 0 1 0 45 0 54 0 0 0 0 0 0 0 0 0 0 0 1 0 191 0 0 0.747 25 1.50 90 90 0 0 0 0 9 0 85 0 0 0 0 0 0 5 0 0 0 0 0 0 191 0 0 0.512 17 1.46 91 91 3 2 14 1 8 40 18 0 0 0 0 1 0 12 0 0 1 0 0 2 191 0 0 1.736 58 0.85 92 92 4 2 0 1 4 0 4 1 18 0 12 4 2 28 13 7 0 0 1 1 191 0 0 2.168 72 0.64 93 93 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 15 23 0 62 191 0 0 0.939 31 1.30 94 94 0 71 27 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.675 23 1.35 95 95 10 5 66 4 1 0 1 0 0 0 0 1 0 0 0 0 1 10 1 0 191 0 0 1.236 41 1.14 96 96 0 0 0 0 0 0 0 96 0 0 0 0 0 0 0 0 1 1 2 1 191 0 0 0.204 7 1.51 97 97 0 52 1 16 0 0 0 0 2 0 2 0 28 0 0 0 0 0 0 0 191 0 0 1.167 39 0.83 98 98 1 1 0 1 0 0 0 0 10 3 9 17 0 1 11 13 8 17 2 6 191 0 0 2.256 75 0.76 99 99 94 0 0 0 0 0 0 0 6 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.235 8 1.45 100 100 31 4 16 1 13 0 16 0 0 0 2 7 0 1 2 3 1 3 1 0 191 0 0 2.016 67 0.82 101 101 1 2 0 1 0 0 0 0 0 0 1 45 0 2 0 0 0 4 17 28 190 1 0 1.409 47 0.94 102 102 0 0 0 0 0 0 0 9 5 0 2 5 0 0 0 4 18 41 5 12 191 0 0 1.781 59 1.01 103 103 0 0 0 0 0 0 0 82 2 0 1 0 0 0 0 0 2 4 4 6 191 0 0 0.753 25 1.34 104 104 9 1 1 0 0 0 19 3 5 0 2 8 1 0 5 5 7 29 1 5 191 0 0 2.190 73 0.62 105 105 3 15 1 1 1 1 2 1 6 8 4 6 3 4 3 4 3 19 4 13 191 0 0 2.580 86 0.63 106 106 8 63 12 5 11 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 190 0 0 1.172 39 1.32 107 107 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.000 0 1.56 108 108 16 1 5 1 1 1 0 0 1 0 1 25 0 2 10 25 4 9 0 0 191 0 0 1.985 66 0.74 109 109 66 14 19 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.890 30 1.36 110 110 9 2 4 1 0 0 0 0 7 0 10 19 0 2 4 27 1 4 2 9 191 0 0 2.195 73 0.73 111 111 0 0 0 1 0 0 2 3 10 0 4 1 0 8 1 1 4 30 3 32 191 0 0 1.858 62 0.98 112 112 31 23 36 11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 190 0 0 1.303 44 1.23 113 113 3 39 11 25 12 1 1 0 0 0 0 0 0 4 0 0 4 1 0 0 190 0 0 1.675 56 1.12 114 114 0 0 0 0 0 0 0 0 3 3 9 7 0 2 2 2 7 47 9 7 191 0 0 1.819 61 0.95 115 115 0 0 0 0 6 0 1 0 5 18 3 58 0 7 0 0 0 0 2 0 191 0 0 1.343 45 0.92 116 116 1 0 0 0 0 0 0 97 2 1 0 0 0 0 0 0 0 0 0 0 189 2 0 0.147 5 1.52 117 117 0 0 0 0 0 0 0 1 79 1 20 0 0 0 0 0 0 0 0 0 183 8 0 0.561 19 1.29 118 118 0 0 0 0 0 0 0 10 1 0 2 1 0 3 0 0 3 0 81 0 191 0 0 0.763 25 1.27 119 119 0 0 0 0 0 0 0 0 0 2 1 1 0 0 0 0 1 3 1 93 191 0 0 0.375 13 1.47 120 120 78 15 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.663 22 1.39 121 121 1 47 4 7 1 24 16 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 1.405 47 1.05 122 122 66 4 4 1 0 0 0 0 1 0 1 1 1 1 1 1 2 19 0 0 191 0 0 1.197 40 1.00 123 123 73 3 23 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.702 23 1.42 124 124 1 0 1 0 1 0 0 1 6 0 3 5 0 4 15 44 9 9 0 3 185 6 0 1.834 61 0.91 125 125 1 3 1 1 0 0 1 18 27 12 4 11 1 0 15 1 1 0 0 3 177 14 0 2.100 70 0.74 126 126 1 1 0 0 0 0 0 1 8 23 2 3 6 3 1 8 2 8 21 13 167 24 0 2.235 75 0.75 127 127 2 12 1 0 0 0 0 24 19 2 11 6 0 2 2 1 5 5 5 2 132 59 0 2.258 75 0.75 128 128 0 9 0 1 0 0 0 17 5 3 3 4 0 1 4 28 9 4 9 2 98 93 0 2.247 75 0.70 129 129 2 0 0 0 1 0 0 0 6 4 23 3 0 0 4 3 1 3 1 47 90 101 0 1.707 57 0.85 130 130 2 12 6 3 0 0 0 5 40 3 15 3 0 0 1 2 1 3 0 2 86 105 0 2.045 68 0.76 131 131 2 1 5 1 41 0 1 3 2 3 3 5 0 0 2 15 1 2 0 10 87 104 0 2.068 69 0.57 132 132 1 0 0 0 0 0 0 35 2 0 3 1 0 0 5 8 2 8 1 34 121 70 0 1.686 56 0.97 133 133 1 0 3 1 0 0 1 32 3 3 1 0 0 5 5 31 10 1 1 2 152 39 0 1.932 64 0.77 134 134 1 1 0 0 0 0 0 10 5 2 3 2 0 0 22 43 6 4 1 0 175 16 0 