pax_global_header00006660000000000000000000000064131051447120014510gustar00rootroot0000000000000052 comment=5faba2a815198cf4e7f0ef44f1b90ee0e8a25e83 periodictable-1.5.0/000077500000000000000000000000001310514471200143215ustar00rootroot00000000000000periodictable-1.5.0/.gitignore000066400000000000000000000002241310514471200163070ustar00rootroot00000000000000.project .pydevproject .settings .coverage .mplconfig build dist periodictable.egg-info doc/sphinx/MathJax doc/sphinx/_build doc/sphinx/build *.pyc periodictable-1.5.0/MANIFEST.in000066400000000000000000000002251310514471200160560ustar00rootroot00000000000000include doc include periodictable/xsf/* include periodictable/activation.dat prune doc/sphinx/_build prune doc/sphinx/build exclude build dist *.pyc periodictable-1.5.0/README.rst000066400000000000000000000110161310514471200160070ustar00rootroot00000000000000========================================= Extensible periodic table of the elements ========================================= This package provides a periodic table of the elements with support for mass, density and xray/neutron scattering information. Masses, densities and natural abundances come from the NIST Physics Laboratory, but do not represent a critical evaluation by NIST scientists. Neutron scattering calculations use values collected by the Atomic Institute of the Austrian Universities. These values do corresponding to those from other packages, though there are some differences depending to the tables used. Bound coherent neutron scattering for gold in particular is significantly different from older value: 7.63(6) as measured in 1974 compared to 7.90(7) as measured in 1990. X-ray scattering calculations use a combination of empirical and theoretical values from the LBL Center for X-ray Optics. These values differ from those given in other sources such as the International Tables for Crystallography, Volume C, and so may give different results from other packages. Change history ============== 1.5.0 2017-05-11 ---------------- New: * mixture by mass and volume, e.g., 5 g NaCl // 50 mL H2O@1 * multilayer materials, e.g., 5 um Si // 3 nm Cr // 8 nm Au * add support for bio molecules with labile hydrogens * update list of possible oxidation states to include rare states Modified: * fixed computation of incoherent cross section so it is consistent with coherent cross section and total cross section 1.4.1 2014-02-04 ---------------- Modified: * default density is now the isotopic density rather than the natural density 1.4.0 2013-12-20 ---------------- * support python 3.3 1.3.10 2013-10-25 ----------------- Modified: * fix activation calculation to ignore fast neutrons in thermal environment * add emission spectra for remaining elements above neon 1.3.9 2013-04-23 ---------------- Modified: * Update requirements to pyparsing<2.0.0 (we don't support python 3 yet) 1.3.8 2013-04-08 ---------------- New: * formula parser supports density spec and mix by weight/mix by volume Modified: * py2exe/py2app wrapping now includes missing activation.dat * skipping bad 1.3.7 build which didn't include all changes 1.3.6 2013-03-05 ---------------- New: * add activation decay time to neutron activation calculator Modified: * Change neutron scattering calculations for incoherent cross section to be the linear combination of the incoherent cross sections of the individual atoms rather than total cross section minus the coherent cross section. Penetration depth of the unscattered beam still uses the total cross section plus the absorption cross section. 1.3.5 2013-02-26 ---------------- New: * formulas now report charge and mass_fraction * formula parser accepts ions as Yy{#+} or Yy[#]{#+} for isotopes * support neutron activation calculations * support xray refraction index and mirror reflectivity Modified: * update X-ray scattering tables for Zr * adjust ion mass for number of electrons * ions now display as Yy{#+} rather than Yy^{#+} * fix formula.natural_density * fix formula.hill so C,H come first * fix element.interatomic_distance * formula(value=...) -> formula(compound=...) 1.3 2010-12-05 --------------- New: * mix_by_weight and mix_by_volume formula constructors * use natural density to set density for isotope specific formulas * add neutron_scattering function which returns xs, sld and penetration depth Modified: * need wavelength= or energy= for xray/neutron sld * improved docs and testing 1.2 2010-04-28 --------------- New: * support pickle: id(H) == id(loads(dumps(H))) * support ions, with magnetic form factors and x-ray f0 scattering factor * support py2exe wrappers * allow density to be calculated from structure (bcc, fcc, hcp, cubic, diamond) * estimate molecular volume * support private tables with some values replaced by application Modified: * rename package periodictable * rename table to periodictable.elements * neutron sld returns real and imaginary coherent and incoherent instead of coherent, absorption and incoherent * bug fix: sld for H[2] was wrong when queried before sld for H. * remove CrysFML ionic radius definitions 1.1 2009-01-20 --------------- Modified: * Restructure package, separating tests into different directory * When defining table extensions, you should now do:: from elements.core import periodic_table, Element, Isotope rather than:: from elements import periodic_table from elements.elements import Element, Isotope periodictable-1.5.0/doc/000077500000000000000000000000001310514471200150665ustar00rootroot00000000000000periodictable-1.5.0/doc/README.txt000066400000000000000000000005671310514471200165740ustar00rootroot00000000000000The following files show which papers are the source for various measured neutron scattering cross section data: nsf.pdf the real-valued cross sections nsfimaginary.pdf the imaginary part of the cross sections nsfreferences.html the source papers for the measurements They were retrieved from http://www.ati.ac.at/~neutropt/scattering in March 2008. periodictable-1.5.0/doc/nsf.pdf000066400000000000000000002577561310514471200163750ustar00rootroot00000000000000%PDF-1.2 % 10 0 obj << /Length 11 0 R /Filter /FlateDecode >> stream HWn67R XM&$j(څbߗHY嘺da$8 -)6M/G ?D>Lr_)l/ j|DEY,جM(OK|Z_~Fӿe(8#E[Uʜdm65}vQ+Q\㵘ЪDSzΪb΅h6 Cb6ui?TZb#ZB5}Y"DCɒgz^m l`5l+޸+ŵ?);[q_rBp<̣ 8zy8cq߿M4.NT1yW)hϛ^[Iۜ$kmx^BMyoP\kiOV4ں;y-w.Z΀[VKn]Oқvo">e >I t7Ej:101MZv5ZѲFvm_|4}x%6 'm1vd-e:[(R[ld+.}$O]$ ocDnZ/D0> /ProcSet 2 0 R >> /Contents 10 0 R >> endobj 13 0 obj << /Length 14 0 R /Filter /FlateDecode >> stream HWn7þp,k+}Q QkCjߗ䒻ҒkȋbΜ,f#UϚ>T3\)nPÀwZSVjnjĩ=Wڴ!5E pTmcD}`JCֈ6K}'AR`= ISn{?΄JjHkqzf F*0 >G. *5Ġa  Uu?;YKQƕ߰q?3L:ҏp}ab" lXF5A62n:xQƾ4xa~a0([#gSPͪuSƈ9^E( ^3 $XG9t۸%X>uh ScHdȩh1*2$v$vBra\\0J~| u29w`#DCl<H{|4wљR;/m.lxQӐM|U|]"_ n,u}n}LT9DD7$~{٩8Y>6 +H\<և**+ 0s*"(n_1OxZ$1}ʧeEWYAcLr s)-d˚VH4`[x9Fz=ԺZ&έvG$.B(p}xMqS(58݃InG}P}W5HМr^3NOnE:\f+^6La3:rS?~3b֙㮇!ϒ#jHUf3؛Xq=q)XFp jIj$ݭ('׏*IPLk'#R‹Ԩ@ɰKN?TS8ݢ< RY 鯛LɱgztYm&k`XIw-{X=i4Y2eLUl89[V)de+PӲַA./6 '+d lY<d$e=؀6pL(]r+ `|d,^.tIޗk 'd޽X2Ity=4b9ӳ2eN'nOƫ_a[hgT܍bJ鼌tqJ@m겾2ƺm):3z!#'c36U/]vj8!~j!G*Sj$|;IO\-$?ӳT:Zz0'!HC7+)!+FȦqY6:w<@r(.JJqf[v yiYM;C5'&dK΢3ղ+(1ߢa>.ͷR8fc:3> /ProcSet 2 0 R >> /Contents 13 0 R >> endobj 16 0 obj << /Length 17 0 R /Filter /FlateDecode >> stream HWn7P,Ѫ(0E_C&u(UKJ\/A"̙3g櫎 H "C?bZ?oA 71X f|_VuB0W*DDP+|ACJ8e,5]b wT*H߸sɡb9$y HM01B҈oOP' 6[w~m%)/pE~|a-!jk@ $c%L3$ 12v |ݡO&S5>ZgULZEU,**RWw1 vqH{RO(-H i_PMi%a,f fYffp[`fB~\qF ='P33e!-<[^?&>x =E W "HNM5A8x(L OA=`I)Lowd!}=5ZY7kMԹU9O'嗵‡tGn֩q6UM;h䑲@ߏQSeek30^ Rf5] $ ]̰Pf(P2y0Md4ͱ&r:,sC1+Rk-:*JƩw 䑘[q׶,.* /_zA˨SuLیrA5Vv9H+p9Y^p*Y`q.Qm)tY7a7A\EuJBEi.r] p燧]6l Z֭4ELݾBӘ}*֗$WχHKJ<^uX,C0vb+lnn.(`f '%Ua/7hM S#$il$nȊ2Sn.( *u}~ܵYG(xKw7oe@`;\~,qm`3n_F}t6 b$H`9o }w:$P7򓊜 Wґ]}Deؐ)buWʬoN7#P'.aF.Cذa6#Fa9̆:xI5q!;Yr#EUmBa,y/*/l+oUpx[I:ܩ+/1JI({\ T,$j-Nk#Ӊp/0$>xJ=BER0ܴ1X~F!^m#S55@c7oU/uH0S4G{T8(}b06IʾbM9qOFɐ?׏@P H_X endstream endobj 17 0 obj 1406 endobj 15 0 obj << /Type /Page /Parent 5 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 16 0 R >> endobj 19 0 obj << /Length 20 0 R /Filter /FlateDecode >> stream HWێ6^ 8&E 5ع`[N_^)Q>mRã3sg6VJhyUmWrOTi>j~h?Է/ו`Hrr_٭a*YCu1.O""f'[VS\oϤoJ$nS[K(wsn3zU݀St~jd7P*ȓ֍FZZ?v):];eght$cuOh1B)}?سBL汾md%'F,eV`y*kΆW5)jRt2IQku#6'lvN2݄$5}>tyI)xu9媡p-X"ݕ9 _zbb z!o4.L\=;Sw)k9ΏږWvhb́{o%kXef_JՊIݷViS^1yalU+ktJg -#B]H脂@Lcgi2"Ap*Y t3F&Csd#x&hmDΒ_r>Cr]hJxG u&h$FZ|#8][hoPLwsl6$õsETΉj&,CsffFM(ƅ\<7"GU)B ĂE^ł/-O s?ݞ,`|10Q+-mb\dT:,Zͷ)۬FC{r$r">c2NPSы[#Ti7A榘]S-9]LMG?39ϹlX}W:*fbz endstream endobj 20 0 obj 1335 endobj 18 0 obj << /Type /Page /Parent 5 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 19 0 R >> endobj 22 0 obj << /Length 23 0 R /Filter /FlateDecode >> stream HWn6m De鸅1FhUtES8Ԍ4Eļ<'7\rXr$ 絿^".! SH$X>; H';ɰKS^jp ΣtVO^b', :+QsnBE0yx0QP̙p{mHp>!YPҐ~F %fAWmZp5b[@^p(pljM3(sI"Zv iPe |LN!6~޼^a9蠨vOE&d$c,.oz_^rLL3[2# EH #謷ͲJ?DWh!E/H|drn5Kc4>m?KRd^>PҾLAk^TQNfTѳ(A>zT43oZnE otDOg ܄O }T8HDc6EK>93K0tRl ޾ĤUқIVmHNZXb݋eO߾<p2$I^QbyN<'X"(dW*dh~}Bg_H Sed6DEPG*)JDL="w(.5G62Nn ܐdeldpfZ'e}v[KT:C9w׉pGC余Y\ܣCvY@KhCBՑ+Ȼ2g"pE'"<"έ"u)i 0QM"1cwO^dإq/_n#4Q h@޷&S f䲱n˄ǔy#<>Bk.v8>=f?8|\8 81nw"[EwGе:i̬G.?3[ȴ8zQlJ틱<;9u֭uk:ȣ =龇uJ;wvFpy&? 7f@rf`ӑӳ+d7<ݯ:2`_'G^T0l5Uc%,BV=<6O endstream endobj 23 0 obj 1235 endobj 21 0 obj << /Type /Page /Parent 5 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 22 0 R >> endobj 25 0 obj << /Length 26 0 R /Filter /FlateDecode >> stream HWn7þPG;ҢcXBVFߗKi/N&w33gn63&$W,gjFZ?f 0'dͿ?V?g"ɲ2W1*DPp6pE%2]b ;Q)"\a 9}߸ N..<;wa Ԣ\D鱮v}MRmCY-!e2>W.*0dj"D|O#)!Z)JFtRz}f+$ BHW+}SKG|b\s Nh{hA/JʄR)RX?D@|Z"BP4KBd1Ɯ eDtDHkFrfbAj x s)1H">/NX @MMG CHDS"b|k|6f|'_ԣ .XLeQ_)hkhj>0.ͥC3?́'HzeSMt9g$o?Jr AFbLω9 ˯ (!GIhOj }gf#NSWWb=A#Y@Vׯb=n%d^+e>x!n@R^sV9PJ(CRM~: ӧ"A1|4$nWW6ІPY }7e93XS5$%ߑ VsIePFRJYΙ+)HT' Tcg2rr/8K*b?=v'Mh`>cDg32XڹW2(BkD'd%1bmK!'[gCWN](ѮV8K!#fg`@;o4~ޠv zګ;=@{¸i; +Gs"*5e}gfF&-sYzelaAF}569BfwlJrxc'nsNiXcF8Oo/ɐ!2S-n!efH\jgZEZ\ǖk![X-,ͼk;q#lu%î:# endstream endobj 26 0 obj 1232 endobj 24 0 obj << /Type /Page /Parent 5 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 25 0 R >> endobj 29 0 obj << /Length 30 0 R /Filter /FlateDecode >> stream HWnF_ ޙ?ZuSɠnT5}J.DiyYΞ=3sffqIRBʫju5{fPbӬ GkVW_~ԗVfɽ媲G)S((Y8MU+@0~3s?CWooESu9*] yf +"d=$:vO2bۿ"A{tiXKoX ́ww @ۣs"N@vCW@VyD4̔ jl>G5tϭA^\M+O`WkvkXװ=ϒp}`Zm"^}G *A%c4늏)E KUv2J+=G#nrpp4QBgN $ h^Ḁm'0J*m `qUOJyh>kPI FIn"P"N\jspQ%`r-QixC4Il$KDBhf$K"Դ_0*K!񙔰d=[ˁ7 ^]sX~Q~b|.@}12s1xAÑΑz<{t®-~Ǻg|Rљ$>:Xr 7 eGj+~;lQ?oF~ :AY2 ǬGlFl>oqoW:\}s_H{69qrr#Μ3` ?a.qb;s` (qMH l_FL,l)(4 T8zƺ޿&#%3Wns|s*]6P4HB@gEpqBOWz~=gE'l^; 8yuvb7\n^GPAx`I&ױR/RQDr0H|mFRw8Vf4Ώ+ \id_R0*,+&Q,FdџV: h拭iyL#O.8B[{ Ykk57Ϟ(; UVy$bKN[@b_:c8zGzJ])1:*RD&׋5M [։1$OU۷Na|Cɵ34 \T[U/7]5gݪ?MSLr/ endstream endobj 30 0 obj 1289 endobj 27 0 obj << /Type /Page /Parent 28 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 29 0 R >> endobj 32 0 obj << /Length 33 0 R /Filter /FlateDecode >> stream HWn6"M޺6a/ ݍݺp`4-e(ZI+qQecgfl+TZBEUm/V?WKVYbaUSB%HWۿ?>WV%EL)єPP<W==W[v;B#A2k8^ 'cAK<ε$FdBzMʿgM&,`p4] 8zG#) =l%[Y`V+Lkyzf Dz$%v_s"Cϟ\1 іeL^E3Crlv_Y9OX1dx\W6+'h&[L6e^:nY9 )ks]n Z\<<"qWLc8B(-[M=m /Y@:~Ȋ~g <+'Md}:rTdr4 Ya4{WsÚ$fm`vcFXKv@f͋HKOSlV1FU7"~5vL,ah [VR!ZA#W!J5`c.k&T3 9ROHzbIO3#Vc>+S=*n endstream endobj 33 0 obj 1373 endobj 31 0 obj << /Type /Page /Parent 28 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 32 0 R >> endobj 35 0 obj << /Length 36 0 R /Filter /FlateDecode >> stream HWMo94ﲏB!'@=U "]{d!._UzU}meM]mx4kx-yi9FgS{c:\5h$SƥUYo:q!+t!8WZ_G#͙uk<~Og%:0s <0c"hD;&*Y~J0_HE]<ٕL;L h cov.<僫u*n^ɫ]t+fs|ۤm%J1!~X%銕y+ Ki$7:hxqͫbPTW@g`op^^Tʥ7Oq)z4=i׃@i`ޚy%3k6FR 5%DƵ* l&6?$%\|4\Z> /ProcSet 2 0 R >> /Contents 35 0 R >> endobj 38 0 obj << /Length 39 0 R /Filter /FlateDecode >> stream HWn6_ X!9>4E"SoIZqatQH,ʖ"!yxj bLY0/dqqˉNL ??a,su#YP@#7ć20)2!@v{"NМ aq2_$ն^5/??˨taFQ+qiWi{CzC!R.#9)b5. 8gWPi=(㊁.̥:(ꘋQB \t߄1_:M9l*EYXj}Qx\S/nY{LKP~LAu"9+vy}[@ dj!ZU@r2s>NX;*Xq_7zUl>>XIB6v ;kh)cLnɱ&g@_s'=M8PFݥF!P,_=Ȥ2>MhXI R0fT(+eo#4C7cBR795f&[wi'iǷѺ˷/F28ctM\aSHhlj.Vn8+)܎P8J½:P <,p]YZ2e:xp$#X0)֬,&v܆|Ynǚ 1*: 1 @KR[Hc>afDc7:cd1MaljJ^vM}~sVpUv2D}+mwZz^OXcL"S(pQ޼l gdLK刿% endstream endobj 39 0 obj 1139 endobj 37 0 obj << /Type /Page /Parent 28 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 38 0 R >> endobj 41 0 obj << /Length 42 0 R /Filter /FlateDecode >> stream HWn7P,ᝏv㢰>}Q iTߗDJҮE^p̙rbL2i 6O΀8yմ2ŕћo2}[2Qj-7Ļ2a+e\ Yo<~ B2I2m͓b7nKަ UM.R+9&  t_.F1CN7Kj?#\d3L̄"ũwDOKjwC@5D yXS2v,-,8s5DV0K&-hjtvw* ɣ:Q@nUM|uh u'B-|Xx5eBe=M8̄s^A9:Orf{>(hpD W_P &xQ tqՓ̖-rJr䶊@@[zop܀6PW׵s"bo?-]+KA_=Lm 8_H*wTxytbZUf-I)Ww2d=nHTJ"Y5V;;Jjd$Z9۞< ͠Q(S|by_121qԙ'*:z2T<~ӠfV@K~+9wn6٭Ҍ[2>%/[@ClDX W1?OK@+/ endstream endobj 42 0 obj 1234 endobj 40 0 obj << /Type /Page /Parent 28 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 41 0 R >> endobj 44 0 obj << /Length 45 0 R /Filter /FlateDecode >> stream HWj@þ\6{ǸI-$PRLCwҮmVG;=sfhTBaLByE[ߡ"WUM0L߷5k>{X r):bo5Ŝs.D7+H^֟Lx~ϵ sY<KOIM`ʺ jpMfx4\ .,ܡzy.in+ǿc=&cU9^S@{j.b5\{+7oLQwHyxE2'tw pE13zS⮩H%)h pT CLX/bUR 1ֱc3=SnN}2!T#q!@Q'RiQdq .e|06I3l{r+Uon-\/$eV/ˇPHwmiXA;!)z?\:k{%ٛR 󬭒ցf ;jZNPӅP Su`809=en,?>?5@,bp4G(BWԭ lt/P[eMGwvFt1eJWන'(@2ש،\ve|_m7x6yOАE'Bܐvҿn&bH|KݹF Ce^]6 kænZ<.=q2r'|=Xz0pඹKIف 账i )y&3NRˮLqNe7mȾb:I RI}2bnĴ[y}I2푋N7nf wCp q endstream endobj 45 0 obj 1009 endobj 43 0 obj << /Type /Page /Parent 28 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 44 0 R >> endobj 48 0 obj << /Length 49 0 R /Filter /FlateDecode >> stream HWMo6t)E ona/ emn] P+C7oޜoV0XWMX&{}lVgxMarƵ۬u׾Ғ\4a)[ʸ0[ClL 0)TnkZ83.Ǚsua5>[͜"ϕ>o6}ߵD9b8[qH`,)v&~$JG2VI,&Nӷe # *%:=<;xN~CP+F[p-s[,^L5-ҺK^K*=Jɍ%o OHkW{>u@t)qEG)%Q)@!PN֝o8uT|_>? Js364~$ljtλn=5;v-w_YHiO$H77U!We^ `#3psR nLX[fqBi"*hl~tvOBtMEB3b?(;XOb(O䀴ۧe! m9Th!Z$QYl=E5]? ಬ^V,};oDsRG̱m -!SÅD41ɂ #4 "+7y [PXpj")5@&HzDgpZ0|{@ur:DZȥ9OARu/d@H7B־P(;b 2nsqLM^YЩ.S@&.u&^f+\ݸF2O3#Yꎒ9EQ4_jVah?5YD=U2svnA :'I0c.s2b>k c0KYN7A4Sg~EI[1lxW62wre/w{c.* C<^9:Ui;>w=U7dьArZ G"mRӌ c^m#Z!̥C͈_M ogr R"*9T8rlsr~z/!aHX'|>~'Scf:[ CN5Y1uE&)7&e5^ŀ%-{͠ϻ~"z?1xEhJq׀l^>u endstream endobj 49 0 obj 1557 endobj 46 0 obj << /Type /Page /Parent 47 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 48 0 R >> endobj 51 0 obj << /Length 52 0 R /Filter /FlateDecode >> stream HWn7þ"XZF` %q%[EZ_^+RKkw)ggg̜=_-"hiMX=7KXby({s꟦-sfBrD8h): Gcbg^Pps.D`$(Q&y pb(1&{W\KbDv.4yk"U>K:40_R-O3b3hpބ_\v=IYsn6zW>>X{:iO`h( ` S{pӣ1.`~mY=S|Xxv5'(Y,DgvXX~tEHS;1Ax^~ftef7赵]tKD1@zKZT/eo"@'ZHo"F4U۾ rj|; /f> =< ODgCC cŴbd_1uYip><b}K@lM4"5WuSYYq1s5Q٪8_IyQ&O~6M%6:NR#(qL>ۯlڥLviGcr<6{xB*ET]:u6zf6ZdJe #|YP޵&1UŽl>1dˇobҩN^ZBL B,tAZY`-^ǸY~/ *^g9'I4⬃BrExNP%v]BM+@pj*Qk8/$F|S. kWXW2GB(j'ְo iɹB֚blؽHS83BS t8Kc)(|nFԂ'R%m|⬼> /ProcSet 2 0 R >> /Contents 51 0 R >> endobj 54 0 obj << /Length 55 0 R /Filter /FlateDecode >> stream HWMO1| Ǧ)m@ &PASE؛M˒߼U%H G  6,J~?X3]9r_~`Xro!Jj\15z*8~hX3߽'X՛'ޢ :YN3oWkع^6+,d .\c#;0&q,8Kob٥kK/shqѲVnbƅr;C2c)?9fao(0 :wX0!%?.,4O!KuqzȜxkx~AcE-YR6Qńy;jpY8DW ;BxJ[u 2Up?&V]u"e3Qr:tڌϷ(dV7=ƍq_; f戀s`FaB`A$ >kaC{z4=cVsG$*W%$&Y⹛ЌM2W%4PB_֋ifC3"MV?M6y8P%'Q24evwdX j v.OL[sH\t|6PT@TD0Wfa1MУ@!YGw=ÀfWڝn ,8T[:N{;rGHhz]3Xs=^-15%zb:ZD8$}ZG#@  МX+۲ 8"8KF+<2O@XȎ1 0Q endstream endobj 55 0 obj 844 endobj 53 0 obj << /Type /Page /Parent 47 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 54 0 R >> endobj 57 0 obj << /Length 58 0 R /Filter /FlateDecode >> stream HWN@l*BX6UB& hSEUw^1IRq|9s3qU`"&AC"$H&¨F7VH TuHń)ߡUbW ʤ><C1pe؈,.42LTxGeLS,2>Slce=S`aa^HB}EFb\I֕r;c3D?|] -z~ԛB,눰+ImlWoCbVSCTΖf<{>䔹TaY+6TކuZ@O]^ ,NmE:rE1 #;D6" EgsYBbB(vmEb^DlKr>-YXiU IBȝJ5cH00 2j[?: endstream endobj 58 0 obj 892 endobj 56 0 obj << /Type /Page /Parent 47 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 57 0 R >> endobj 60 0 obj << /Length 61 0 R /Filter /FlateDecode >> stream HWN$7~Djr8hQ"Ey4,DK4Ii\K3vO9UuZpIX&wtA;-Ϡ3H &]VvG}w?~崳[)P&1{t+8f Y|7qJN;):{)?u%:W,iCpMd(? d W{e- Df/NV#?w`//ПssE`H؎`G eĐ$p0ACr~6iWGzۃ$;>ŝr,}gEvp6DӀOkzW:{PQPèL"R\PsN(*Q~0 ȃQi9τX2"&JfLa gBZH#<9$V[ʀĄ ߡffbik`l2Ta\l&a"@1i2W6e< Bu)9o,Y('GlwA0 PD"Y=}W_C/0Z{'wI|[(U.@EІ#=mL1 *#!LBMgH]U5 k DE_: 3D<"39jNNj^aIF, M g1#Հb>s:;OX/Z-^IՂh!"RL,W8vI\IǸNhĭT}Ne?_lEs<2&Aj0 P{RdPk.\} q|d4H|y}0XEdޡY Okj2hw AەWKj`zR.%2e*r"jAavz֬ѡx& !ϒ\Gތ> /ProcSet 2 0 R >> /Contents 60 0 R >> endobj 63 0 obj << /Length 64 0 R /Filter /FlateDecode >> stream HWn0/\1NROE/Ij'(Һ0iQeKShهFH*hL16d4qRǫQ(BLK18OGZRXW&rLY# Y RrTzG5o q:ϼ4E`/@Ih?+BERdq|y2q28.W+BKth4FfIV,Uz(F:IU̗bnOYգcq@K$;yjUU#ˆfU8BZYfoN.]{!C n(zɌyx]27TkD n]tn.Zc˨6BHO߫B,@t6"7ᓡ)7-|) V0hpڏ34 la10sR)5UuIUSPwg5@SKӐlGNmo5wQB ҂KR07JFj{s1}IO0nǮvCp~H0TU4 >{ *{g ap7㠻`s%!"dABcj07[U(33p[LRT_}o9(vڽpt;ē37N:PSҸ[Օ&v5iiW+c;UO! gdaFBXea_/Yu/]mTV{@yXu>΃;VvPDrg "%쪸 rOTůIE/#&N}~-lQzٖ @=vP%an=y;c/ :;]3iU/:a+}C܃X{-|{\d" 2H endstream endobj 64 0 obj 982 endobj 62 0 obj << /Type /Page /Parent 47 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 63 0 R >> endobj 67 0 obj << /Length 68 0 R /Filter /FlateDecode >> stream HWn6^ X EXK-zatQ˫LT$zUtGq ]oW\lЄޮhCw*P/vݬm}}}%ܯ662B EBwl ۜqoHv):{Dl+mHߵ1kx<,Dl>dbC?Xvpmewtf޺$?ŌXح `we?}dٲ=h-ISV~H Lw;jbЂ¥j.eK%HMuAmr|MCZa*`$)Ba&y=aNs#𤮮Aoi0B7=:.]>CyF (#zD Qq]r:XʦCN0$1M:'4N Ȫs'csd9n`;:<| cP=du'RM䠎ITKuODٶһ@t:DCw`T1'B! F|uwߤLY#!/#Ȉst"tnat=̤;f;*TY56:))+_/Io͏ ٽj5D '?QtTxMɈSřq4uzf_1ux`&k=[BQC$O9uE :hܑBwr ƻ@OvF2c`MX.;1Pe'Ҫmf ":xY??v fkI endstream endobj 68 0 obj 1187 endobj 65 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 67 0 R >> endobj 70 0 obj << /Length 71 0 R /Filter /FlateDecode >> stream HWn7þp,N$Dž["eWBE1gsܦ %4ifWڸfry !F?/&-%TfWsoٯ䪱`J(Jkf?@sy7H/DSu9*s%9Wp"BC:F I`q3  ?Ѣk /s ޣt5o]bqHbbB V:pq2X MDt4{4΄^d)%w !eN&&;w,pгϜ&x4|X[= v״-~bũP2n;LgTC QM-%nBtcb?> NjC!!jBb56JLoG.08@=>T褸{xA)`JZԻrv|z~9VMÑٙM.>~siuU$z: E u eM(Lӭ sb}UwoYNɍggŰ0lȪ&CeB\g[:hcY?ѻ؁C  7β2o 8dƠn6,tCמt㼔X*ZLc]vyN3{xo^iC7rC,~R`َ#k:C9I RnB<`ĸt M Dm0昝p0jķܸSv ʯ;w TV XքLP?:24Ѕxsj&y;|p 13|_ ۀgɮqmmOTsafw&&GnR{' D㗉L!ʛį"˄ai+aHmoxޖ_rCXl*R*y[[I>07sranve~wEGsG.Dέ 4o6ELr/i3 endstream endobj 71 0 obj 1247 endobj 69 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 70 0 R >> endobj 73 0 obj << /Length 74 0 R /Filter /FlateDecode >> stream HWn6"ᝏq]/^!E$RbQwxDjdo"/s4s̅JjʉQ2IH}b;<5G?߯*F 1!_|OWJP-AS&L4k#ႇ4P޹2wS0jx Ow2jm97* FQ+six:bxCο]Lb1.3"."£Q GaGW3yWz:HZjAJ*P*Yij@+;3O߸=~yy)`M~)?\G3KsIkknRAS /YV%WǤЫ0\7}-l?~Z_AeBa&D)C|9"U؛þSc(б&CTƋE(};q2J /)';x@7P1ޛ9˫I!l4 x\[LV.}PlbgE73{"q/ot<1=Y!99s&vyCkAЂ"K_8x&Š'y-^Q|ހ3Yi%0J3S ~a*fC)i'[.yN06)ifg,kB9j*j*!G['A"MT]\|8]^8r%ŕb)r1첝CxhOl: c$G/)甀=.