1.746 58 0.91 135 135 0 1 0 0 0 0 0 0 0 2 4 9 0 1 0 2 2 66 0 14 184 7 0 1.178 39 1.16 136 136 24 17 6 2 3 1 5 0 5 0 0 1 0 3 36 0 1 0 0 0 191 0 0 1.798 60 0.69 137 137 0 87 0 5 0 1 6 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.493 16 1.43 138 138 10 30 58 1 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.999 33 1.30 139 139 0 0 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 191 0 0 0.000 0 1.56 140 140 3 1 0 0 47 1 32 0 14 0 1 0 0 0 0 0 0 0 1 1 191 0 0 1.291 43 1.08 141 141 51 5 31 0 0 0 0 0 1 0 1 10 0 1 0 0 1 0 0 0 191 0 0 1.196 40 1.20 142 142 47 0 12 0 0 0 0 2 3 5 0 1 0 2 4 7 0 5 0 14 191 0 0 1.752 58 0.83 143 143 2 6 1 0 0 0 0 0 2 20 1 1 0 1 1 26 9 13 1 16 191 0 0 2.035 68 0.77 144 144 17 0 1 1 4 0 2 1 1 0 5 12 8 2 2 8 7 19 4 10 191 0 0 2.398 80 0.64 145 145 82 0 18 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 191 0 0 0.476 16 1.47 146 146 0 0 0 0 0 0 0 0 0 0 3 0 0 0 1 1 1 0 9 86 190 1 0 0.560 19 1.38 147 147 16 52 16 1 1 0 0 0 1 2 0 3 0 1 4 3 1 0 1 0 191 0 0 1.552 52 1.05 148 148 1 1 0 1 0 0 0 0 21 2 4 12 0 1 0 4 3 38 1 13 191 0 0 1.803 60 0.92 149 149 0 0 0 0 0 0 0 9 30 0 5 6 0 0 1 7 7 15 17 4 191 0 0 2.012 67 0.86 150 150 0 0 0 0 0 0 0 37 1 0 1 0 0 1 12 37 8 1 4 0 191 0 0 1.444 48 0.86 151 151 5 6 4 1 2 0 1 0 0 0 3 13 1 1 34 14 8 7 0 1 191 0 0 2.103 70 0.73 152 152 20 3 51 25 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 191 0 0 1.147 38 1.23 153 153 20 6 10 1 0 0 1 0 0 0 1 21 2 2 5 6 7 17 0 2 191 0 0 2.165 72 0.70 154 154 63 2 28 0 0 0 0 0 7 0 0 0 1 0 0 0 0 0 0 0 191 0 0 0.932 31 1.29 155 155 0 0 1 0 0 0 0 0 1 0 1 8 1 20 2 1 1 12 4 48 191 0 0 1.587 53 0.99 156 156 7 21 7 1 0 40 0 0 1 24 0 0 0 0 0 0 0 1 0 0 191 0 0 1.486 50 0.65 157 157 1 12 3 22 0 0 0 0 0 28 0 0 0 0 0 0 1 1 0 32 179 3 0 1.533 51 0.68 158 158 1 1 0 0 0 0 0 0 3 40 0 0 0 0 0 4 0 45 1 6 166 3 0 1.212 40 0.95 159 159 0 0 0 0 0 0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 126 0 0 0.000 0 1.56 160 160 0 81 1 2 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 126 0 0 0.574 19 1.48 161 161 4 57 20 2 8 0 1 0 0 0 0 0 0 0 2 0 0 1 0 4 96 0 0 1.368 46 1.15 162 162 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 28 0 72 65 0 0 0.590 20 1.41 // profisis-1.0.11/examples/3A1P_A.profisis0000644015075101507510000000343712012424753014676 00000000000000>3A1P:A|PDBID|CHAIN|SEQUENCE: strech=5 crowd_predictions=7 gap=20 itr=0 MRLVEIGRFGAPYALKGGLRFRGEPVVLHLERVYVEGHGW ----P-------P---------------PPPP----P--- RAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVYAEVAD ---PP------P---------------------------- LPPLEEGRYYYFALIGLPVYVEGRQVGEVVDILDAGAQDV -----------------------P---------------- LIIRGVGERLRDRAERLVPLQAPYVRVEEGSIHVDPIPGL -------PPPPPP--------------P--------P--- FD -- 1 M 17 2 R 20 3 L 8 4 V -67 5 E 30 6 I -66 7 G -69 8 R 0 9 F -46 10 G -7 11 A 5 12 P 4 13 Y 32 14 A 4 15 L -25 16 K 12 17 G -36 18 G -12 19 L -63 20 R -7 21 F -76 22 R 1 23 G -11 24 E 19 25 P -12 26 V 10 27 V -37 28 L 16 29 H 30 30 L 35 31 E 41 32 R 38 33 V 4 34 Y -23 35 V 8 36 E 16 37 G 32 38 H 8 39 G 4 40 W -1 41 R -11 42 A -24 43 I -64 44 E 27 45 D 30 46 L -38 47 Y 15 48 R 11 49 V 9 50 G 5 51 E 12 52 E 30 53 L -57 54 V -68 55 V -81 56 H -20 57 L -79 58 A -30 59 G -23 60 V -39 61 T -2 62 D -5 63 R 16 64 T -14 65 L -9 66 A -56 67 E 6 68 A -10 69 L -55 70 V -12 71 G -8 72 L 3 73 R 15 74 V -68 75 Y 14 76 A -56 77 E -11 78 V -4 79 A -13 80 D 3 81 L -13 82 P -21 83 P -10 84 L -17 85 E -2 86 E 1 87 G -4 88 R -4 89 