{=HƩ?G7Ud0[52xOhKZރ16OOlтL0U*SݱdNGEՑ"D/QJ{Kg\1ӔT- &<Ӕe7Ύ|g!&,U;KͅgD3.ꡡYTub5  ZwE7駒S,5zna)JXOG)b[czba.v1^y9s薏aFVȘBh iUs}wL9>}onƷ2 [UR1?1>>'5o endstream endobj 74 0 obj 1126 endobj 72 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 73 0 R >> endobj 76 0 obj << /Length 77 0 R /Filter /FlateDecode >> stream HWmo1 T.K24 ev ɋs2˭vY,gRS FY$!˳#o{Cf'Դb)Po2_]~]>&˯3%ArF*&RZDGd%K~TƅAI2mAb6;FIEʫxJy?PEZʡ f"j^uޭA̡ TZ(ƃEvEֳ_3<uLz&~ f;r^Y;fhͣ%$cہ4BN6%ަ<#fyNk:\ &}* '笈`@Uz* GEO&wtQ:s_:jIP9c^mW֗hF ݻ܂BOme*K/᱗-VQ0hS/)sێ]fƒ_|ݭЩTTF!;ysKܳޔL]oRTVd\UqƓ_AWDe99v c^F(zN$*Ne[X!B,*%$( RX2]i|δ+әaٹĄ)G!Ez0E L-6@qUr ?)U;:W{;(`~9X .04TuZ֓K{^ʔygi)7UD\.tXػSԅZ;Ѹ8D%NMa{k؇}: F=n>k7tְŤA1TvfNro FQЮdRmjE82}$I=AN%el ;jVBžhUyu"d&NE endstream endobj 77 0 obj 1108 endobj 75 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 76 0 R >> endobj 79 0 obj << /Length 80 0 R /Filter /FlateDecode >> stream HWnH ~\pQh2pM`"KM0R}Ο-˒7 EpHG#yZ/HsdFY.l!Xܲ90ǝ?BU?/B$jcV |!(DQ׶W nmqQRqNytyU!'9!( BeZw]d=2xD͊u03Uzz0ۛ%w;:7Y2IYEDc!~{F v1kʘ=Ob^qWbҩ%*)(m<9Weg=,IV9g&?VO&Md֙Q2pt uPGUc7eۛ߈ypѥs!r|bϧ1y* kG~%}کY%%u tzD=;HEqbAjDBٰ  X Nv bSWȯf|ӹ dϳ$Wr~Ev,>+fY;R`[Χ0X@Er9qr'~M˻T7$~54>Of+y9,ʁ:՝ߑpdTk NjI,wTA\ T~@ٳ8PKkY[q"kDTk7~z~]1qr z? endstream endobj 80 0 obj 1024 endobj 78 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 79 0 R >> endobj 82 0 obj << /Length 83 0 R /Filter /FlateDecode >> stream HWn7P,ᝏV>X } F/iQ{lE3gf KL!P3_2HML=FvG KO.5%LSLdݡ5̩Af43sx#Nɫ?~'`ש?WksEy>ߵфk !,X| (ƟR̵948uh,#/Ōswdlde&Hz~s̤AheI@#t.X01%P >]!'T'ISu08s"\w /IX?RQE ATœi.?-OUTekXHJ/nGbUBD d(`뉟W bA[xaN`L!|7Isl 6?)`uq0-L5$th 6W)""~`xF'6&9^J?媻xhzeg }"ϩ@ax:0i 2 x qvF{}wGz2v1"v&,J1ՀTdgU1Pojϙ>@b{<ʨy{׫ȓ$˄ ),aL-2#TH_q2x1@/C^xu*jFVp 7,\cd%O+3UU*Xm;#}h|& R݄M.}}>}aJؘޏޗ0@Fq}FE' ՍtZdᙽ3^4iY9Vtp;%tY/(bZ^NgI(x̴$M҇u)Q>ϤckסMnIΚlwpgmG!boɴ8/] XYyΗ* $vW=QD)V˵,a6y 9+fuQc}%}1^9> 1J$ mGP9f9^\E*r*Lqo,JۺMk`jH"Ϫ#O Ǧojy4e ~+~_~ҀpbXHAQ(T7w/n7?{~ endstream endobj 83 0 obj 1224 endobj 81 0 obj << /Type /Page /Parent 66 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 82 0 R >> endobj 86 0 obj << /Length 87 0 R /Filter /FlateDecode >> stream HWnFþPpw>um% (EB ɥ2ܸ̙]3sfxVRSNIBˊ!z۪f)g4oz_ϤRj-]02E54Pw2;IFoէb69΍n2Kã7T<utCjo_$\Dn0Jbot9wd[]%e=\^mohW݌BF{=Jjh'\ N4ȧѓ#\*a sX }l b|0+X| mTvƖl(O>gR=rzi/ٝ"^ţfj XCs0-4j&7)I(#ϣu^t{q1XDUTBUTU!Z>w;;6iN`g_%IRiM~B>Izfj+`̪b)v4;.j^/2ZoǶri^)Q_$pL#N-PN܏c8u[ώc=1[#+E-p@ꤢo k :цMKd'UEs 3%p̧X2zIܝ+헻#bis]{DofĂ #r,]cWzbMGݖ_y3 endstream endobj 87 0 obj 1043 endobj 84 0 obj << /Type /Page /Parent 85 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 86 0 R >> endobj 89 0 obj << /Length 90 0 R /Filter /FlateDecode >> stream HWn7þp,ZM$z(hBMz*s-wWQ.ȋ9X-4 XBY].d5+h:ёvJ!2gnV4goWImaPƹJUHEkf*|@ PuyOIKAO 泷7R0+ki[#XvmU1!۟EuNbxpDW8(L/7cW ͎^hptin+b{S293} usuы*RgB""O\zCίh;5-usyUrMMT 0'TԾ 8V 4l_\>ba(}$ICxNL1*D}PM`‹ 5)ԌB%ޯT[<@Brϛ6֙{ b3/I/R`qJ@ !RCQvC}0?m^M9"$'~"і'U?h2xd]0c_Y,+Q&!FW]OrmʰJ+?!AV]o7n-r8hRy Cy}~IOBGX"'p\T{pꋀ>ytgq5`@C8Щyh7#0 h6 X*&8m6e)φk[VҪҫe;qX7s7&meL!,u9>!gQ|*4aSQKqXkmڙ٬fw$݇=^ 'S$8ai1OTڇ :$ :u͍J\r:sP@> /ProcSet 2 0 R >> /Contents 89 0 R >> endobj 92 0 obj << /Length 93 0 R /Filter /FlateDecode >> stream HWn1_к *x@p'!ew6݆3sf2Վ t&Xzfg<~^*FMoi_/li%7*22&S.d1n0% Tt$)˷q \ܩb]YU:rmP?r2Y<[ $p_/E+- z ^-jv<V*XX/&9նznY:bgס9pU _-7h .hp Y2#ǭ_*-*)U`gs Woå_Ի4Z{^nµYJ z > O <4pc5@t)Щ`ӡ5iٲ%kcHDIk7(,J a͎$MX+xȿjs2m,w}{ཙ=5ruw=]mf6=?9DK&}H^SY߲ޔZڷb;.[3f֡n eirTF,SQ62kJl/gZbZ4M.@VXn#^pt62 H|E:Yy{oeNkZYv\z)mA}MV靬Ѽ~==e-hNoLM{NԔ ژexủPBt't%9bvV endstream endobj 93 0 obj 1020 endobj 91 0 obj << /Type /Page /Parent 85 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 92 0 R >> endobj 95 0 obj << /Length 96 0 R /Filter /FlateDecode >> stream HWn$5~Aj.e#!BYK6dA+Su=}\ڇMⲻԩSUەBіqUU۫ܿjuq-5HޯjθM?qZToyXem%CO*2Se: 0$Fbd99;ц`$ezbgLGhKEq:P<4mP`~Lr#)м,Sge0֡&ᝂQv*<׹4T4zSf,#fA&U1<ŝLƿ;Cl6>JiF"#lSgj 15YB-f3!hƳI=lfG1O`l:Ўڨ1Ls6 F*{PXK,x|}4˸IQVN1_a_'?6e=&?QʍK}(L_ Qp9gm ١F35GdTYeҤ7kKɝ:ȕ΅Z!VB!TpS`wڌHnbhJl!f;a }['2'K:\::"þMz_= endstream endobj 96 0 obj 1160 endobj 94 0 obj << /Type /Page /Parent 85 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 95 0 R >> endobj 98 0 obj << /Length 99 0 R /Filter /FlateDecode >> stream HWNA üTJv{ T%hSPտ\7{KKBǞ@(DKC d|<`-HNseLo1!ïߟ7=HN'Ě2)exG 2C/( 9 FI^֟F)Z%5t.4,|^SC:?Ȣ0pRx>{4/ ә??"{t.d684ϝ+ǿc=&c6p#.ų$RAA-Ej] P= 樰 R,1nEƙZ 5UI54TTGkrR;eTm  F\,!5jL]n^{ohW;4TwI9MX^*>jLiT4m`6H,t(mbԊ̥:UEtmpa|^Lu ̾!  |aww\$Q_Plbܪ| <*bOs2'3s9 endstream endobj 99 0 obj 1017 endobj 97 0 obj << /Type /Page /Parent 85 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 98 0 R >> endobj 101 0 obj << /Length 102 0 R /Filter /FlateDecode >> stream HWn0/\b c-E"PrEߗkDڴd%NQ䢘7qãv3jOfk4;XPd!&]Fo4ԜqDיX_9A6pB1ahuZz b o},uB+ :{)_u%lMBӴ!1e}JqNgү2 AGtvh9;jGwG33*t@i/*L8e,s_8J`SٳQ_Ws9u1 M9&}f0%2SbP֣B 8u'AyARsV9"gA9 s\F 65v q#\PR3)Te(}alJfoRÉ冪Xk3=@QJH 7/A\9²8I˒;ڼ|s{RV:ŴC*íCd9='%nuwG*Q "IzxNfaWŝwFc&s)?Qk^v9;%\)4ON@Rk~[O l.͗Mc;߇LS:*%q\2S['OO?h{N.aܼgdGlK1=-IJ\5ֺ:Upx9o* mz7©)V 'td%4bMSҀsj?H9t$#9X%9{Ɇj{fcn դ\A)%S`Nקr!ݣUܽ FMg"jr\h0q4- qnjB0zL(ݩJ>n V`rm҄phgGnçT0?X:^"gғ{듥v37&*b+\E4~]\wZ"n_}L endstream endobj 102 0 obj 1058 endobj 100 0 obj << /Type /Page /Parent 85 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 101 0 R >> endobj 105 0 obj << /Length 106 0 R /Filter /FlateDecode >> stream HWn7_ ǨuB؆HBMP.dȋbrs.3.1EJhL8BA.lzL]F˿Cs`XrrVT؊ ,mh  3?py&N)_?>MTƯ+5ֹq +,d=7M5]vܭ~`m,neW6smAGt9ݮzXC3.˿z$c=sy 1jn6 Hng\^,nڟ.> 찉oW#s91LsRJp,t9uQy1Ha9c u (X,gpgvA QF --'wqM 樎j#$B́{6Dhlm@"s.'sC% : 2q8!V:X\H`2D 3jtȜͷ2Z\wroq}O3zWq*wߞG = b/_#12u m*?cӧ>@;|?D'h#!a+ ;<޻ p*g0%񘼆b>)!̳'_C\s%>nGr'c;Fꎴ?*XEVj(kCl؅1B^wH(ӨxPRWfm죩I-Cmr>=9-n7+(}47G{(q<6;_1ln2m +sv&G`pnׇ_GAlu:((rցBaZK *] g*fU50=pLaaNRIbQ\-J`eQ.ojaI!A=2dU*&3Pai /#UgR1k;:)gHK`QrHEmEQf I$jc}bI>.">.ⓧOڽ|"r5(r+Ϡ: K"hYWUEH!L^+4.RjWB!ɤ5gkn4x@(-̗DJǵ+=lVCc2W9d2;PfuB TN4١J=h_S5)l|* g -r4qƚX" BB fIf endstream endobj 106 0 obj 1217 endobj 103 0 obj << /Type /Page /Parent 104 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 105 0 R >> endobj 108 0 obj << /Length 109 0 R /Filter /FlateDecode >> stream HWn8_pQuH>M]V@Ѣ/IamE`Ë$JmU<yqOFpqC݊rk򊾸ipn_74kg6]\%1;T SuPBPݮ3c>2+5?I%x& Ahz?h#! i!Zڸ"f) h`;Jk0pfl"BȉX^ t<FvOS* cp^xp`iWvy飃dR:jNO ̝ [A Mv_ o|[FOz3|X62+F3r/n.Thdݰۿ({ |3c4| ?މs=kBgmCڐo*NݽLVqxSU3_NPۙ'vRn`IXa K:(E.R^ H7J|:z;ݚPŁ5كj>-*;VcvϢyndv8cA ~u4{(#*9jvӳY,QV%=KҔXZWJ'g0q8$AI Fؠnd(XgcaGK̶}>;aGN,=HxKxb[Wurm]BV.,3E ?m᰹4,N qcif>;G{*/f<Gs"b ◡ŊK놏O+6k"]Z endstream endobj 109 0 obj 1066 endobj 107 0 obj << /Type /Page /Parent 104 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 108 0 R >> endobj 111 0 obj << /Length 112 0 R /Filter /FlateDecode >> stream HWn1 U:[J)"DV< ^Ғ PP ޲6jQ_x<>s*`Ԙ A9EWEI0LvUK9H'wP)EGij 4%U2҅ @n-#mKӓ3fz.w'W}XBEBy$7 _]>L)L \6[@Qd ;CcsӠs%icnuyZp̩[P~!\]5;4^:DV^JM-f*&uo) B0G,0SzкBrᖊw7^7杘֠Q5v^Fctipj)y!SdJ헩 A Nm\*Oye#(L%>n[2#:a0, f fl0$Ɂd.^b 6=qh{(u#RXF,3NԈyY--O5uٹBB.Vܘ?Ò 8^RtW&hަ%WI;@`0(X^> /ProcSet 2 0 R >> /Contents 111 0 R >> endobj 114 0 obj << /Length 115 0 R /Filter /FlateDecode >> stream HWn6"ᝏq]#A P% N[1}7Jʻv̙f%5(K$dsbސ%GU(S\xL6_TprAP E)ZDl W., BQmp~!XF-spn8&>o}Ϛ$"-ޛ䘈W헏A@uIu 翢w9+< h>mvuF8{=cZYmP RR=9֒.Kk`*&E1Kŗ>Ch BKVxF҂?9\n]h; &ּgpMJRC4f1DpXjjv>xAAdOV(8UbOǻM*">vdO,99^Ə}bz㘑ڟNXG?juW5,Φ :s7#C&n|tSDIbb(]XOX)ThK!8Y6M{]+1+̱cbur}r?y!ѕ0]JK䙪$tJ客SǝZ|"M;9#-wBW,2>%,O4C>|uTGJPS@4۲*}8P9pDgR rK.}Qh{?ܮ'yi_&euC}E!G:7>2u ijxa 撚z&RlHFE^Y[yuwsOEsu9 b MĮ aG8Bvn~/Yc)01z9l)_jS8&ZjVV5˕yqsλ5_o%弚7,֞?[=xBOMgj>f rh4sW:Qo%F2b5ƒa1c%_D^c>g]kVXIkP5cgl ǃ4$qV(2MU5`,ӓ:6ah* yYW<9GxGeu=^ՓuI6HuC▅d|;"$iRFO͘#ҍp̗#B'"'RMK$-.{ endstream endobj 115 0 obj 1194 endobj 113 0 obj << /Type /Page /Parent 104 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 114 0 R >> endobj 117 0 obj << /Length 118 0 R /Filter /FlateDecode >> stream HWn7þP,ᝏq]F`#)PN$'EB_^wI-򢘳3ggΛT+YU5+\juv FZ?oW5Fn~0UOcת{)̝\TSM&z_ݾj JrXz3b ouDaT9~a $yv8BU:jXZKe<EQ9CWe,};/2 #oKׯ.YS!:Kxe4/edH ~CvIFVnpG]]t2`5nC>V(ْ{2aklx%-}],9a> /ProcSet 2 0 R >> /Contents 117 0 R >> endobj 120 0 obj << /Length 121 0 R /Filter /FlateDecode >> stream HWn6^ Dc\ljl؆vfE!Eju겗&ȋgPr- "ˋ).YnU*+($yO??D rc(%כdg?Pp͹ͯ|D_~W %ƴ>-{%1.4>^߳!+Yg!Z.a^HMܺUx V~[&ʡR(Q[~m+!#b>[DA/'| imV/m1>vtp3 G^jGIAP +e]E>PZW;5(Dc D Nz$F5>UlsT/_$@իR1uB Z4- CIrQ r//6!5tr\:LfK#T5#p κzZlAbև;lbν]6" `'6eweeqY:̨"Z(8]^6ě)MO0(};T JwPxX~NeIkz^,|=QI<-; !tEÏdH Nq)NdibK ڜ5:4?D%Jf~4Uvseݢ[%C۟lk='0wMM(Z5]NQֵk=^-Ru8̝ ;H]]. 2I H}&S-MdT6 /7ىA{PlIV:ٵ.^^wtD4zȡ7oU0T^ f ⬕m4_+P~e/m[C [}5È:su$BMMUPuV@*|D]Nڟ23c[wϻ Aj)),.:h&])4q(weyTȤv?8KzZ%1Ȓn*ZTaȨƆ~\"d;^W"gu\;`{P4-f$aOV$KjL )ڳ푱^-9bkㅻ_A},33(IEMs 0Ƒv<,Y*?7̱ endstream endobj 121 0 obj 1247 endobj 119 0 obj << /Type /Page /Parent 104 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 120 0 R >> endobj 124 0 obj << /Length 125 0 R /Filter /FlateDecode >> stream HWn6^ X!ǸiE 苓:"]/ 2D(3Ùr&JKCV^*A{\-N~?}>Z5(V+gJjZ-) ;Bt%$a>Jl-qCXגYpk"Uw?Kj40hd)WoO3b;`~?;v,x|qin+Ͽg0 0s YόCpUc D~,%R)DhhZ%uAdJ⁤C Q> #o1.߾䑚<&ꏈy0Dr Dd0p?r`[(dd5oK`fImmPKOc[r\z1 !cjraIm^ėII,3>k3Y6^,Az;ed^ӉTTm=.c= 5Qr*BϘFB\m'D{S6?/`xd0WFYhz(k.o;Ph&J 8~Y}9qݾ"UUKϕ9ʮ BW k/OƓJOyP>KJVRdCV{E 7DmA֣s|CF.FRynĥ=ٴ> /ProcSet 2 0 R >> /Contents 124 0 R >> endobj 127 0 obj << /Length 128 0 R /Filter /FlateDecode >> stream HWn7þP,ːC>viUH i+ޕ~Y3sfϗ3P7(54mm3;b!Fٟ׳*rh}Y=(+ C(\]o# '(vDu2(l6|T,hchx$CEx,pZ, FRwtޯ|>bCaVzLz4o~[@r=fm4>_w~23'WgKW/sb(r&im,Y<>Jz`v׬R<^pݞ%!Fs bTA3!