Y -68 90 Y -26 91 Y -82 92 F -41 93 A -15 94 L -66 95 I -48 96 G -37 97 L -65 98 P -35 99 V -76 100 Y 6 101 V -6 102 E 9 103 G 20 104 R 38 105 Q 13 106 V -26 107 G -62 108 E 1 109 V -65 110 V -18 111 D -15 112 I -68 113 L -46 114 D -8 115 A -12 116 G -21 117 A -25 118 Q -13 119 D -7 120 V -50 121 L -83 122 I -49 123 I -74 124 R -19 125 G -37 126 V -16 127 G 15 128 E 34 129 R 44 130 L 55 131 R 50 132 D 47 133 R 22 134 A 2 135 E -6 136 R -15 137 L -78 138 V -63 139 P -65 140 L -68 141 Q -56 142 A -21 143 P 10 144 Y -3 145 V -57 146 R -18 147 V -13 148 E 21 149 E 15 150 G -7 151 S -13 152 I -79 153 H 11 154 V -77 155 D 19 156 P -2 157 I 23 158 P 12 159 G -11 160 L -45 161 F 12 162 D 15 profisis-1.0.11/examples/3A1P_A.rdbProf0000644015075101507510000004070412012424753014434 00000000000000# Perl-RDB # PROFboth # # Copyright : Burkhard Rost, CUBIC NYC / LION Heidelberg # Email : rost@columbia.edu # WWW : http://cubic.bioc.columbia.edu # Version : 2000.02 # # -------------------------------------------------------------------------------- # About your protein : # # VALUE PROT_ID : query # VALUE PROT_NCHN : 1 # VALUE PROT_NRES : 162 # VALUE PROT_NALI : 190 # VALUE PROT_NFAR : 190 # VALUE PROT_NFAR50-5: 71 # VALUE PROT_NFAR40-5: 71 # VALUE PROT_NFAR30-5: 71 # VALUE PROT_NFAR5-5: 0 # # -------------------------------------------------------------------------------- # About the alignment: # # VALUE ALI_ORIG : 3A1P_A.hssp # # -------------------------------------------------------------------------------- # About PROF specifics: # # VALUE PROF_FPAR : acc=/usr/share/profphd/prof/net/PROFboth_best.par # VALUE PROF_NNET : acc=6 # # -------------------------------------------------------------------------------- # Notation used : # # ------------------------------------------------------------------------ # NOTATION HEADER : PROTEIN # NOTATION PROT_ID : identifier of protein [w] # NOTATION PROT_NRES : number of residues [d] # NOTATION PROT_NCHN : number of chains (if PDB protein) [d] # NOTATION PROT_NALI : number of proteins aligned in family [d] # NOTATION PROT_NFAR : number of distant relatives [d] # # ------------------------------------------------------------------------ # NOTATION HEADER : ALIGNMENT # NOTATION HEADER : ALIGNMENT: input file # # ------------------------------------------------------------------------ # NOTATION HEADER : INTERNAL # NOTATION PROF_FPAR : name of parameter file, used [w] # NOTATION PROF_NNET : number of networks used for prediction [d] # # # ------------------------------------------------------------------------ # NOTATION BODY : PROTEIN # NOTATION NO : counting residues [d] # NOTATION AA : amino acid one letter code [A-Z!a-z] # NOTATION CHN : protein chain [A-Z!a-z] # # ------------------------------------------------------------------------ # NOTATION BODY : PROF # # ------------------------------------------------------------------------ # NOTATION BODY : PROFsec # NOTATION OHEL : observed secondary structure: H=helix, E=extended (sheet), blank=other (loop) # NOTATION PHEL : PROF predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PROF = PROF: Profile network prediction HeiDelberg # NOTATION RI_S : reliability index for PROFsec prediction (0=lo 9=high) Note: for the brief presentation strong predictions marked by '*' # NOTATION pH : 'probability' for assigning helix (1=high, 0=low) # NOTATION pE : 'probability' for assigning strand (1=high, 0=low) # NOTATION pL : 'probability' for assigning neither helix, nor strand (1=high, 0=low) # NOTATION OtH : actual neural network output from PROFsec for helix unit # NOTATION OtE : actual neural network output from PROFsec for strand unit # NOTATION OtL : actual neural network output from PROFsec for 'no-regular' unit # # ------------------------------------------------------------------------ # NOTATION BODY : PROFacc # NOTATION OACC : observed solvent accessibility (acc) in square Angstroem (taken from DSSP: W Kabsch and C Sander, Biopolymers, 22, 2577-2637, 1983) # NOTATION PACC : PROF predicted solvent accessibility (acc) in square Angstroem # NOTATION OREL : observed relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). # NOTATION PREL : PROF predicted relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). # NOTATION RI_A : reliability index for PROFacc prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' # NOTATION Obe : observerd relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. # NOTATION Pbe : PROF predicted relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. # NOTATION Obie : observerd relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. # NOTATION Pbie : PROF predicted relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. # NOTATION Ot4 : actual neural network output from PROFsec for unit 0 coding for a relative solvent accessibility of 4*4 - 5*5 percent (16-25%). Note: OtN, with N=0-9 give the same information for the other output units! # # -------------------------------------------------------------------------------- # No AA OHEL PHEL RI_S OACC PACC OREL PREL RI_A pH pE pL Obe Pbe Obie Pbie OtH OtE OtL Ot0 Ot1 Ot2 Ot3 Ot4 Ot5 Ot6 Ot7 Ot8 Ot9 1 M L L 9 0 169 0 90 4 0 0 9 b e b e 0 2 97 3 3 4 6 9 13 18 22 30 32 2 R L L 2 0 104 0 42 3 0 3 6 b e b e 3 38 63 2 3 5 9 16 22 27 26 21 17 3 L L E 4 0 49 0 30 3 0 6 2 b e b i 3 70 30 10 11 13 19 22 23 21 17 12 8 4 V L E 6 0 0 0 0 3 0 8 1 b b b b 2 80 16 32 29 23 19 16 12 7 5 3 2 5 E L E 7 0 58 0 30 3 0 8 1 b e b i 2 84 12 10 11 13 18 23 25 23 18 11 7 6 I L E 7 0 0 0 0 5 0 8 1 b b b b 3 84 10 34 29 19 15 13 12 9 6 4 3 7 G L E 6 0 0 0 0 4 0 8 1 b b b b 2 80 18 31 26 20 17 16 14 11 8 5 4 8 R L E 7 0 74 0 30 3 0 8 1 b e b i 3 86 12 8 10 12 18 22 26 25 20 13 8 9 F L E 5 0 0 0 0 3 0 7 1 b b b b 3 79 20 30 27 23 20 17 13 9 6 5 4 10 G L E 4 0 35 0 42 2 0 6 2 b e b e 3 70 30 11 11 12 16 20 23 24 20 15 11 11 A L L 0 0 0 0 0 0 0 4 4 b b b b 10 44 50 22 22 21 21 20 19 17 15 13 11 12 P L L 4 0 76 0 56 2 0 2 6 b e b e 10 26 67 8 8 9 13 16 20 23 24 23 21 13 Y L L 4 0 66 0 30 0 1 2 6 b e b i 14 23 71 12 13 15 18 20 22 22 21 20 18 14 A L L 4 0 31 0 30 0 0 2 6 b e b i 8 26 72 17 16 16 18 20 21 21 20 18 16 15 L L L 1 0 0 0 0 2 0 4 5 b b b b 4 43 57 29 27 24 22 18 14 10 8 6 5 16 K L E 2 0 86 0 42 3 0 5 3 b e b e 4 60 39 4 6 9 16 21 26 27 23 16 11 17 G L E 5 0 0 0 0 4 0 7 2 b b b b 3 74 24 33 28 20 17 15 13 10 8 5 4 18 G L E 6 0 25 0 30 3 0 8 1 b e b i 3 83 14 8 10 14 21 25 27 23 17 10 6 19 L L E 8 0 0 0 0 6 0 9 0 b b b b 2 90 8 38 31 21 16 13 10 7 4 2 1 20 R L E 8 0 74 0 30 5 0 8 0 b e b i 3 90 8 6 8 12 20 26 29 25 17 9 4 21 F L E 7 0 0 0 0 7 0 8 1 b b b b 2 88 12 38 31 20 14 12 10 7 5 3 3 22 R L E 5 0 74 0 30 4 0 7 2 b e b i 3 76 24 7 8 12 19 25 28 25 18 10 6 23 G L E 2 0 35 0 42 1 0 6 3 b e b e 7 63 34 15 15 15 17 18 20 21 20 17 15 24 E L L 0 0 58 0 30 2 1 4 4 b e b i 14 44 49 7 8 12 17 21 24 23 20 17 14 25 P L L 2 0 76 0 56 1 1 2 5 b