± q;D% _\ jwKrz$؀H7_GY~ݛ1fC vF2xУ2IfMV5c̩щw"qx/u}ݡZw1]@ )˹Nkg[@9yQ Q2i(ͻ0G;ٱd_d-Yr4mX00$q֔68RИtXkxpFg#"1(A\JQ"q#ydYI҇5C5c9Uԫ$ _EPu:gX5.F4ECsMק5wK]?%ucǧmv3ĽO{dܳ|d^3ʻl8ks3tcRMIv1.کH]۩P픩XFo>YH>'g 3Q'eP?b!LuT _nӪK֥XY;>ÎRxoXN+0S Qߪ&8V\o+3Ǹ=>zeX̩vz]dXT&MRoG]7IA%6FHj))s3b s5w)-mDHjFOPON ~ڿ9 esܗY7R7 endstream endobj 131 0 obj 450 endobj 129 0 obj << /Type /Page /Parent 123 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 130 0 R >> endobj 6 0 obj << /Type /Font /Subtype /TrueType /Name /F0 /BaseFont /TimesNewRoman /FirstChar 31 /LastChar 255 /Widths [ 778 250 333 408 500 500 833 778 180 333 333 500 564 250 333 250 278 500 500 500 500 500 500 500 500 500 500 278 278 564 564 564 444 921 722 667 667 722 611 556 722 722 333 389 722 611 889 722 722 556 722 667 556 611 722 722 944 722 722 611 333 278 333 469 500 333 444 500 444 500 444 333 500 500 278 278 500 278 778 500 500 500 500 333 389 278 500 500 722 500 500 444 480 200 480 541 778 500 778 333 500 444 1000 500 500 333 1000 556 333 889 778 778 778 778 333 333 444 444 350 500 1000 333 980 389 333 722 778 778 722 250 333 500 500 500 500 200 500 333 760 276 500 564 333 760 500 400 549 300 300 333 576 453 250 333 300 310 500 750 750 750 444 722 722 722 722 722 722 889 667 611 611 611 611 333 333 333 333 722 722 722 722 722 722 722 564 722 722 722 722 722 722 556 500 444 444 444 444 444 444 667 444 444 444 444 444 278 278 278 278 500 500 500 500 500 500 500 549 500 500 500 500 500 500 500 500 ] /Encoding /WinAnsiEncoding /FontDescriptor 7 0 R >> endobj 7 0 obj << /Type /FontDescriptor /FontName /TimesNewRoman /Flags 34 /FontBBox [ -250 -241 1200 894 ] /MissingWidth 780 /StemV 73 /StemH 73 /ItalicAngle 0 /CapHeight 894 /XHeight 625 /Ascent 894 /Descent -241 /Leading 178 /MaxWidth 1000 /AvgWidth 404 >> endobj 8 0 obj << /Type /Font /Subtype /TrueType /Name /F1 /BaseFont /FKJPOH+TimesNewRoman,Bold /FirstChar 31 /LastChar 255 /Widths [ 778 250 333 555 500 500 1000 833 278 333 333 500 570 250 333 250 278 500 500 500 500 500 500 500 500 500 500 333 333 570 570 570 500 930 722 667 722 722 667 611 778 778 389 500 778 667 944 722 778 611 778 722 556 667 722 722 1000 722 722 667 333 278 333 581 500 333 500 556 444 556 444 333 500 556 278 333 556 278 833 556 500 556 556 444 389 333 556 500 722 500 500 444 394 220 394 520 778 500 778 333 500 500 1000 500 500 333 1000 556 333 1000 778 778 778 778 333 333 500 500 350 500 1000 333 1000 389 333 722 778 778 722 250 333 500 500 500 500 220 500 333 747 300 500 570 333 747 500 400 549 300 300 333 576 540 250 333 300 330 500 750 750 750 500 722 722 722 722 722 722 1000 722 667 667 667 667 389 389 389 389 722 722 778 778 778 778 778 570 778 722 722 722 722 722 611 556 500 500 500 500 500 500 722 444 444 444 444 444 278 278 278 278 500 556 500 500 500 500 500 549 500 556 556 556 556 500 556 500 ] /Encoding /WinAnsiEncoding /FontDescriptor 9 0 R >> endobj 9 0 obj << /Type /FontDescriptor /FontName /FKJPOH+TimesNewRoman,Bold /Flags 16418 /FontBBox [ -250 -217 1214 904 ] /MissingWidth 783 /StemV 135 /StemH 135 /ItalicAngle 0 /CapHeight 904 /XHeight 632 /Ascent 904 /Descent -217 /Leading 168 /MaxWidth 1012 /AvgWidth 422 /FontFile2 132 0 R >> endobj 132 0 obj << /Filter /FlateDecode /Length 133 0 R /Length1 135 0 R >> stream H\V XO˜b;$K-N"Q"{(6/KRLp ]9u88}ya#:g΁@3 rCfǛ=[[!%&Q?n0ZԱ[U[7iE3-Zjmwptrnڶ]/;|ֱSgwO.]u񗞽{ۯ:,`F;'L [Ф`L 152jZtLl3gNHLsΗ\% p5JOWΝ @H DJu(7515729ژ:;8*U-riM>6٘LڕR=TTjSUފĊE*:=|SKD wku؈EXo?b Vcz!o2 `=~}`N8r1!XPD P(B1N:qgp1 8D&ʰ(DcbXLRxFn sd\rVcnq  8/˥)#.Qo`0u6ZKrTL309z.{ Ĩ4&(; ̥09UiOfdɚ\eڇ:EuyEx!kWT+l1 yʾ+s/]sELJh0`]#M.f7_%j(џߴw3Wv= dU/+M- qV'#яe6ԛ&-"ATY 5W.7^)`a4CHG%*"SnVҩգ&d"w‘%9-''|}JR`Z dGr `?sӍwzS5tQ\cDֲzbH/i)L-^K;׆*E0O5g7+O֢g5>9f9{t 5]aBa>3WPʹo=e&jI0:Y}ޑjDaGK4ZN9lkIcz1At>bG &@ "ۏ⎸/l$[K_Nd<,ɟmiQe&Gԃ}]ߩU2dv OF/cqqqXnT.!g;&hn"(ψxȢϛB$ iun|$ >~{r+]iM',WY2X ybN) s3AMMWz:W<<>YwK钋0BxtRuʽ*DU1Н:IeV=窯Ÿ/߳Pr~YMZ3k-,V|t_?x5'78)=0^`ݪr!>Lg=s^UGJ.R[q^fɦp|'foɎ<(3|Ι_gݝ]gvkeƘŞ&4ElؕIiKETiJ2\RTEcC&Vo<4UdONBJ . -{jHPݘݖRitb sXtdqBh)M{1Li@;ПˤCoi8uT*kHڭef4SJ3h9a,6\@HNcJyچGv,kR!FʪYAܟ[)%lQB! y9Ф@GBG2A)C%*햆05AUCO׃A fPN/7yzx@5M1ֳ1{8NG9E"ipT$S'%H= f1xi0#4k]TN5c QRZ"#D!͓TcɲHSĜ9>v|{ST)`( |Ķj"sVxCב,5Rc͚{QL>]ݬ63ԥaQ{z焌Z\m ܊sMT UDB^dF'2+EEFlfF8Eidev!YMg}$.im='lQ`&# I'e 7-^|b\Yxps²Z6C,MVKEǡӇ V*uQbYU9 DI aiߌ+I紓8zop}:,/UO.TOA~](`u`-x0&u4ZM ]16@1nrpƦDRM E$d箄4RM5pR5'v*3{W:d\!SRߐJ´0d8GhFP}s--O1k{\hyܪD4uZ)FAb]T/E$b;l0|~|cЀSU&<2lx\ƒx? W%߷^tҵԞofd)/%a9ʊcnϕ+&鯟גZkEr ;M'i_U ׯWˏs/U?])?"t~Yҏ¬rȅȂ  Q\n 2ZagZ:v֍.AB>@<`Xcz"x4$Cy0ָOlut{Q?WW¾`M[f/fbȖE~V_07`DZcg<~Ό=0.R<X&$5M@hC6H`Hai**U`q@)D-$M jf&ͪ!+6T`J^?=%w/IkqT Ka BF?<,$l革7R4UMEFOGQn@a#5 5U Νa7U^ەR.׊nLtJYtS*J>Oȟ3?ڑhKJv!iN">V>E'OͻWXږE w?~bGPv+3б{ًzx;g3/?v"Erm )uiqmqkbk`l_Xx|q a fxFwġ%:UOL?r#xN79G` 5afp6ihk Q5)c=4݃y1.1ZhδQFeV,bFRgp^dĴ+_qhpt> s> ^{N~4hK >6=nU٫;~r_T:urnjv@`z@<%nCY4Q /*J8\8A@P +p sD5WAeH\b/Tx*atAGPu4iʘ nNC0"饁"=_U:61$<º X;Kn٭_>4 pJX0 $Vq)IdY `d,p`Wߥ4Bu_χfG:!Ѩ + ˧HHp W'9kvY`1 ]`]dIRCEa*5LL|nsQbzB9U_q^/NY(13͸?R\XF-jE-\,\=\-.3\S8RO_+`rfO1jV& y7 LXx˞7xtŖyK6[+Chfp (?i盧Z<]Øx~߂9x,:I%۹| , VCCrb؇ qMh5)b5T3dP 7gO9ԩ9nb*8;Zl/nL*%HDhCj],/<` j_g>d͘']awEas_UXxPO}nG`?n?y C|٬15\E5HU7LBiD6ϟj].1D֛J (j B"O@J!Co+7Va1KQ'.ecq%^ӀO/@3q  GqVWlGN#ȋ<&Z}XTfKNSR^?O_H*'8L&|y^y< t7DV ,nYbH(q,Ҩ ;KnC!/ܣv|1B%f<%0*SO)cKl荁_5ן}{ڤtkwef%u/{ޑ{ @[գ޿PFg=Mjj_g"<"U|*/ԃ_A%bi"Y РXdH.\wҸҳ-rwj4'D_ucw)j@'8jiWnune%;_ ^$~3]K'~:4lյK?9*y*NU >v<]o>?|f+Y[p-fw18ʿB>5 Ƹ3#ߴiJޭ[1h3߿ţ},ĩdIx4Յ2oиsGr=f|!f`ftC1 ei!%ro!&7d"9JOoߢ6Q]6۴E$I˲p;%dӄHF%1!(;e=^|WP͟rRquE:]N5t^_w]!}\Mϰ|?7B0=bmQ)X{=F(V= [.\jtH0v̷&ɚ>Plp1985U$j=3/f+nzܽ`q{_6(A`=mޥ[褹2_[Xtt.L{1Uv<vA|37!)-)3ͤLu d0ifѬӴnbQƱ?q$s|!3cawaH(^YֺR)-.jN iтAu4)RaIT䘅4i;vMj|d0`w:"&: mH{:u+؂TNUp%yd JEO~6/_6` BwQWq ;cR "YX q +ig>Hƹ%U1v_@}}r,|XO6b2ѤM2q,sm lBOMwZNp 3 r0N:B`hC"1e#aLym\$ n _+pS-F#ʶ)d$옸]Ŝ$ XCy;` \wLS70>(iABbhW5Y|W}lS{~q$!$N"Fؠ ZARu0JU2}dEkJ?lk$ aZL M][uUGQH`}\@Ə^?~g垬2A+W~f%oh 6։?~&3I]ś?W8_wb En]kԨvuJei@^բiZ,KAgOODbp:ha:K|NT6M˳FX/ã./r#F) X4sèw&~nb ?Oq7f nȿ&ί(&pbͦ߮ ]۫߶5R}),.EVdI"ܭ^-!y).,DwXԂ$JW\*F\s.+l30ΩC-;quvh E-w s^AkU>'}Ks>=_]xw]X k!2A^Yxa?W[ 4Vt ]~ͅ'`O#BAB:iY֮!+uBi(Wd]KYf d n >!"VvxxRfa4:h/32Ay \&uor9{}A,T5lֱPG%b}j#3 nbC։tf  9nεU}1,rEh}aT%cIڭ8̨#;LXв{mwa 5T}gpͺwD vkzxvE1S0V]weϣTԖUIۂtzs"9ax&1N&&7[naV2%h&D}\m,/BQN d*dGNY̯k7QS ,o y Ӊ`K;|󧂉`"s}|DLy_߱=1-1pƞюJvg,&o|LrH^q,6Ai&3kHy9ս3d[C f~K4F#$%]d9F +G-ql7鍈aqp. 2lw-44KPO,l>"Šo0P D0LaBLMP49H6 #hu>Z\2?C+E ([ޅڲM^\nvx?⦸i6x,FU ^x pa}k+Yuwe܏XYKMaU=%I7O967hT,y&"Dk4/;4VQ*UQb4,rD#^ TB~Npm<L@BDI#@"_Fxi2<:*/Ÿ,&Є'mLX > .aLű qX'dil4vAzAeDWIaRTϐ3*oUj5vqvS8G-mEQ8c5mC[)rH ^);`p]^_ 0t4S@ 5aD6yY2қB Ujc**m6T݉;oMY-+_oFsV:֎Au~“(+m|uYz?~|Ur:X@4%S+6>3_9]` @ُq/4L񆋶ɗ2S;h!eǣ_n8:$O ggˑ!Xl5|9D""Ȇ,RR"HqJY5ʴ}Y҆kkLIML!&rҗtd( SK:)CV8B˯( dͯ| gr٥eA)׀:S6OV|Ή_9b8^ؐ9"<2-Ҥ%kSG_! zt[l}l˶ y! G׏?Y=EuDic88w_~8ݽ;>Hup1 $RFZڪ7$i [ *aBŴѪ41-uHTU7؏N v礥4EwyXgKbXȅu-4tLܹ~h}KĬݶTm>8G&Ծf;bțq,_Q>Q>؂9n߱c CP~oHdL븎>C}I6ełf h}`q^yEayNQdU|(g7h 0`R0L >ԞEmF9Wd䩈ݹh|Ҳ$_su Yeل/%%WCo0vV҂gY}H8_ fj1Ed̓8}|pNqE+2- ffvL?ZG)GKDxX%p 0ygFaKOscc؛&ozҿ /&3{;ڱ}wq㻳/gb_qb_@UhmG M[*ZҲv-bLbƯDV`E!UvӺ mմlHͨ6p{@c^<+-.[ap^lV}}B~iv!D[ضܞ&:$<_m'j=`'j/}.(nARe3~paul R Jj$ܲ##69?_Lo9zr~oy#b L4U9!gr'T {P;RZ:*VEQ('Ǒc1F(B/9gqtpN 4yJ{bMş**v`2cjxx(vd(6z%4#ܓ0daPR REAɩhw>/+lս%$ J K@}S]hŝlv2]H>u;=n !%ng|HU3HUY&?QAUq]I65D9?^8KqH'P(~'T0 8h"> \$<B3Pv_ܼi5Vaf@HN3Ms ext([Q>@Aۓğng;Hn6##oax kw} ;`ú ,qX+ھ]v[vi-Gf?~8I_v{}ujvav3;~̂YA]Xyxpp-s5ҽ͡H@[|~P\В4Rsb)V YpWsF8)j Ō{/e}9w;'>g؇HHE11 (eubtlHT0M0MikmѴ1eդ5w6l7tc<*!5r~)u=S;\͓&>d^g^C,Bk 47w]{z?Dw|ۉ?yltS9>5{J`eX ^zi{vtvY$RNJpMx?gIZ}lU_8kTA ws1QRO2'ģ<jja7 aoƴFNj3I ̋Ư>*X{Qg _@`VVW!h8JX"F,Nl`F^5QA&%)m6)N*3%vnO&weye޴Oy?}!m? qLZnN7}ty!TGMyьÐwQLmO,j>˕/E5=M.9dG~07n/A[<-}][o꽘xTs!7宲k5~ηDO:WkkQ5vCjj35v+P7ms) d冐@K=8LCg&TjM]Wt&dױ7|<Ѭ)EerK($$]gc9ҩ* / :JY,cU']y]Sf@l~/I8 Q"L-/RTVq\p?F*/>`}ce{3uuݻUkqY75?Ǽz=qYp@ uDzD Fw"+jMnÍBT̻@KY*7ݎ#-~)^SxiW7=0azRlњ5/ԇ"(U0zyNE43)\PT2&(xjwwPD톟vdWpYCiYRY0eyuB5sk 7'c~S $Vy~@Mgݒg"Fn~𲏍۬ߝr}/>ߋ}g\r/אkKr}IAWVQvb+( p ?V Iaj 5R^R#?FBU@{_"E=~>ߏNjoa0ާr#E %zRY=WYHH\>H*` 5zP?G i{AGX.,R]|c1.x)%yy ;cUlKlDWv% -J yҼL)(g%%XVFEX(&7 wk4?l͵YFH =V Ԏ'=AG ]"at23M175==ɮ=J3 b5wtR9e>9\ehtB6{s;g0u"rJoX0H3 SߛzzsRN,g *ttHttO|ٝ,GDeE抹jMk!wP|79@z}C\\ϯs\ϯs#S:} Cq8 z6D~8g4}")iU%^vZնIϓGv kzQ>>S/̷l?̝w\]Wu=}Fː:'-x," Bee U<;I~]݂PMQ~knGHU%ЌؓdY9``)s *Y(붐VPOTRlHN]*ADŽfXChfV bl_ߦTl|k n1A~3N"(+HS sC i|ȩwvHlsQhӁ+_o}'wږCJ+;"2:B91TJ LOYea,&X/_et9)@1ESep7ߏLZfyd7U8UYЃ2U+BG-c^l*[b?őbg+˩ȩK/{Kd7oY6`̓swYRR,C0v*X :-@:!tG;vCeQ"TMʌ&ss;-+u4hɰa6;x:5p- V~DO3FeŠޡKM6f[jX❦Wa^F O~޼ ro_`~6Ͻ=[NR{ʭxuVO-ŜRӽʲ!xXIeLlݒVIl.6",P]r^fɜ*9ʢ!i NB~? PyO%sx ]R.O>"%OTIsu)ʞzuA~9Gܶܗs_˝ˉ9l Y8ZԟJbI#M"'}=,>ӋE0)5cEwG O "\o$N>ދ cn<Æa ,e `@hFaH> BTpsh0~ꆢ\PUIb(Y,dusajLžܾ9 \Ѿt+*K:KYmE :O\3p2KGH3p/4>wƋG6 JoD.yisp`<~xm1]^=k}g in8x?9jwϵ2q' 񑓺td#nGŰ)Ik8S:6Ad(Y VgnU<)xe+jR}~9pWZ BeXÌA Ö˛Ac38_ʊ䥩M~|zvl۴`$63,Vj|U {h_8-`KGZ;X.sVQC1Ӛ" X, MVI"(@$b""м/2/2.2.2.2/2.2HewEȉ 7iMk 5_H׻aYk@xuhy'-2 Îw4n;*fWsk@FPc>2dKeo FgXn 0 m@mvF.ohmrz`蛛&K'T@kK2]ў޿a͓8M1]꟠W:j*ctl9̿P=Mג):vwvu|;P p$դGɨ}Ӽv2{Lٳv[!!<@ʇsԐ;I$#~f ٟ MBi$96b$DcU=ڭ̋AYOwZ2HN溚'<%jқT*%; p}]蛍\}b8+7>cFf[2 ՜wqW#qWL?ƿ͸.D֬D,B +V&S[8I!,/Ȝ dς.#X \ؾ`Lsʧ̝_@e~HhCL]yN5qF<8# @q߿jQ 9xNY<]~z%r'$ wgF.O^?K|h%I评 ׂAPhW bv N~ *\#d'ASM!&PfzQ@_|yrCnE<\ |g!=ʨa{+fL8W} (ƤkڬghcI>R@: '=9 yq>ElƼc{s_e{O\vg͆ok_!Ӧ<(sÜ7>_NRyQ;|1-h3Δǵd ~kYa mL6sbD{у"h_2t;3zAj*ݻdMi) l–gZڄP^Cgnɒn4+"jt:Sbǡ>BժѪV[EhEVKeS!gw;;w̑qZN}jN pM5SOŎOMs%^ai yR键wa2fkz.(}kL@=@.6J LaZ1c `Y|| [[P}puM5D%t@t %ֲh;ζq7օ}i^#@g3N{uh'[;Qwiނ/c _{ԡgi1/:oRk9s+k!>~U.A=U[4 %ܵWcHp %+_Ҙ|w25+~`8ޥ sS; G5ZU♢q M℧G26k.oޭޜ kGr?Sp5.?*دlBc/JEcׂJOeW|m+k={4V_N~m++|UW]-xڪolvG D2Mٖ%P7hֿjTxFqR-XC(hfg?2;#= j_ױi`$12ҙ+ }5bEI)fm#=`&ʹ#}T:bGf,a)eafsS44D،S~昆Uh:t``> DjHrn!z #UW%9XpV鉯4vO8>Rľ]F寉I]R RZKh&VE~L$Lr\$Z)|55-3YleR寳, qvrMmH˪NF;O(N4NtV/:B,**9SKr$:a>S<% ͔#7gɍLZk˜%kcb2%>aAZD2~.\=#SB;>JhKyMnNjK.!1]ސyɢaPv>B{s}9~j9 'yt}{ǝ KΈM9gwkFIZ?96&9*eEJNY/qwt)|fL(kUlT`JV:P^G8h).֍g:FIhK^Aq|raaTm!>;EFeJaPIrL K~eD1ْ, ILFHC6נӔo=>PߠtŒ (1-@٥f))sG+;H$r=.kțzʨTՒש:;rSR)}Ny*M9K_MJ'08gu6bROgݳ+u}UEz]Eb2?)]<_%_|!sW[ev0%(E|(GD$2ra2`*ނiq%f_x+,#ǰ~EQ~WmlS>\61\׸!Q Źvlͽ쒑*OA҄H&Bm1M]\T`>6Y6C(3[iT4ئvݖ=8V:y,u=Ȭtߺeݵʖ1M%dv)ȏ|NoǕ)kκm)SsgiZZz,}4@6Q(*/).MiPڕm7)>S_7+sE{}]uGcni{LN}M= t`Ǥ痑"pZ8 &Sz:Qx0އn8:1ցb aan8c=su1l? 3wt:<fNfD+]Π V3 RwRw:=h8 =)=(hhMzSPD%Z-iUM= 6H;!M RcPd<%㼭Dظlg\1 xFz v]{c8/{z't]lqx>c[rZˣ~d ;P%#oI ӧ꛺(g_[Bw$AsYX}XIX}#~7^Du檐aHuHR BjwHRTQxTV#|(3&"4TsA59+?*ė%6_ڠjԚ xYr1J97ZAY"qk h5@hNi%]ۻ潂r8¾yTƍMZ:n׀r17>t i_}-iHRu.5]ss܈F :ׁNs5nM!oDeWHDrKdVAy:h?K<ůĐᶁp|De4̏qKl$⍤h$,&7!s#j+mQ1mع-X+k46D"!ҸT4( VU+I\6BFP![f,':qQ~/ЯpYR= h\Em8\ӧʸ}`Pg:GB6ijy4}[fx'e\;-0gǵWr z&ωHtxZzv?aymȨQQ!mѥÍŚ~{86ˎw׵2/e v .`3~MX#RO;&k_n6uxy<;=Iwyj=+^ww./Vd/蒾 WM2 Jev$XYr62sW6O9qOL_x^۟p$u*3$3Y þQdg@Ċ#{Px!#U#囶N_ձgF5η3;[59I8 5vG;{bҩ젠\2<ݗAYHX c$.d1%6"<4ۤ艒"$퐢.4 +;D Y(;$eBDɎI)A>$ۥ"\~9R6J"BENΦt:'GU;}`%>{?S|[<ɦwfY?̶'z|gj=Hv\$(jm|@xPZ֠*ke4ә{I2]I+%ql>"rR=0O'D-tbzn1r=IS5<|xhեp,-  8b%-ud󖕮ޟ 0?)߱Jc1ky௒~j/,(OӰyy/? IV)ƧqhM[N*zeQ*GQ1"w endstream endobj 133 0 obj 26752 endobj 135 0 obj 39625 endobj 134 0 obj 0 endobj 136 0 obj 0 endobj 2 0 obj [ /PDF /Text ] endobj 5 0 obj << /Kids [4 0 R 12 0 R 15 0 R 18 0 R 21 0 R 24 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 28 0 obj << /Kids [27 0 R 31 0 R 34 0 R 37 0 R 40 0 R 43 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 47 0 obj << /Kids [46 0 R 50 0 R 53 0 R 56 0 R 59 0 R 62 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 66 0 obj << /Kids [65 0 R 69 0 R 72 0 R 75 0 R 78 0 R 81 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 85 0 obj << /Kids [84 0 R 88 0 R 91 0 R 94 0 R 97 0 R 100 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 104 0 obj << /Kids [103 0 R 107 0 R 110 0 R 113 0 R 116 0 R 119 0 R ] /Count 6 /Type /Pages /Parent 137 0 R >> endobj 123 0 obj << /Kids [122 0 R 126 0 R 129 0 R ] /Count 3 /Type /Pages /Parent 138 0 R >> endobj 137 0 obj << /Kids [5 0 R 28 0 R 47 0 R 66 0 R 85 0 R 104 0 R ] /Count 36 /Type /Pages /Parent 139 0 R >> endobj 138 0 obj << /Kids [123 0 R ] /Count 3 /Type /Pages /Parent 139 0 R >> endobj 139 0 obj << /Kids [137 0 R 138 0 R ] /Count 39 /Type /Pages /MediaBox [ 0 0 595 842 ] >> endobj 1 0 obj << /Creator /CreationDate (D:20010205135426) /Title /Author /Producer (Acrobat PDFWriter 4.05 fr Windows) >> endobj 3 0 obj << /Pages 139 0 R /Type /Catalog /DefaultGray 140 0 R /DefaultRGB 141 0 R >> endobj 140 0 obj [/CalGray << /WhitePoint [0.9505 1 1.0891 ] /Gamma 0.2468 >> ] endobj 141 0 obj [/CalRGB << /WhitePoint [0.9505 1 1.0891 ] /Gamma [0.2468 0.2468 0.2468 ] /Matrix [0.4361 0.2225 0.0139 0.3851 0.7169 0.0971 0.1431 0.0606 0.7141 ] >> ] endobj xref 0 142 0000000000 65535 f 0000086322 00000 n 0000085154 00000 n 0000086717 00000 n 0000001312 00000 n 0000085188 00000 n 0000055348 00000 n 0000056468 00000 n 0000056747 00000 n 0000057884 00000 n 0000000021 00000 n 0000001288 00000 n 0000003138 00000 n 0000001456 00000 n 0000003114 00000 n 0000004799 00000 n 0000003283 00000 n 0000004775 00000 n 0000006389 00000 n 0000004944 00000 n 0000006365 00000 n 0000007879 00000 n 0000006534 00000 n 0000007855 00000 n 0000009366 00000 n 0000008024 00000 n 0000009342 00000 n 0000010910 00000 n 0000085305 00000 n 0000009511 00000 n 0000010886 00000 n 0000012539 00000 n 0000011056 00000 n 0000012515 00000 n 0000013868 00000 n 0000012685 00000 n 0000013844 00000 n 0000015263 00000 n 0000014014 00000 n 0000015239 00000 n 0000016753 00000 n 0000015409 00000 n 0000016729 00000 n 0000018018 00000 n 0000016899 00000 n 0000017994 00000 n 0000019831 00000 n 0000085424 00000 n 0000018164 00000 n 0000019807 00000 n 0000021217 00000 n 0000019977 00000 n 0000021193 00000 n 0000022316 00000 n 0000021363 00000 n 0000022293 00000 n 0000023463 00000 n 0000022462 00000 n 0000023440 00000 n 0000025081 00000 n 0000023609 00000 n 0000025057 00000 n 0000026318 00000 n 0000025227 00000 n 0000026295 00000 n 0000027761 00000 n 0000085543 00000 n 0000026464 00000 n 0000027737 00000 n 0000029264 00000 n 0000027907 00000 n 0000029240 00000 n 0000030646 00000 n 0000029410 00000 n 0000030622 00000 n 0000032010 00000 n 0000030792 00000 n 0000031986 00000 n 0000033290 00000 n 0000032156 00000 n 0000033266 00000 n 0000034770 00000 n 0000033436 00000 n 0000034746 00000 n 0000036069 00000 n 0000085662 00000 n 0000034916 00000 n 0000036045 00000 n 0000037492 00000 n 0000036215 00000 n 0000037468 00000 n 0000038768 00000 n 0000037638 00000 n 0000038744 00000 n 0000040184 00000 n 0000038914 00000 n 0000040160 00000 n 0000041457 00000 n 0000040330 00000 n 0000041433 00000 n 0000042774 00000 n 0000041603 00000 n 0000042749 00000 n 0000044252 00000 n 0000085782 00000 n 0000042922 00000 n 0000044227 00000 n 0000045580 00000 n 0000044401 00000 n 0000045555 00000 n 0000046803 00000 n 0000045729 00000 n 0000046779 00000 n 0000048259 00000 n 0000046952 00000 n 0000048234 00000 n 0000049888 00000 n 0000048408 00000 n 0000049863 00000 n 0000051397 00000 n 0000050037 00000 n 0000051372 00000 n 0000052961 00000 n 0000085908 00000 n 0000051546 00000 n 0000052936 00000 n 0000054488 00000 n 0000053110 00000 n 0000054463 00000 n 0000055199 00000 n 0000054637 00000 n 0000055175 00000 n 0000058200 00000 n 0000085058 00000 n 0000085110 00000 n 0000085084 00000 n 0000085132 00000 n 0000086010 00000 n 0000086131 00000 n 0000086217 00000 n 0000086818 00000 n 0000086907 00000 n trailer << /Size 142 /Root 3 0 R /Info 1 0 R /ID [<7acc2bafb23ee96bff6390c58b251cc6><7acc2bafb23ee96bff6390c58b251cc6>] >> startxref 87086 %%EOF periodictable-1.5.0/doc/nsfimaginary.pdf000066400000000000000000000504651310514471200202620ustar00rootroot00000000000000%PDF-1.2 % 10 0 obj << /Length 11 0 R /Filter /FlateDecode >> stream HWnG üPQxs%AQdT(2}9H]9r^i)9(ø#V ^p rrzʼn0~??KOLg+i9[%竗'rzrC>V/jIfM~Z.ȇj<~LB> yϤxNMA>ӳc-QeK[#Od&Sq F0 T&bm$b[FkǙsmbm5s\;>kZv1ڡ d2^wH304si.By"s4pT~aLHM^WTjaS^ $0ESiD‹Yl.eB5"9C8!ěc$|gO"P-P,ꄑ|wXCTـ**hO,D]\W4"n'#4'N}׳ YP^~*ipz8( =I>7z3ոWxj[ —A DOԤ&B &R75Z]Iz'[K_sW`[NF beg- l3, W}2SrAj DIvp,-Ͼv 4˾A` VmĢ %_,m%yV6.Nq[x6Ong *MC $e V"Qp ? =9Н!;7rp48Nnx6GѾyDZps MR-%b *lcN.7u։ۗžN}fu8*Muρua_U*vƼ+=Ym-hVZؙ#qjG41xh[7׷&a񢚛/i.Gn2koԻMZz~GQ5лZdv`(2ʁãҎ6B76PCvûT P ZOT;Z-g&zߔΧKE-u`C*ҠNjO1?D%a)iX4l=/ nHe4]XA? r_)]0I+=#tsB3aJq^0/ R1+awUHx3J/*94)d5' endstream endobj 11 0 obj 1289 endobj 4 0 obj << /Type /Page /Parent 5 0 R /Resources << /Font << /F0 6 0 R /F1 8 0 R >> /ProcSet 2 0 R >> /Contents 10 0 R >> endobj 6 0 obj << /Type /Font /Subtype /TrueType /Name /F0 /BaseFont /TimesNewRoman /FirstChar 31 /LastChar 255 /Widths [ 778 250 333 408 500 500 833 778 180 333 333 500 564 250 333 250 278 500 500 500 500 500 500 500 500 500 500 278 278 564 564 564 444 921 722 667 667 722 611 556 722 722 333 389 722 611 889 722 722 556 722 667 556 611 722 722 944 722 722 611 333 278 333 469 500 333 444 500 444 500 444 333 500 500 278 278 500 278 778 500 500 500 500 333 389 278 500 500 722 500 500 444 480 200 480 541 778 500 778 333 500 444 1000 500 500 333 1000 556 333 889 778 778 778 778 333 333 444 444 350 500 1000 333 980 389 333 722 778 778 722 250 333 500 500 500 500 200 500 333 760 276 500 564 333 760 500 400 549 300 300 333 576 453 250 333 300 310 500 750 750 750 444 722 722 722 722 722 722 889 667 611 611 611 611 333 333 333 333 722 722 722 722 722 722 722 564 722 722 722 722 722 722 556 500 444 444 444 444 444 444 667 444 444 444 444 444 278 278 278 278 500 500 500 500 500 500 500 549 500 500 500 500 500 500 500 500 ] /Encoding /WinAnsiEncoding /FontDescriptor 7 0 R >> endobj 7 0 obj << /Type /FontDescriptor /FontName /TimesNewRoman /Flags 34 /FontBBox [ -250 -241 1200 894 ] /MissingWidth 780 /StemV 73 /StemH 73 /ItalicAngle 0 /CapHeight 894 /XHeight 625 /Ascent 894 /Descent -241 /Leading 178 /MaxWidth 1000 /AvgWidth 404 >> endobj 8 0 obj << /Type /Font /Subtype /TrueType /Name /F1 /BaseFont /EKJPOH+TimesNewRoman,Bold /FirstChar 31 /LastChar 255 /Widths [ 778 250 333 555 500 500 1000 833 278 333 333 500 570 250 333 250 278 500 500 500 500 500 500 500 500 500 500 333 333 570 570 570 500 930 722 667 722 722 667 611 778 778 389 500 778 667 944 722 778 611 778 722 556 667 722 722 1000 722 722 667 333 278 333 581 500 333 500 556 444 556 444 333 500 556 278 333 556 278 833 556 500 556 556 444 389 333 556 500 722 500 500 444 394 220 394 520 778 500 778 333 500 500 1000 500 500 333 1000 556 333 1000 778 778 778 778 333 333 500 500 350 500 1000 333 1000 389 333 722 778 778 722 250 333 500 500 500 500 220 500 333 747 300 500 570 333 747 500 400 549 300 300 333 576 540 250 333 300 330 500 750 750 750 500 722 722 722 722 722 722 1000 722 667 667 667 667 389 389 389 389 722 722 778 778 778 778 778 570 778 722 722 722 722 722 611 556 500 500 500 500 500 500 722 444 444 444 444 444 278 278 278 278 500 556 500 500 500 500 500 549 500 556 556 556 556 500 556 500 ] /Encoding /WinAnsiEncoding /FontDescriptor 9 0 R >> endobj 9 0 obj << /Type /FontDescriptor /FontName /EKJPOH+TimesNewRoman,Bold /Flags 16418 /FontBBox [ -250 -217 1214 904 ] /MissingWidth 783 /StemV 135 /StemH 135 /ItalicAngle 0 /CapHeight 904 /XHeight 632 /Ascent 904 /Descent -217 /Leading 168 /MaxWidth 1012 /AvgWidth 422 /FontFile2 12 0 R >> endobj 12 0 obj << /Filter /FlateDecode /Length 13 0 R /Length1 15 0 R >> stream H\V XsҐGE8=PyII]tRz RW5~GR13G5ͽÝopq^>{ZZH sj'~rИv{ :"/tFEn R#':}'NNn]u 8eD5ЩZgH~P{aG%2&!SXg4yo& M!1*:7-ٙ>?