e b e 19 31 58 12 12 13 16 18 20 21 22 21 20 26 V L L 4 0 59 0 42 0 2 2 5 b e b e 22 23 63 10 10 12 15 18 21 22 22 21 19 27 V L L 3 0 0 0 0 0 2 2 5 b b b b 28 23 58 21 21 21 21 19 18 15 13 12 11 28 L L L 2 0 68 0 42 0 2 2 5 b e b e 28 24 54 8 8 9 13 17 20 23 23 22 20 29 H L L 2 0 103 0 56 2 2 2 4 b e b e 28 29 52 9 9 11 14 17 21 23 24 23 22 30 L L L 2 0 49 0 30 0 2 2 5 b e b i 26 28 54 11 11 13 16 18 20 20 19 18 17 31 E L L 3 0 108 0 56 3 1 2 5 b e b e 18 26 59 5 5 7 11 15 20 24 26 24 22 32 R L E 1 0 104 0 42 1 1 4 3 b e b e 15 49 39 9 10 12 16 18 21 23 22 20 17 33 V L E 4 0 28 0 20 1 1 6 2 b e b i 14 67 24 16 17 18 21 22 22 19 15 11 8 34 Y L E 5 0 0 0 0 0 1 6 2 b b b b 11 71 21 22 21 20 20 19 18 15 12 9 8 35 V L E 3 0 28 0 20 0 0 6 2 b e b i 9 66 28 18 18 18 20 21 21 17 13 10 8 36 E L L 1 0 139 0 72 2 0 4 5 b e b e 8 42 54 5 6 8 11 14 17 21 23 26 26 37 G L L 6 0 75 0 90 3 0 1 7 b e b e 7 16 80 4 4 6 9 12 17 21 26 30 31 38 H L L 7 0 165 0 90 3 0 1 8 b e b e 3 10 87 3 4 5 8 11 16 22 27 31 32 39 G L L 3 0 35 0 42 2 0 3 6 b e b e 2 31 70 5 6 9 13 17 22 26 25 22 19 40 W L E 3 0 95 0 42 1 0 6 2 b e b e 4 68 30 9 10 11 15 18 22 24 24 21 18 41 R L E 7 0 49 0 20 1 0 8 1 b e b i 2 85 15 17 17 18 21 22 21 17 13 8 6 42 A L E 8 0 31 0 30 2 0 8 0 b e b i 2 90 10 9 10 12 17 21 23 23 19 14 10 43 I L E 8 0 0 0 0 3 0 8 0 b b b b 2 89 9 30 27 22 20 17 14 9 6 3 2 44 E L E 6 0 81 0 42 2 0 8 1 b e b e 5 82 13 8 9 12 16 20 24 25 22 17 13 45 D L E 6 0 68 0 42 2 0 7 1 b e b e 4 81 17 10 11 13 17 19 23 24 22 17 13 46 L L E 5 0 19 0 12 0 0 7 2 b b b i 8 73 21 18 18 18 20 20 20 17 14 11 10 47 Y L E 3 0 66 0 30 2 1 6 2 b e b i 15 62 24 12 13 16 20 24 25 24 20 15 12 48 R L E 0 0 138 0 56 3 1 4 3 b e b e 18 46 38 6 7 9 13 16 21 24 26 24 21 49 V L L 2 0 28 0 20 1 1 3 5 b e b i 18 33 53 14 16 19 21 22 22 18 15 12 11 50 G L L 4 0 60 0 72 3 1 2 6 b e b e 12 22 69 3 4 5 8 12 18 24 27 29 29 51 E L L 4 0 174 0 90 1 0 2 6 b e b e 7 27 67 5 5 7 10 14 19 22 25 26 27 52 E L E 0 0 58 0 30 1 0 5 4 b e b i 4 53 47 11 11 13 16 19 21 21 20 16 14 53 L L E 7 0 0 0 0 1 0 8 1 b b b b 2 85 15 26 25 22 20 18 15 11 7 4 3 54 V L E 8 0 0 0 0 3 0 9 0 b b b b 2 91 6 31 27 20 18 16 13 10 7 4 2 55 V L E 8 0 0 0 0 6 0 9 0 b b b b 2 90 6 37 30 19 15 12 10 7 5 2 1 56 H L E 7 0 55 0 30 2 0 8 0 b e b i 4 86 8 14 14 15 19 22 24 21 16 10 7 57 L L E 6 0 0 0 0 4 0 7 1 b b b b 4 78 18 33 29 23 19 16 13 9 6 4 3 58 A L E 2 0 44 0 42 2 0 5 3 b e b e 6 59 37 9 10 12 16 20 24 25 23 19 16 59 G L L 0 0 47 0 56 1 0 4 4 b e b e 7 47 52 11 11 12 14 16 19 20 21 20 19 60 V L L 2 0 17 0 12 1 0 3 5 b b b i 9 37 61 18 19 20 22 22 20 16 14 12 11 61 T L L 5 0 59 0 42 0 0 2 7 b e b e 9 21 72 8 8 9 13 17 21 24 24 23 21 62 D L L 4 0 68 0 42 3 2 0 6 b e b e 27 7 69 7 7 9 13 18 23 25 23 18 14 63 R L H 3 0 104 0 42 1 6 0 3 b e b e 68 6 32 9 10 13 17 20 22 23 21 18 16 64 T L H 6 0 79 0 56 4 7 0 1 b e b e 81 5 19 4 5 6 9 13 18 24 28 27 25 65 L L H 7 0 32 0 20 1 8 0 1 b e b i 87 4 11 15 15 17 20 23 23 22 18 12 8 66 A L H 7 0 0 0 0 4 8 0 1 b b b b 85 5 13 33 28 19 17 14 11 9 7 5 4 67 E L H 6 0 108 0 56 3 7 0 1 b e b e 81 7 14 5 6 7 11 15 19 24 25 23 20 68 A L H 4 0 76 0 72 3 6 0 2 b e b e 73 7 25 5 5 7 9 12 16 21 26 27 26 69 L L H 1 0 0 0 0 0 5 1 3 b b b b 54 12 39 23 23 22 21 20 16 13 10 8 7 70 V L L 2 0 59 0 42 2 3 1 5 b e b e 33 14 61 9 10 12 16 19 22 24 22 19 17 71 G L L 6 0 75 0 90 3 1 0 7 b e b e 13 9 81 5 5 6 8 11 14 19 25 28 30 72 L L L 4 0 19 0 12 1 0 2 7 b b b i 7 24 73 13 