@@OvHFٶ;{CGVҨBj]LNzه܍TӶ>_6 ˙)5`aEZ6ԭg[AFv84mҢe+m~ٮ[=<;wڭ{z~˻w|8p@Æ9jƌ!11rRTظ)S%L131iVrԴ9s_p%K-_XβX9ks׭`o-[m߱s={=tcENjKN4\Ƙ`fڢi>3G<&Gz$c?Y.;A4RH;UUGݞly?~sg^4n3EH檽V]9gә=2/l?P%n4g3-TjR}2;uaϒ =M-'}JR\ bG2qc? |ӍozQ -t^\8r|Trzg lű.b9$ 5cM=ɏ5SP&m "]g ;Ld&˦+7+vWR|Z}*w6{f09svV.Uxh a $ɞ-r"gjE_wh4ͤ ʢtQU ‰,8.^Ji-LkMAK;G7 c +ad1oPE3ϖss~r׆)\,yC\g. W{#;`&xdLfx gl?J2e@ Ie[ ٣@1VP1W,GX~=X|ud]\DXfȃIZjޚ]n=X՗[mz^+Cahml 47.11U+?[ʝEc57IJߧDAdS]` ,I)%S>'e'W+\eZ).a :aGemvN۹M<F}^0AMkzG<|^~;.J!ua'>`&*dޥqmܪz /a!h^p?'?0G`rzQE\3kMTP3nW/ǥh匹[es_=AΣw›ld՘kp.ת:jfWKFUmz.Õ( Bs4wr9:jkfֻ3_Mv6쀽[5B]ĦkDRTJHG@}BViR`(iڠ"?TSY?jR }k8v~q=s!EQ2M?ٱ=hkmi^E^uTTMu8 W9v9vb61XJPL tӦN~``4 X:T2Ԥ՚ hʢ9)񘔥vJek{Z݀eH`ᒔrlu:i#C'@' MFٮQln0J ў=Ӷmg{²\4ܽݨQCuhnj,# A؄z̡=k׿;1} > h$LΟ\) 3j60$餪+ 0%\IҧI9Qk,);w9$N7A&jhr(\_BSY˄izԇGƂ\-F9~ѱv +@zw,{͐WKԡ7HjW0J%xᨤ>Btϫ9KK{tr ֢QIOk7l\o2y$}h e= vl{~Оe4G )钉'L7ffkXPҰ_h]y)|ۻs(X-!;τ"aƐBR^V։K3Eg1z_j48Xi\ib[p9W}}9lL+~f<ʀһs:VrpjJ9GlTdKO"Z^q*N`+ն OZeƦT!iAib$Mq t%MU(Ee> ٜL)fL2g>X-f$dHPMҶ7CxxldkYǠՇ:ף7%KXtnoyaBa G#2_7$pL >[w#H/:fdݦ&T&wܻ1A:+-sW%42`[B ]딕X1)?Vnn齉A-z:htlrqP pJR  @[p N4lymevk ?\gu ɔXgX>QDۺԺT{oKdW攳Ͽ `wX< LM'?>}j>O :Cn+9Weֿvw~{;n虾v{ge蓷쳋o&_xwSBt9)wBLMFNT'qXGL#;KPw2Dc C(0Iеco z7[$.beL[[d>~?8%Լz|_ #d=dnHq? 23稹o!H: >,< #SJ af1 1q2#$#$f4;{7ά/Dd滏[fU$ֽADnG6|j7V7 Q$KG~(ֆ6 X? vxp,fχ!hip^*Egf#ȶ(!퉶TO64:kcDVR_J^7x9D䎑[/4R]ћjP01t812qlr8me\m5e\w{ s*`=fbxV #3g&߳V5=b| csȈ_ }4dfp+U6Epgl&BOXHAC%sF|g'_;@rˊ(۞4|J%8V Tj]6'+hA%ᭋ[qNoE0]z{Ys\O Tvx5QԈN89VcxNe9"L9sP>%=8c l@eCLXl]+Ӝ±((Y 7+dWkl%JMa"EeҦi=۲(6'Ҽ5dmtIl]ΩC`-(Cҵ]n?!-X= X7~#eߥ5 #/;\]C ք5cn-ZK 6Z5OZWGIwVH k("ȦU@<לwXRT;rY@ 7A`< UA7* $.lQ$kL^:Rߴѭq>P9Ef,i/xVhLX8KbA6vO47Ԓ*<ًRZ/|o{Gqi=!59S~ x^!Z=V+D=SITEKO=sD޳d^J}xjהּ96Y4?_j؜RPo>g׷oԆAJw}7v$Jd87P|Hc !nlӿ9c <!iZ_0nH0 o k5.0yA]^Ѝ&(2ns3a觌@PGFfe}Uu:2ayi |<_iAn(:xH~L(7i5DFp3Mpsj('wkVV@609U-*W`UYcuk֙[̴nv&: M-X$J<)gf52);L-^$O֭.т/BAᏃ;ʼTXde%(#!gN`B\3\H Q4/`U >A*#)W>7zG;0(0 uU_ h U #-㩡\X ,zgܩZle͟*>N H-elwfi8ߧ/.!c9t%2Cj f( \M!Rl8D#8o3043?b`&"03n( pGseҍ:D\ V$"b4G;3l-?$ISrn%O nTЈ?sSo~Sk]|2OM&s Zr`Ӯ[D~ J6b J) h9+֬/Xyx6ŘMr}7u؋6U]{Ğ_ vnnF\ZIShq/wOzj<" y[RH*Oڪ\U}ϫ!xɠ;fH7f% ,4z#,jjVP!c8w?>gq>K|q3NH@)+5P`0  )FTtڊ!-2t4 IumhLѪ}´v)5$R\AQ8f4um`bJ?:|uzC7=LS3ηt\GK`Yl)#W1C?xwO 9r z{6v2:+'ʼnU{|Vl_LLiW_Xhjw?)t7w#-ҋ-t<.Jˇ܇<[Bx,] ""+`X0tREQ)/^섉At HYw6.'f$(7ҍ\}8^n6 8x_L%ޙ$}#T)Q3f,'8ysH9ai]l!݌-,xoi[ojwFrjm٘Աa1{zG݅Xk+{6\+cd7B%PΆ6KoD sIy sw+osg*"F^zRO0?#N!mR+b\%gBCuR<%ry$^7./$ΎV7); p8^E{Q Y~:DKUtj9'Q Uc! ĔZ1rf4H-ctL J JMh,J!Yuq E#0PDiT2!R=<9+#BpV1Ec}#}[}ƿdD^ϭVwvzf=/jb@di?og+:-'Α6[χ̀2"]f5l qf6❩#(? oQAY& tqcq^jQm꩖Ƿ3(sZjIO 7+P7}P shg[:_iOK)~g)>O X"۞۲P݈jGv+)%w|f>q%Zfp}pr}3"n$Ё}s]9zZ>FNl]s!>yұϬְ>m20ˇVdtۇWw fO-<ߝXB#f<5DQn:o)x{nY!ތtulu>JZe_@ Y5?Gy/vP5tYT.4QycEY[5 HNUqnNE[/KD{zVä3 0u "JE: "qgڐvζid"v#6$v"DFU1l%a 5ॹjlG5"ou7)ˌNWY.8mbQU G%'n5*Yf0,P՝(!oA! ~2|0 C>ftnگ}*貨iT]6[W4u6CƩU R_^qplEO-}UR-8SX\(:@$~AZH71sk1Ǝj鮢2(Ceeg;zܥ~sCjM/3, ~?8O?7`xU =y-ļ/#XF{G/ῧ(!g;M^mO5:mb&ox_P-PpQCrNrnŠC"RfyxxsFcޅc/Xf8l[D=ǟdI >x:D2չP{}"C=-hg6fUA#'FwU6yw2ڕx(l63hJx3Tsؖu[<ꙕ iw+Šg\]S7x^,.R4 +P>"[7 Gm.ʇ(..o du)ѠU> @\ G[MU4lmB÷N[;њCtȮxGHq 2Sa.2F,aRU3c/H _M^gjKlq_b!B !@ f4Ip HCUB[mbEeQime6FlF'mZ2ߍ}s.߹XAN2.''I[KZQ=8A$ڳkp1B8Z\ >y䒵v_;?[Ds%Wpb[?ѳ^ڋ&\\ 0`GvGđqQP?T t-od Xult |q$9*DPq 'BAx .y? "'o@Fl ރ^$7e^f(JpoQ5ݵx4Qs:/ErfSݞi6u/$kZrgݐoulJ uMɅ] . JnV^#_,HpCߞuGĵRHn߸ cYm1pǡ >b4yW9,YjG;r㧰 ϏbH*۵τE1d 8S ΫN)pt߭D|WOC5i#>v!xC-pñD<01$\qE4 p;R989of8]Ogc;jW||O%_O/3f֡:_+jUy@9:N{UhUMJJ]^weXBH45gȬrEc -jyMϫGu76!`,jdW4*Ţ(q$W|t$9NL%ͧɬf6 J8%b/oG 7lL`>=} ۊ@u?%`}0uCbh x 6 S؂t((ɝDu5ƨO5t A iV׹?C2OlAPXC2.z62PY|(1{ s|훀H`kdAy2OOEq5vK *3 G61Up!'?/?glFHe}h{`-eVP7 J( >Cd֑~s|z @{מܨvq Hn_]yp_RAW!|qYE+KqxhGP \ݎ_c')@הˠ8q976qwQ>z1bqh>f.vqqmuND1*a+]}+ rqNFVV8KAQMAW#;ܪO1N͔?Ɖ-]UƉ~r7)]Kk݌};~FqƉ~!DIy^8z)<~FSD?J9~qSRhy tEl1N]Fs[szdxd7HVH~t$߷{Ȱ5:ԟvB)Ҙ~dhQƬP/Tχ84d60{Z涴l_-ѵmgn#u#; =TݹGMv-D $j|ߖξkd#fsv-ֶ_-Q]en6 KPh.d iS!Pk-l Vjɒc˲l}6NRutc*Sh[UダSBGj1%ؑ3&q|㜵zd֖dEQ;XnF7z&"7a#nBWb b/f$9 X~Qi&gΔ_eA^Jq (2݂]l-|}Q*A:R6pf_c"aq&M]/רd[\I&ù[kGk Wn^ڐUnTDo2%km[kSDFg>#{ۑe j݂˫2蚖;E΀tm\:sR|Q.ɺxk9yhcdϥdmU;HS u;]ЮR̽2lO^"ǎd~;.mNݞsQ9A֔{EWJ֜IźY#?slF45r@,ˊ4D]1v:]Fі]3mFNY˱FH!KKdTL*; |IΨQ /5G'i ~) ɨ l~m?rIkeUZεuWֵumVlt{WYL7*h8WN'6{:|;hf pU,xp LF Zťxa>^˰ q9X a9ހn%M~d[UoF+Ỷ XuhG< <|snf4[x[yڭmxn۱uS^]rK);qbvoUc}n ޏ>n܃c8>OS§q>|#x!| _/߇5|(x 7qpG8O)|O#8~_8&p#xok~?%LxŸߓZEES"{HzW,ћ cwnUe.k7|ܘqejvݙP:+\:.5ڠXMO䌋b--`h@4B%%¤2Sc\<@|s~IN*ds:ɇH:56s%:IiTq4RO>H%M\H+iJ~5, Ӽ7ЦzȻyo~NU+VTIdթj_WjZ?tnPٶMݶdCFm{R^$,ˑ7p1nruxh2t6dc6}BbWN;.r)z$OI/@^_ㅆ֚eԸ|idQ yI'l<n.ElAˎ`>LT;,h9:7-\dM^1g/% 'fv=*25(iGJvHOՑ]0WٻVSU{H?\+,9`7}`j/ D>MxM`|J[Ԧ~g`|g>3#گxڒzzz`py_y{yK^Z΋+!|Q`e2g,i|2o6˼L?'k̺55ah 5>vƬŠuuji%lBA6 lBi6s zߥ*^(&" R%kAd9vQ.mnE[%xI_bB!&ZH4&Jԥ'MƤbLkFً O803~&aJFh.06y3oHa/H.;x/L3YO*nj(%0`yc LEs) N=lxmǘ~`7q`xtyy Bm"G˃lfy#aNgq d} d: @WtrO1O`*1ng"ܓe}s 4x4ADy&@v].(W2"_䉈H. ]=/0r'ʘ?U7{j0s'0Ԑ "$rUl71'"|2FP°}9rj%9׹'kWh!@Nʍ$LFaM'idMĎOz! 9t{ K[ڮ3B8|<~Moc|WS`< ;ƛr\+ղ,W$C)7J PCUVqğ|D²E+fI@o׬0wh?`-Rt+YY&@Ko :!+~]YA?26ɱwDwsc4 m%4O ր|ZԐ"MIGMcE:uV4eym<av"K㳜H1edѼ? -h]i#@9N&oL5徹1E9{MoAOs{Msi՗^V[@FY77TS e$fkOt6%N%T j4ߖۡsSp9(SSM+xLth 48B!:DD5S (¨((a{A̖yoiZE-m&&$˼ҴPx®E_/ ǿoٱUQA/J5%c^c]zi=ڼ\j3V. 7f Hn endstream endobj 13 0 obj 14833 endobj 15 0 obj 23787 endobj 14 0 obj 0 endobj 16 0 obj 0 endobj 2 0 obj [ /PDF /Text ] endobj 5 0 obj << /Kids [4 0 R ] /Count 1 /Type /Pages /MediaBox [ 0 0 595 842 ] >> endobj 1 0 obj << /Creator /CreationDate (D:20010205135256) /Title /Author /Producer (Acrobat PDFWriter 4.05 fr Windows) >> endobj 3 0 obj << /Pages 5 0 R /Type /Catalog /DefaultGray 17 0 R /DefaultRGB 18 0 R >> endobj 17 0 obj [/CalGray << /WhitePoint [0.9505 1 1.0891 ] /Gamma 0.2468 >> ] endobj 18 0 obj [/CalRGB << /WhitePoint [0.9505 1 1.0891 ] /Gamma [0.2468 0.2468 0.2468 ] /Matrix [0.4361 0.2225 0.0139 0.3851 0.7169 0.0971 0.1431 0.0606 0.7141 ] >> ] endobj xref 0 19 0000000000 65535 f 0000019569 00000 n 0000019443 00000 n 0000019880 00000 n 0000001420 00000 n 0000019477 00000 n 0000001564 00000 n 0000002684 00000 n 0000002963 00000 n 0000004100 00000 n 0000000021 00000 n 0000001396 00000 n 0000004415 00000 n 0000019351 00000 n 0000019401 00000 n 0000019376 00000 n 0000019422 00000 n 0000019977 00000 n 0000020065 00000 n trailer << /Size 19 /Root 3 0 R /Info 1 0 R /ID [] >> startxref 20243 %%EOF periodictable-1.5.0/doc/nsfreferences.html000066400000000000000000000752141310514471200206150ustar00rootroot00000000000000 References:  
References:  

 
47Fer1 Fermi, E., Marshall, L.: Phys. Rev. 71 (1947) 666.
47Gol1 Goldberger M.L., Seitz F.: Phys. Rev. 71 (1947) 294.
51Shu1 Shull, C.G., Wollan, E.O.: Phys. Rev. 81 (1951) 527.
53Koh1 Koehler, W.C., Wollan, E.O.: Phys.Rev. 91 (1953) 597.
56Hei1 Heindl, C.J., Rudermann, I.W., Ostrowski, J.M., Ligenza, J.R., Gardner, D.M.:Rev.Sci.Instr. 27 (1956) 620
58Kae1 Keating, D.T., Neidhardt, W.J., Goland. A.N.: Phys.Rev. 111 (1958) 261.
61Ato1 Atoji, M.: Phys.Rev. 121 (1961).
61Wil1 Wilkinson, M.K., Wollan, E.O., Koehler, W.C.: Am. Rev. Nucl. Sci. 11 (1961) 304.
62Chr1 Chrien, R.E., Jain, A.P., Palevsky, H.: Phys.Rev. 125 (1962) 275.
62Mai1 Maier-Leibnitz, H.: Z. Angew. Phys. 14 (1962) 738.
63Mue1 Mueller,M.H., Sindhu, S.S., Heaton, L., Hittermann, R.L., Knott, H.W.: Argonne National Lab., ANL 6797,393
63Sch1 Schermer, R.I.: Phys. Rev. 130 (1963) 1907.
65Cab1 Cable, J.W., Wollan, E.O.: Phys.Rev. 140 (1965) A2003.
65Koe1 Koester, L.: Z. Physik 182 (1965) 328.
66Kro1 Krohn, V.E., Ringo, G.R.: Phys. Rev. 148 (1966) 1303
67Hea1 Heaton,L., Mueller, M.H., Williams, J.M.: J.Phys. Chem. Solids 28 (1967) 1651
67Sid1 Sidhu, S.S., Anderson, K.D.: Phys.Rev. 156 (1967) 1225.
68Chi1 Child, H.R., Raubenheimer, L.J., Koehler, W.C., Moon, R.M.: Phys.Rev. 174 (1968) 1553.
70Bin1 Binder, K.: Phys. Status Solidi 41 (1970) 767.
70Gre1 Green, J.L., Arnold, J.A., Leary, J.A., Nereson, N.G: J. Nucl. Materials 34 (1970) 281
70Lus1 Lushchikov, V.I., Taran, Yu.V., Shapiro, F.L.: Soc. J. Nucl. Phys. 10 (1970) 669.
71Lan1 Lander, G.H., Mueller, M.H.: Acta Cryst. B 27 (1971) 2284.
71Koe1 Koester, L., Knopf, K.: Z. Naturforsch. A 26 (1971) 391.
71Tru1 Trostedt, W.-D.: Z. Naturforschung 26 A (1971) 400.
72Abu1 Abul Khail, A., Amin, F.A., Al-Naimi, A., Al-Saji, A., Al-Shahery, G.Y., Petrunin, V.F., Zemlyanov, M.G.: Acta Cryst. A 28 (1974) 473
72Dil1 Dilg, W., Vonach, H.: Nucl. Instr. Meth. 100 (1972) 83.
72Koh1 Koehler, W.C.: Oak Ridge Nat.Lab. 1972 (unpublished)
72Koe1 Koester, L., Knopf, K.: Z. Naturforschung 27A (1972) 901.
72Moo1 Moon, R.M., Koehler, W.C., Cable, J.W., Child, H.R.: Phys.Rev. B 5 (1972) 997
72Rau1 Rauch, H., Treimer, W., Bonse, U.: Phys. Left. A 47 (1972) 369.
73Abr1 Abragam, A., Bacchella, G.L., GlAttli, H., Meriel, M., Pinot, M., Piesvaux, J.: Phys. Rev. Left 31 (1973) 776.
73Abr2 Abragam, A., Bacchella, G.L., Glaftli, H., Meriel, M., Piesvaux, J., Pinot, M., Roubeau, R.: Proceedings XVII Congress Ampere, ed. V. Hovi (North-Holland, Amsterdam, 1971).
73Coo1 Cooper, A.J.: Acta Cryst. A19 (1973) 514.
73Ver1 Vertebny, V.P., Gnidek, N.D., Ignatenko, A.I., Kirilyuk A.L., Pavlenko, E.A., Trofimova, N.A., Federova, A.F.: Proc. 2nd All-Union Conf. Neutr. Physiks, Kiev 1973, part 2, p. 114
73Wed1 Wedgewood, F.A., Burlet, N.N.: Harwell Report 1973, unpublished
74Dil1 Dilg, W.: Z. Naturforschung 29 A (1974) 1750.
74Kal1 Kalabin, S.M., Adib, M., Rukolaine, G.V., lvanov, RX, Karalova, ZX, Kukavadze, G.M., Pyzhova, Z.I.: Sov. J. Nucl. Phys. 14 (1974) 13
74Rou1 Roubeau, P., Abragam, A., Bacchella, G.L., Glättli, H., Malinovski, A., Meriel, P., Piesvaux, J., Pinot, M.: Phys.Rev.Lett. 33 (1974) 102
75Bac1 Bacon, G.E.: Neutron Diffraction, 3rd edition (Clarendown, Oxford, 1975).
75Bou1 Boucherle, JX: Acta Cryst. B 31 (1975) 2745
75Koe1 Koester, L., Nistier, W.: Z. Phys. A 272 (1975) 189.
75Wat1 Watanabe, N., Ishikawa, Y., Takei, K., Otamoto, T., Fujii, H.: Kakuriken Kenkyu Hokoku 8 (1975) 309
76Ako1 Akpyan, G.G., Alfimenkov, V.P., Lasen, L., Ovchinnikov, O.N., Sharapov, EI: Sov. Phys. JETP 42 (176) 397 .
76Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 277 (1976) 77.
76Ver1 Vertebnyi, V.P., Vorona, P.N., Kalchenko, A.I., Pshenichnyi, V.A., Rudishin, VX: Sov. J. Nucl. Phys. 22 (1976) 348
76Was1 Waschkowski, W., Koester, L.: Z. Naturf. a 31 /1976) 115.
77Fou1 Fournier, J.-M., Blaise, A., Muller, W., Spirlet. J.-C.: Physica B 86-88 (1977) 30
77Koe2 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 277 (1977) 77.
77Web1 Weber, M., Steeb, S., Meier, J., Koester, L.: FRM-Munich, internal report FRM-124, (1977),
77Koe1 Koester, L.: Erg. Exakt. Naturwissenschaft 80 (1977) 1.
77Koe3 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 282 (1977) 371.
77Mas1 Mashak, H., Bull. Amer. Phys. Soc. 22 (1977) 993
78Bau1 Bauspiess, W., Bonse, U., Rauch H.: Nucl. Instr. Meth. 157 (1978) 495.
78GIa1 Glättli, H., Abragam, A., Bacchella, G.L., Fourmond, M., Meriel, A., Piesvaux, J., Pinot, M.: Phys. Rev. Left. 40 (1978) 748.
78Koe1 Koester, L., Knopf, K., Waschkowski, W.: Int. Conf. Neutr. Phys. a. Nucl. Data, Harwell, 1978, p.
78Koe2 Koester, L., Knopf, K., Waschkowski, W.: Z. Physik A 287 (1978) 61.
78Was1 Waschkowski, W., Knopf, K.: TU-Munich, Reaktorstation Garching (unpublished).
79Boe1 Boeuf, A., Fournier, J.M., Gueugnon, J.E., Manes, L., Rebzant, J., Rustichelli, F.: J. de Physique Left. 40 (1979) L-335
79GIa1 Glättli, H., Bacchella, G.L., Fourmond, M., Malinovski, A., Meriel, P., Pinot, M., Robeau, R., Abragam, A.: J. Phys. 40 (1979) 629.
79Kai1 Kaiser, H., Rauch, H., Badurek, G., Bauspiess, W., Bonse, U.I. Phys. A 291 (1979)231.
79Koe1 Koester, L., Nistler, W.: TU-Munich, Reaktorstation Garching (unpublished).
79Koe2 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 292 (1979) 95.
79Koe3 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 289 (1979) 399-
79Koe4 Koester, L: FRM-Munich, internal report (1979), (unpublished).
80Koel Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A296 (1980) 43
80Koe2 Koester, L., Knopf, K.: Z.Physik A 297 (1980) 85
81Kis1 Kischko, U.: Inst. Laue-Langevin, Grenoble (unpublished)
81Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A 301 (1981) 215
81Mal1 Malinovski, A., Coustham, J., Glättli, H.: Nucl. Phys. A 365 (1981) 103.
81Mug1 Mughabghab, S.F., Divadeenam, M., Holden, N.E.: Neutron Cross Sections, Vol. 1, Part A; Academic Press, New York, London (1981).
82Boe1 Boeuf, A., Caciuffo, R., Rebonato, R., Rustichelli, F., Fournier, J.M., Kischko, U., Manes, L.: Phys.Rev.Left. 49 (1982) 1086
82Bon1 Bonse, U., Kischko, U.: Z.Physik A 305 (1981) 171
82Kno1 Knopf, K., Waschkowski, W.: Z.Naturforschung 37A (1982) 1132.
82Wor1 Word, R.E., Werner, S.A.: Phys. Rev. B 26 (1982) 4190
83GIa1 Glättli, H., Coustham, J.: J.Physique " (1983) 957.
83Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 312 (1983) 81.
84Eng1 Engel, D.W., Koetzle, T.F.: Acta Cryst. A 40 (1984) 99
84GIa1 Glattli, H., Meriel, P.: Nucl. Phys. A 426 (1984) 137.
84Kaw1 Kawarazaki, N., Kunitomi, S., Morii, Y., Suzuki, H., Moon, R.M., Nicklow, R.M.: Solid State Comm. 49 (1984) 1147
84Koe1 Koester, L., Knopf, K., Waschkowski, W., Kluever, A.: Z.Physik A 318 (1984) 347
84Mug1 Mughabghab, S.F.: Neutron Cross Sections, Vol. 1, Part B; Academic Press, New York, London (1984).
85Koe1 Koester, K., Knopf, K., Waschkowski. W., Kluever. A.: Z.Physik A 320 (1985) 661
85Koe2 Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A 322 (1985) 105
85Mei1 Meier, J., thesis TU-Munich, Reaktorstation Garching 1985.
85Rau1 Rauch, H., Tuppinger, D.: Z. Physik A 322 (1985) 427.
85Rau2 Rauch, H., Tuppinger, D., Wolwitsch, H., Wroblewski, T.: Phys. Left. 165B (1985) 39.
86Kai1 Kaiser, H., Arif, M., Werner, S.A., Woillis, J.O.: Physica 136B (1986) 134.
86Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A 323 (1986) 359
86Koe2 Koester, L., Knopf, K.: Z.Physik A 323 (1986) 367.
86Sea1 Sears, V.F.: Meth Exp. Phys. 23 A (1986) 521.
87GIa1 Glättli, H., Eisenkremer, E., Pinot, M.: Z. Phys. A 327 (1987) 25.
87GIa2 Glättli, H., Coustham, J., Malinovski, A., Pinot, M.: Z. Phys. A 327 (1987) 149.
87GIa3 Glättli, H., Goldman, M.: Meth. Exp. Phys. 23, Part C, (1987) 241
87Kno1 Knopf, K., FRM-Munich, internal report, (1987) (unpublished).
87Kno2 Knopf, K., Waschkowski, W.: Z.Naturforschung 42a (1987) 909.
87Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A 327 (1987) 129
87Koe2 Koester, L., Knopf, K., Waschkowski, W.: Z.Physik A 326 (1987) 227
87Rau1 Rauch, H., Seidl, E., Tuppinger, D., Petrascheck, D., Scherm, R.: Z. Phys. B 69 (1987) 313.
89Ram1 Raman, S., Kahane, S., Moon, R.M., Fernandez-Baca, J.A., Zarestky, J.L., Lynn, J.E., Richardson Jr., J.W.: Phys. Rev. C 39 (1989) 1297.
89Sch1 Schmiedmayer, J.: Thesis TU-Wien, unpublished
89Sea1 Sears, V.F.: ,Neutron Optics", Oxford Univ. Press 1989.
89SIa1 Slaus, I., Akaiski, Y., Tanaka, H.: Phys. Rep. 173 (1989) 257.
89Was1 Waschkowski, W., Knopf, K., Koester, L.: Z.Naturforschung 44 (1989) 173
9OKno1 Knopf, K., FRM-Munich, internal report, (1990) (unpublished).
9OKoe1 Koester, L., Waschkowski, W., Meier, J.: Z. Phys. A 337 (1990) 341.
90Rei1 Reiner, G., Waschkowski, W., Koester, L.: Z.Physik A 337 (1990) 221
91 Koe1 Koester, L., Rauch, H., Seymann, E.: Atomic Data and Nucl. Data Tab. 49 (1991) 65.
91 Koe2 Koester, L., Knopf, K.: Z. Phys. A 388 (1991) 233.
92Sea1 Sears, V.F.: Neutron News 3 (1992) 2&
93Koe1 Koester, L., Knopf, K., Waschkowski, W.: Z. Phys. A 345 (1993) 175.
93Ter1 Terburg, B.P., Verkerk, P., Jericha, E., Zawisky M.: Nuci.Instr.Meth. A324 (1993) 247
94Iof1 loffe, A., Lukas, P., Mikula, P., Vrana, M., Zabijakin, V.: Z.Physik A 348 (1994) 243
95Kno1 Knopf, K., Waschkowski, W.: Z.Physik A 352 (1995) 449
95Koe1 Koester L., Waschkowski W., Mitsyna L.V., Samosvat G.S., Prokofjevs P., Tambers J.: Phys. Rev. C 51 (1995) 3363.
97Iof1 loffe, A., Neov, S.: Physica B 234 (1997) 1183
97Kno1 Knopf, K., Waschkowski, W., Aleksejevs, A., Barkanova, S., Tambergs, J.: Z.Naturforschung 52 a (1997)270.
97Kno2 Knopf, K., Waschkowski, W.: Z.Physik A 357 (1997) 297
98Iof1 loffe A., Jacobson D. L., Arif, M., Vrana M., Werner S.A., Fischer P., Greene G.,
periodictable-1.5.0/doc/sphinx/000077500000000000000000000000001310514471200163775ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/Makefile000066400000000000000000000061131310514471200200400ustar00rootroot00000000000000# Makefile for Sphinx documentation # # You can set these variables from the command line. SPHINXOPTS = SPHINXBUILD = sphinx-build PAPER = # Internal variables. PAPEROPT_a4 = -D latex_paper_size=a4 PAPEROPT_letter = -D latex_paper_size=letter ALLSPHINXOPTS = -d _build/doctrees $(PAPEROPT_$(PAPER)) $(SPHINXOPTS) . .PHONY: help clean html dirhtml pickle json htmlhelp qthelp latex changes linkcheck doctest build help: @echo "Please use \`make ' where is one of" @echo " html to make standalone HTML files" @echo " dirhtml to make HTML files named index.html in directories" @echo " pickle to make pickle files" @echo " json to make JSON files" @echo " htmlhelp to make HTML files and a HTML help project" @echo " qthelp to make HTML files and a qthelp project" @echo " latex to make LaTeX files, you can set PAPER=a4 or PAPER=letter" @echo " changes to make an overview of all changed/added/deprecated items" @echo " linkcheck to check all external links for integrity" @echo " doctest to run all doctests embedded in the documentation (if enabled)" clean: -rm -rf _build/* build/* plots/*.pyc plots/*.png html: build $(SPHINXBUILD) -b html $(ALLSPHINXOPTS) _build/html @echo @echo "Build finished. The HTML pages are in _build/html." dirhtml: $(SPHINXBUILD) -b dirhtml $(ALLSPHINXOPTS) _build/dirhtml @echo @echo "Build finished. The HTML pages are in _build/dirhtml." pickle: $(SPHINXBUILD) -b pickle $(ALLSPHINXOPTS) _build/pickle @echo @echo "Build finished; now you can process the pickle files." json: $(SPHINXBUILD) -b json $(ALLSPHINXOPTS) _build/json @echo @echo "Build finished; now you can process the JSON files." htmlhelp: $(SPHINXBUILD) -b htmlhelp $(ALLSPHINXOPTS) _build/htmlhelp @echo @echo "Build finished; now you can run HTML Help Workshop with the" \ ".hhp project file in _build/htmlhelp." qthelp: $(SPHINXBUILD) -b qthelp $(ALLSPHINXOPTS) _build/qthelp @echo @echo "Build finished; now you can run "qcollectiongenerator" with the" \ ".qhcp project file in _build/qthelp, like this:" @echo "# qcollectiongenerator _build/qthelp/Periodic Table.qhcp" @echo "To view the help file:" @echo "# assistant -collectionFile _build/qthelp/Periodic Table.qhc" latex: build $(SPHINXBUILD) -b latex $(ALLSPHINXOPTS) _build/latex @echo @echo "Build finished; the LaTeX files are in _build/latex." @echo "Run \`make all-pdf' or \`make all-ps' in that directory to" \ "run these through (pdf)latex." pdf: latex $(MAKE) -C _build/latex all-pdf changes: $(SPHINXBUILD) -b changes $(ALLSPHINXOPTS) _build/changes @echo @echo "The overview file is in _build/changes." linkcheck: $(SPHINXBUILD) -b linkcheck $(ALLSPHINXOPTS) _build/linkcheck @echo @echo "Link check complete; look for any errors in the above output " \ "or in _build/linkcheck/output.txt." doctest: $(SPHINXBUILD) -b doctest $(ALLSPHINXOPTS) _build/doctest @echo "Testing of doctests in the sources finished, look at the " \ "results in _build/doctest/output.txt." build: cd ../.. && python setup.py build periodictable-1.5.0/doc/sphinx/README.txt000066400000000000000000000015261310514471200201010ustar00rootroot00000000000000This is the top level build direcgtory for the periodictable documentation. All of the documentation is written using sphinx, a python documentation system using restructured text. See the User Guide section "Contributing Changes" for details on how to build the documentation. Manifest: Makefile use "make clean html pdf" to build the docs guide user documentation api auto-generated interface documentation plots programs to generate figures index.rst top level include document genmods.py creates the module index files conf.py sphinx configuration rst_prolog restructured text macros (for units) discoverer, shelltable sample extensions _static images and style sheets _templates page layouts _extensions sphinx extensions _build output directory periodictable-1.5.0/doc/sphinx/_extensions/000077500000000000000000000000001310514471200207355ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/_extensions/dollarmath.py000066400000000000000000000041511310514471200234370ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle r""" Allow $math$ markup in text and docstrings, ignoring \$. The $math$ markup should be separated from the surrounding text by spaces. To embed markup within a word, place backslash-space before and after. For convenience, the final $ can be followed by punctuation (period, comma or semicolon). """ import re _dollar = re.compile(r"(?:^|(?