15 19 22 22 21 18 14 11 9 73 R L E 3 0 138 0 56 3 0 6 3 b e b e 5 65 35 6 7 9 12 16 21 25 26 23 20 74 V L E 5 0 0 0 0 2 0 7 2 b b b b 3 80 22 30 29 26 22 18 12 8 4 3 2 75 Y L E 6 0 66 0 30 2 0 7 1 b e b i 3 82 21 12 12 14 18 21 23 22 19 15 11 76 A L E 5 0 0 0 0 3 0 7 2 b b b b 3 79 28 30 27 23 20 17 14 10 7 4 3 77 E L L 0 0 108 0 56 2 0 4 4 b e b e 6 48 51 8 9 10 13 17 21 23 24 21 18 78 V L L 3 0 42 0 30 1 2 2 5 b e b i 26 23 57 12 13 15 19 21 22 21 19 18 16 79 A L L 2 0 76 0 72 2 2 2 5 b e b e 30 22 57 7 7 8 11 14 18 21 24 27 27 80 D L L 3 0 117 0 72 2 2 1 5 b e b e 24 21 63 3 4 6 9 12 18 23 26 27 26 81 L L L 5 0 19 0 12 1 1 1 7 b b b i 15 14 74 19 21 23 24 22 18 14 11 9 9 82 P L L 7 0 57 0 42 0 1 0 7 b e b e 12 10 82 9 9 11 15 18 20 22 22 22 21 83 P L L 6 0 122 0 90 3 1 1 7 b e b e 11 12 81 4 5 6 9 11 15 20 25 30 31 84 L L L 6 0 19 0 12 1 1 1 7 b b b i 12 11 81 19 21 22 23 21 18 13 10 8 8 85 E L L 7 0 139 0 72 3 0 0 8 b e b e 8 8 86 3 4 5 8 12 17 22 26 30 30 86 E L L 6 0 174 0 90 3 1 0 7 b e b e 18 7 79 4 5 6 9 12 16 20 24 29 30 87 G L L 5 0 60 0 72 1 1 1 7 b e b e 18 12 73 9 9 10 13 15 18 20 22 24 24 88 R L L 1 0 74 0 30 1 1 3 4 b e b i 21 35 50 12 13 15 18 20 22 22 20 17 14 89 Y L E 1 0 0 0 0 1 1 4 3 b b b b 20 51 33 27 27 25 23 20 16 12 8 6 4 90 Y L E 3 0 4 0 2 1 1 5 2 b b b b 16 57 27 25 26 26 25 22 18 12 7 3 2 91 Y L E 3 0 0 0 0 1 2 5 1 b b b b 26 62 20 27 26 22 21 19 17 13 9 6 5 92 F L E 2 0 0 0 0 1 2 5 1 b b b b 32 60 19 27 25 22 22 20 17 13 9 6 5 93 A L E 2 0 0 0 0 1 2 5 1 b b b b 31 58 22 25 24 22 21 20 18 15 12 9 8 94 L L E 2 0 0 0 0 3 2 4 2 b b b b 32 55 27 32 29 23 20 16 13 9 6 4 3 95 I L E 3 0 0 0 0 1 1 5 2 b b b b 20 63 24 27 25 21 21 19 18 16 13 11 9 96 G L E 2 0 0 0 0 2 1 5 3 b b b b 11 57 36 26 23 20 19 18 17 16 14 12 10 97 L L E 3 0 0 0 0 1 1 5 2 b b b b 13 62 30 27 25 22 21 18 16 12 9 7 5 98 P L E 6 0 57 0 42 2 0 7 1 b e b e 7 80 16 10 11 12 16 19 22 23 21 16 13 99 V L E 6 0 0 0 0 4 0 7 1 b b b b 7 82 14 33 28 21 17 15 14 11 9 6 5 100 Y L E 5 0 44 0 20 1 0 7 1 b e b i 5 77 18 17 17 18 21 23 23 20 15 10 7 101 V L E 2 0 42 0 30 1 0 5 3 b e b i 5 62 37 17 17 17 19 20 22 20 18 14 12 102 E L L 4 0 108 0 56 2 1 2 6 b e b e 11 24 68 6 6 8 12 15 20 22 24 24 23 103 G L L 6 0 75 0 90 1 1 1 7 b e b e 14 11 79 11 11 11 14 16 18 19 21 24 25 104 R L L 3 0 104 0 42 0 2 1 5 b e b e 24 20 58 6 7 9 13 18 22 24 24 23 21 105 Q L L 1 0 110 0 56 2 2 3 4 b e b e 25 34 46 7 8 9 12 16 20 24 25 24 22 106 V L L 0 0 0 0 0 0 2 3 3 b b b b 31 36 43 22 22 21 21 20 18 15 12 9 7 107 G L E 0 0 0 0 0 1 2 4 3 b b b b 24 45 40 25 23 21 20 19 18 16 14 11 9 108 E L E 1 0 81 0 42 3 2 4 2 b e b e 30 48 28 7 8 9 14 19 24 26 22 15 10 109 V L H 0 0 0 0 0 3 4 4 1 b b b b 50 45 15 31 28 21 19 16 13 10 7 5 4 110 V L H 2 0 42 0 30 2 5 3 1 b e b i 65 38 13 13 14 16 20 22 23 21 17 12 9 111 D L H 3 0 48 0 30 2 5 2 1 b e b i 65 31 15 11 12 14 18 21 24 24 21 15 11 112 I L H 4 0 0 0 0 4 6 2 1 b b b b 74 27 12 33 28 21 18 15 13 10 7 5 4 113 L L H 4 0 0 0 0 1 6 2 1 b b b b 72 23 16 26 24 22 21 19 17 14 11 9 8 114 D L H 3 0 117 0 72 3 5 1 2 b e b e 59 17 27 4 5 6 8 11 15 21 27 28 28 115 A L L 2 0 31 0 30 1 3 1 5 b e b i 30 10 59 10 11 13 17 20 22 21 19 18 17 116 G L L 7 0 47 0 56 1 1 0 8 b e b e 11 9 81 15 14 14 15 17 19 20 21 20 19 117 A L L 7 0 0 0 0 0 1 0 8 b b b b 11 7 84 24 24 22 21 19 16 14 12 11 11 118 Q L L 7 0 83 0 42 1 0 0 8 b e b e 6 10 85 11 12 13 16 19 21 22 20 17 15 119 D L L 2 0 19 0 12 0 0 3 5 b b b i 7 36 57 