<=\s))[$]([^\n]*?)(? not converted\n") # sys.stdout.write(content) # sys.stdout.write("\n") #elif '$' in original: # import sys # sys.stdout.write("\n========> converted\n") # sys.stdout.write(content) # sys.stdout.write("\n") return content def rewrite_rst(app, docname, source): source[0] = replace_dollar(source[0]) def rewrite_autodoc(app, what, name, obj, options, lines): lines[:] = [replace_dollar(L) for L in lines] def setup(app): app.connect('source-read', rewrite_rst) app.connect('autodoc-process-docstring', rewrite_autodoc) def test_dollar(): assert replace_dollar(u"no dollar")==u"no dollar" assert replace_dollar(u"$only$")==u":math:`only`" assert replace_dollar(u"$first$ is good")==u":math:`first` is good" assert replace_dollar(u"so is $last$")==u"so is :math:`last`" assert replace_dollar(u"and $mid$ too")==u"and :math:`mid` too" assert replace_dollar(u"$first$, $mid$, $last$")==u":math:`first`, :math:`mid`, :math:`last`" assert replace_dollar(u"dollar\$ escape")==u"dollar$ escape" assert replace_dollar(u"dollar \$escape\$ too")==u"dollar $escape$ too" assert replace_dollar(u"emb\ $ed$\ ed")==u"emb\ :math:`ed`\ ed" assert replace_dollar(u"$first$a")==u"$first$a" assert replace_dollar(u"a$last$")==u"a$last$" assert replace_dollar(u"a $mid$dle a")==u"a $mid$dle a" if __name__ == "__main__": test_dollar() periodictable-1.5.0/doc/sphinx/_extensions/only_directives.py000066400000000000000000000040751310514471200245170ustar00rootroot00000000000000# # A pair of directives for inserting content that will only appear in # either html or latex. # from docutils.nodes import Body, Element from docutils.parsers.rst import directives class only_base(Body, Element): def dont_traverse(self, *args, **kwargs): return [] class html_only(only_base): pass class latex_only(only_base): pass def run(content, node_class, state, content_offset): text = '\n'.join(content) node = node_class(text) state.nested_parse(content, content_offset, node) return [node] def html_only_directive(name, arguments, options, content, lineno, content_offset, block_text, state, state_machine): return run(content, html_only, state, content_offset) def latex_only_directive(name, arguments, options, content, lineno, content_offset, block_text, state, state_machine): return run(content, latex_only, state, content_offset) def builder_inited(app): if app.builder.name == 'html': latex_only.traverse = only_base.dont_traverse else: html_only.traverse = only_base.dont_traverse def setup(app): app.add_directive('htmlonly', html_only_directive, True, (0, 0, 0)) app.add_directive('latexonly', latex_only_directive, True, (0, 0, 0)) app.add_node(html_only) app.add_node(latex_only) # This will *really* never see the light of day As it turns out, # this results in "broken" image nodes since they never get # processed, so best not to do this. # app.connect('builder-inited', builder_inited) # Add visit/depart methods to HTML-Translator: def visit_perform(self, node): pass def depart_perform(self, node): pass def visit_ignore(self, node): node.children = [] def depart_ignore(self, node): node.children = [] app.add_node(html_only, html=(visit_perform, depart_perform)) app.add_node(html_only, latex=(visit_ignore, depart_ignore)) app.add_node(latex_only, latex=(visit_perform, depart_perform)) app.add_node(latex_only, html=(visit_ignore, depart_ignore)) periodictable-1.5.0/doc/sphinx/_static/000077500000000000000000000000001310514471200200255ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/_static/banner.png000066400000000000000000005726661310514471200220260ustar00rootroot00000000000000BM6(`ؕ\\\???777===RRRXXX@@@RRRGGG(((''';;;ы''' yyy񇇇^^^sss """GGGwww ZZZyyy((([[[nnnhhh!!!888@@@oooFFFAAALLLĪGGG>>>郃111 )))vvv///  &&&nnn'''::: !!!555EEEQQQTTTRRRIII;;;(((444"""uuu,,,GGG```tttzzzfffNNN444 @@@^^^|||gggIIIvvv###MMM%%%EEEdddʬnnnttt򹹹xxxHHH'''***;;;MMMbbb{{{777XXXPPP888UUUpppxxxӾ|||lll^^^UUUOOOIIILLLPPPXXXeeewww++++++TTTjjjtttyyy~~~xxxqqqhhhWWWFFF444 &&&BBBeeedddGGGMMM```lllttt|||ٴiiiHHH,,, (((333:::===999444+++ 888???׼zzzYYY555@@@kkk ɡsssEEE222RRRsssģsss '''QQQ222ϱ]]]333 ,,,YYY```BBB]]]HHH龾ddd888,,,ZZZ```͢wwwEEE AAAttt |||___eee---999ggg222qqqǚeee(((%%%zzz汱{{{;;;BBBrrrXXXGGGSSS444 222 JJJ꼼===444)))...777iii```777ԛYYY(((jjj٘PPP'''iii ///ggg;;; OOO888TTT ~~~YYY"""ٟTTT FFFwww111'''nnn eeeDDD(((YYYppp111wwwXXX9/gU1ZJmZ!t_#p)9/gUFFF$$$ʄ/// ;;;888 +++rrrQQQUUUddd9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/p)9/9/9/9/9/9/aP19/9/9/9/9/9/9/9/9/9/{-QK6=3>3=3;1@5VGȺȁ{j@5=2>3>3>3=29/ysa9/9/9/9/9/9/9/9/9/9/ze%9/9/9/9/9/9/9/9/9/9/aP9/gUze%ZJ@5;1=3=3:0I=üxsi9/9/9/9/9/9/9/9/9/9/ze%I=D8𲲲~}xLD-;1=3=3;19/PB9/9/9/9/9/9/9/9/9/9/ze%ȁ{j@5=2>3>3>3=29/ysa9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/ze%ȁ{j@5=2>3>3>3=29/ysa9/9/9/9/9/9/9/9/9/9/ze%xsi9/9/9/9/9/9/9/9/9/9/ze%Ɔ}E=(=3>3>3>3=2D8rfCĶPB9/=2>3=3;19/u/C7D8B6?4<29/I=p]"xsi9/9/9/9/9/9/9/9/9/9/ze%nhTF::0=3>3>3<2D89/9/9/9/9/9/9/9/9/9/9/9/9/9/9/1LD-=2>3>3=2M@j'VSK>3>3<2]M0I=D8𲲲~}xLD-;1=3=3;19/PB9/9/9/9/9/9/9/9/9/9/ze%ȁ{j@5=2>3>3>3=29/ysaYYYnnn:::Ђ000444֒CCCZZZggg???xxx캺sn\M@M@M@M@M@M@M@M@M@M@M@M@q~zmi]M@M@M@M@M@J=q*ɟpmdM@M@M@_N}qM@M@M@M@M@M@XHD8PBZK]M^NqtrnQK6tmY?4F:N@YJ]MyrofF:?4yɰ|rM@M@M@M@M@M@UF{ڷzM@M@M@M@M@M@PBuH;E9C7G:dS֖|I<?4p]"ɪwq_M@M@M@M@M@M@UFm~h&lY!I<RM?B7H;mZ!zҠN@H;@5QCȿɰ|rM@M@M@M@M@M@UF{tmY?4F:N@YJ]MyrofF:?4y캺sn\M@M@M@M@M@M@M@M@M@PB{`tmY?4F:N@YJ]MyrofF:?4yɰ|rM@M@M@M@M@M@UF{ɪwq_M@M@M@M@M@M@UFmvto@5G;SEze%ǾڤM@E9>3aPZK?4G;NA]MÿhV E9A6iW iW n[!hV ^NVGbZAyxtʪwq_M@M@M@M@M@M@UFmyX?4G:K>PBtlT{rXC7bZAѻhcSM@M@M@M@M@M@M@M@M@XHy|lB7M@XI]MŜOH5QCl]VCUF\L\LeZ;onl~h&lY!I<RM?B7H;mZ!zҠN@H;@5QCȿɰ|rM@M@M@M@M@M@UF{tmY?4F:N@YJ]MyrofF:?4yhhhMMMYYY᜜CCC&&&www栠JJJ LLLxxx,,,RRR،t+t+t+t+t+t+t+t+u+޹t+s*i'v+߭tu+1s*t+t+t+t+x,b[GjX n)v,x,ʪZQ5ȼI=J=_Nua$o)ʺ䔍zH;ʺt+t+t+t+x,ʷt+t+t+t+u+xc%t_#mZ!w,^NE9n(Ƴt+t+t+t+x,֓z-u+kX \LlY!~/뫤dSL?A6jƳt+t+t+t+x,I=J=_Nua$o)ʺ䔍zH;֌t+t+t+t+t+t+t+v+I=J=_Nua$o)ʺ䔍zH;ʺt+t+t+t+x,Ƴt+t+t+t+x,a_YL?bQ~h&l獂^[KG;PBJ=I=_Oze%¹ȬbQ\Lq*|.{-x,ĺƳt+t+t+t+x,L?G:]Mwc$m([KldNЌt+t+t+t+t+t+t+{-K>hV l(v+λmjbJ=OAt_#s*w,/}}}֓z-u+kX \LlY!~/뫤dSL?A6jƳt+t+t+t+x,I=J=_Nua$o)ʺ䔍zH;$$$111222sss󲲲\\\cccee99""00UUᤤYYYHHH777Ƞ1111111Է1w,w,~0Ǜ/1111iW v+010þaW9UFwb$u+~/o)L?砄11100蟃01110t+~.0r*jX OAո⠄11100֖|.0{-w,{-Ƿze%ZKF:u⠄11100aW9UFwb$u+~/o)L?Ƞ111111aW9UFwb$u+~/o)L?砄11100⠄11100db[]M|g&x,0ar^#RDK>L?VGvb$u+Ǹ0n(~.111⠄11100UFPBn["s*/ǻSDȠ111110~tTr^#w,00݀xbua$z-001֖|.0{-w,{-Ƿze%ZKF:u⠄11100aW9UFwb$u+~/o)L?cccooouuu VVV@@  '$aaaJJJ```xxxࡅ111111ҶǢx,p)܌kŠyX{-111o߅n)010/VGi'}.0έq]"{011/~./110|.u+0ո/t+aPv011/~.֖|.110|./p)bQUF011/~.VGi'}.0έq]"{ᡅ111110VGi'}.0έq]"{011/~.011/~.usocRp)/0ԕ{-|g&WHjX kXIj'}.0˜~.0110011/~.zWH}g&{-0k(~tT⡅111110mZ!v+01/ο}.01}.1֖|.110|./p)bQUF011/~.VGi'}.0έq]"{$$$%%%LLLAAA777ӿxxŒ!,,88??@A@;:,)&/}󳳳ZZZ 111011110x,q*덌~bո~rp]"}.110v+11~.{-WH{f%~/11x,yoQ~.11z-/z-11~.u+t+|.}./j'm(~.11z-/֖|.110{-ͭ0p)\Lyd%~.11z-/VG{f%~/11x,yoQ01111|.VG{f%~/11x,yoQ~.11z-/~.11z-/wnPr*00Ŷŵ~/~h&QCsSEi'/1;z-011}.~.11z-/RDze%~.1111110/m/11z-ߠ111v+1֖|.110{-ͭ0p)\Lyd%~.11z-/VG{f%~/11x,yoQyyyDDD}}}"""ppp--e//FFYYiirr{qnt;H22枞333'''CCC /1111~.÷r*ȣtqhx[Kr*010x,11{-y-iW y-11;ݔ{-11w,~/v,11|.u+֊\}.1v+q*ݔ{-11w,~/֖|.11~.|.Ԡ1/|g&bQݔ{-11w,~/iW y-11;/1110w,iW y-11;ݔ{-11w,~/ݔ{-11w,~/|zqk(/1~.׾1{-p]"[Ko\"{-11x,011x,ݔ{-11w,~/hV x,11׾埃0111|.{-̹/11w,柃010t+1֖|.11~.|.Ԡ1/|g&bQݔ{-11w,~/iW y-11;QQQ```SSS 00 ) =..JJdd}}⓭L,  $$TTTjjjRRR|.1111z-s*ȣmhW{kcMze%/11Ĵx,11x,x,xl(011ܔz-11v,~.u+11{-t+OA~h&/1y-ܔz-11v,~.֖|.11{-~.٠11x,gUܔz-11v,~.xl(011|.111/r*xl(011ܔz-11v,~.ܔz-11v,~.w{-10|.ڡ10t+]MȨop)010w,/11v,ܔz-11v,~.sn(011ܝ0111y-z-11x,aPߝ010s*1֖|.11{-~.٠11x,gUܔz-11v,~.xl(011===rrr|||!!!YYYmmm 44 44DDOPPX$g;;YYxx98,,;;EEJJIICC66%%RRR***냃222ܔ{-1110u+Ճl(1c[BdSw,110x,11x,w,wc$x,110ܔz-11v+}.t+11z-s*XHE9dSw,11|.ܔz-11v+}.֖|.11x,~/蠄11/{f%aܔz-11v+}.wc$x,110ܔ{-111/o)wc$x,110ܔz-11v+}.ܔz-11v+}.q01/x,蠄11/ze%st`#z-11/u+|.11v+ܔz-11v+}.u`$x,11/֜/111x,~/ɡ1}.s_#I<ٛ/1/p)1֖|.11x,~/蠄11/{f%aܔz-11v+}.wc$x,110,,,񨨨GGG,,, ((CC[[ppu. 99SSeeoozm, #;=UUhhvv}}||rraaMM55yy{{{jjj)))ܔz-111/s*ƽ獅lo)010x,11x,w,yd%|.11/ܔz-11v+}.t+11z-s*mZ!D8K>hV r*011βܔz-11v+}.֖|.11v,0䟃010r*s*ܔz-11v+}.yd%|.11/ܔz-111~/o)yd%|.11/ܔz-11v+}.ܔz-11v+}.{-11}.w,埃010s*i'|f&~/11|.t+{-11v+ܔz-11v+}.u`$|.11}.ԛ/111w,~.鿶fTG;H;ՙ/1/o)1֖|.11v,0䟃010r*s*ܔz-11v+}.yd%|.11/񏏏&&&ڃ### ^^^==ZZww2M  (rr3ԛ/111v+}.ͿdRVGm(ܝ01/o)1֖|.11v+j'v,110ܔz-11v+}.110иz-|.|.t+ʳ999 䓓000TTT!! !!;;QPdcsr|{xx// ..OOkk~xjd{xutccNN77%%%sss܈,,,QQQ***vvvܔz-111~/yd%]M9/;1C7\Lq*/q*1mgWr^#|.110okaxc%1x,11x,w,Ҷ1/q*|.11}.z-11x,u`$u+11z-ȼ»/0/XIt_#z-11v+}.֖|.11w,mZ!p~qJ|.11/ܔz-11v+}.Ҷ1/q*|.11}.ܔz-111/yd%OAD8C7C7C7C7C7B6>3:0skSҶ1/q*|.11}.z-11z-lY!Ϯz-11v+}.؞0o)YJpjX |.11Ĵ1/j'e[<Ķn["}.11v+z-11v+}.1/i'ylG`H;SDOAQCԛ/111v+}._U8D8E9B7x,ÿ/1/q*֖|.11w,mZ!p~qJ|.11/ܔz-11v+}.Ҷ1/q*|.11}. ...;;;CCCEEEAAA777'''QQQ&&&"""99UUppXX//88LG`Zsnz||w{fbiiNN%%%yyy󴴴XXX"""{{{򜜜... qqqܔz-111/i'o/0q*1ziaPu+0101I<{f%1x,11x,w,Է/ze%yXmZ!x,10n["{-11z-fTviEw,11{-0/p)_Nyd%l(n["{-11v+}.֖|.11{-iW j'ոjbGm(011ܔz-11v+}.Է/ze%yXmZ!x,10ܔz-1110x,lY!hV ]MPBG:?4viEԷ/ze%yXmZ!x,10n["{-11~/r^#uqpnA6A6\Lpn["{-11v+}.הz-iW fTǷe[3PByd%~.111u+VGu`$1Рw,t+iW M@@5XH1{C7aPx,11x,aPD8>3>3>3=21OA@5SEPB>3UFj'kkk{³110ȣ񊊊`^X=3=3D8ZJo)0Ϯ~J=K>QC>3SE~h&y-s*kkk{³11v+}.֖|.1100lkfJD2QC;1D8aPq*nܔz-11v+}.OA@5SEPB>3UFj'ܔz-111/v,џ0/t+p]"NAxc%OA@5SEPB>3UFj'kkk{m10/ּsqm[T=]Mi'x,v,u+簰kkk{³11v+}.󱰪f`N=3M@SE>3D8_OȻt`#M@=2M@M@H@*trnϝ0111v+kkk{³11v+}.vjFE9?4SEL?QCm(0ԛ/111v+}.߻}r^#H;QCSEI=^Nw,έ֖|.1100lkfJD2QC;1D8aPq*nܔz-11v+}.OA@5SEPB>3UFj'222QQQpppbbbBBBmmm{{==CC[[oo|t~tei_Pq|t}}hhh444|||CCCܔz-111/r*ˈq*1ˤ}.11}.n)™DZԤ֖|.11/1縸ܔz-11v+}.™ܔz-111/p)ȣ10z-t`#XI™ᩩڨ0011v+ʠԛ/111v+}.֖|.11/1縸ܔz-11v+}.™ +++HHHfffvvvWWW &&&~~~݆Ro^elrweiي011888WWWvvvܔz-111~/o)وp)1ҵ1100֖|.11y-1ܔz-11v+}.ܔz-111~/o)ء110w,fTŹy-}.11v+ԛ/111v+}.֖|.11y-1ܔz-11v+}.TTTttt貲TTT666KKK```sss~~~{{{rrr777111222~~~KP89MMccvvwwMQQ!!!vvv """111ܔz-111~/o)p)1έ1~/~/֖|.11u+1ܔz-11v+}.ܔz-111~/o)111/i's*t+{-11v+ԛ/111v+}.֖|.11u+1ܔz-11v+}.444Ъ***~~~444$$$nnnppp XXXbbbܔz-111~/o)1y-x,֖|.11t+1ܔz-11v+}.ܔz-111~/o)1111t+n(s*z-11v+KG:eԛ/111v+}.zzzkcMȣ֖|.11t+1ܔz-11v+}.jjjΊ<<<aaaЄ111::: SSSܔz-111~/o)I=1ؿx,w,֖|.11t+1ܔz-11v+}.ܔz-111~/o)頄1111x,w,s*z-11v+\UB[Kԛ/111v+}.hfaeS֖|.11t+1ܔz-11v+}.hhhԏDDD```ה@@@&&&www,,,000ܔz-111~/o)|zseSȣw,w,֖|.11t+1ܔz-11v+}.ܔz-111~/o)֠1111y-ȼs*z-11v+wgUҵԛ/111v+}.˛i'ȣ֖|.11t+1ܔz-11v+}.QQQݞXXX$$$]]]JJJ(((oooGGG