18 19 19 22 22 22 19 14 8 6 120 V L E 6 0 0 0 0 5 0 8 1 b b b b 5 80 13 36 31 21 17 14 11 8 5 3 2 121 L L E 7 0 0 0 0 6 0 8 0 b b b b 3 84 9 37 30 20 16 13 10 7 4 2 1 122 I L E 8 0 0 0 0 4 0 9 0 b b b b 2 89 7 32 27 18 16 15 13 10 6 3 2 123 I L E 8 0 0 0 0 9 0 8 0 b b b b 2 89 9 44 34 19 12 9 6 4 2 1 1 124 R L E 5 0 74 0 30 2 0 7 2 b e b i 3 77 22 11 12 14 18 21 23 21 16 9 6 125 G L E 1 0 16 0 20 2 0 5 4 b e b i 7 54 43 15 16 19 22 24 23 20 16 11 9 126 V L L 3 0 59 0 42 0 1 2 5 b e b e 13 30 60 6 7 10 14 18 21 23 23 23 22 127 G L L 3 0 60 0 72 1 2 2 5 b e b e 22 23 61 6 7 9 13 16 19 22 23 24 24 128 E L L 4 0 174 0 90 3 2 1 5 b e b e 24 20 64 2 3 5 8 12 17 22 25 30 32 129 R L L 4 0 223 0 90 3 2 1 6 b e b e 22 18 68 4 4 6 9 12 16 20 23 29 31 130 L L L 3 0 147 0 90 3 2 1 5 b e b e 29 19 62 8 8 9 12 14 15 17 18 25 28 131 R L L 4 0 223 0 90 6 2 1 6 b e b e 23 19 66 3 3 4 6 9 12 16 21 31 36 132 D L L 5 0 146 0 90 3 1 1 7 b e b e 13 16 75 4 4 5 8 11 16 20 23 30 32 133 R L L 6 0 178 0 72 2 0 1 7 b e b e 6 15 81 4 5 7 10 14 18 22 24 25 23 134 A L L 1 0 31 0 30 2 0 3 5 b e b i 6 40 57 9 11 14 18 21 22 20 17 13 11 135 E L E 4 0 58 0 30 1 0 6 2 b e b i 7 69 28 12 13 15 18 20 21 21 18 15 13 136 R L E 6 0 49 0 20 2 0 7 1 b e b i 6 80 17 16 18 21 25 26 24 18 11 6 3 137 L L E 6 0 0 0 0 3 0 7 1 b b b b 5 79 17 33 30 23 20 16 13 9 6 3 2 138 V L E 4 0 0 0 0 3 0 6 2 b b b b 4 69 26 32 29 23 20 16 13 8 5 2 1 139 P L E 2 0 0 0 0 2 0 5 3 b b b b 10 58 34 27 24 20 19 17 16 14 12 10 9 140 L L E 2 0 0 0 0 0 1 5 3 b b b b 11 58 36 23 22 21 22 21 19 16 13 10 9 141 Q L E 3 0 0 0 0 1 1 6 2 b b b b 11 64 30 25 23 21 20 19 18 16 14 12 10 142 A L E 2 0 31 0 30 2 1 5 3 b e b i 15 57 34 15 15 15 19 21 23 22 20 15 12 143 P L E 4 0 57 0 42 2 1 6 2 b e b e 13 66 26 10 11 13 17 20 23 24 23 20 17 144 Y L E 5 0 93 0 42 2 1 6 1 b e b e 18 72 20 10 10 12 16 19 22 23 22 19 16 145 V L E 6 0 0 0 0 2 0 7 1 b b b b 8 79 18 28 26 22 21 19 16 13 10 8 7 146 R L E 3 0 104 0 42 2 0 6 2 b e b e 7 68 29 11 12 13 16 20 23 24 22 18 15 147 V L L 1 0 28 0 20 0 1 3 4 b e b i 17 37 51 19 19 19 20 21 20 17 13 11 10 148 E L L 3 0 174 0 90 3 1 2 6 b e b e 16 25 63 3 3 4 7 10 15 21 27 32 33 149 E L L 4 0 174 0 90 2 1 1 6 b e b e 21 16 69 4 4 5 8 11 16 22 26 30 31 150 G L L 4 0 35 0 42 0 0 2 6 b e b e 7 25 70 7 8 9 12 16 20 23 23 22 20 151 S L E 3 0 54 0 42 3 0 6 3 b e b e 7 65 32 5 6 9 14 18 23 26 25 19 14 152 I L E 7 0 0 0 0 3 0 8 1 b b b b 2 87 14 31 28 23 21 17 13 8 5 3 2 153 H L E 8 0 55 0 30 3 0 8 0 b e b i 2 90 10 11 12 13 17 21 24 24 20 14 9 154 V L E 7 0 0 0 0 3 0 8 1 b b b b 2 87 12 32 28 22 19 16 13 9 6 4 3 155 D L E 3 0 48 0 30 2 0 6 3 b e b i 4 65 34 10 10 12 16 20 23 23 20 16 13 156 P L L 3 0 27 0 20 1 0 3 6 b e b i 7 31 64 14 15 18 21 23 23 21 18 15 12 157 I L L 6 0 50 0 30 0 1 1 7 b e b i 14 14 74 11 12 14 18 21 22 22 21 20 19 158 P L L 4 0 122 0 90 3 2 1 6 b e b e 24 11 69 3 4 5 8 11 15 21 25 30 32 159 G L L 5 0 47 0 56 1 1 1 6 b e b e 19 14 70 11 11 12 14 16 18 19 20 20 20 160 L L L 4 0 19 0 12 0 1 2 6 b b b i 16 25 65 16 17 19 20 20 19 17 15 14 14 161 F L L 5 0 177 0 90 2 0 2 7 b e b e 8 21 73 7 7 9 12 15 17 18 19 24 25 162 D L L 8 0 146 0 90 7 0 0 9 b e b e 2 4 93 0 1 2 4 6 9 14 19 33 39 profisis-1.0.11/examples/Makefile.am0000644015075101507510000000017711777577450014270 00000000000000docexamplesdir = $(docdir)/examples dist_docexamples_DATA = $(srcdir)/3A1P_A* dist-hook: rm -rf `find $(distdir) -name .svn` profisis-1.0.11/examples/Makefile.in0000644015075101507510000002666412012425010014251 00000000000000# Makefile.in generated by automake 1.11.6 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software # Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ am__make_dryrun = \ { \ am__dry=no; \ case $$MAKEFLAGS in \ *\\[\ \ ]*) \ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \ *) \ for am__flg in $$MAKEFLAGS; do \ case $$am__flg in \ *=*|--*) ;; \ *n*) am__dry=yes; break;; \ esac; \ done;; \ esac; \ test $$am__dry = yes; \ } pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = examples DIST_COMMON = $(dist_docexamples_DATA) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = SOURCES = DIST_SOURCES = am__can_run_installinfo = \ case $$AM_UPDATE_INFO_DIR in \ n|no|NO) false;; \ *) (install-info --version) >/dev/null 2>&1;; \ esac am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' am__uninstall_files_from_dir = { \ test -z "$$files" \ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \ $(am__cd) "$$dir" && rm -f $$files; }; \ } am__installdirs = "$(DESTDIR)$(docexamplesdir)" DATA = $(dist_docexamples_DATA) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ am__leading_dot = @am__leading_dot@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ docexamplesdir = $(docdir)/examples dist_docexamples_DATA = $(srcdir)/3A1P_A* all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu examples/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --gnu examples/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): install-dist_docexamplesDATA: $(dist_docexamples_DATA) @$(NORMAL_INSTALL) @list='$(dist_docexamples_DATA)'; test -n "$(docexamplesdir)" || list=; \ if test -n "$$list"; then \ echo " $(MKDIR_P) '$(DESTDIR)$(docexamplesdir)'"; \ $(MKDIR_P) "$(DESTDIR)$(docexamplesdir)" || exit 1; \ fi; \ for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; \ done | $(am__base_list) | \ while read files; do \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(docexamplesdir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(docexamplesdir)" || exit $$?; \ done uninstall-dist_docexamplesDATA: @$(NORMAL_UNINSTALL) @list='$(dist_docexamples_DATA)'; test -n "$(docexamplesdir)" || list=; \ files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \ dir='$(DESTDIR)$(docexamplesdir)'; $(am__uninstall_files_from_dir) tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile $(DATA) installdirs: for dir in "$(DESTDIR)$(docexamplesdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: if test -z '$(STRIP)'; then \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ install; \ else \ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \ fi mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dist_docexamplesDATA install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-dist_docexamplesDATA .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic dist-hook \ distclean distclean-generic distdir dvi dvi-am html html-am \ info info-am install install-am install-data install-data-am \ install-dist_docexamplesDATA install-dvi install-dvi-am \ install-exec install-exec-am install-html install-html-am \ install-info install-info-am install-man install-pdf \ install-pdf-am install-ps install-ps-am install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am uninstall uninstall-am \ uninstall-dist_docexamplesDATA dist-hook: rm -rf `find $(distdir) -name .svn` # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: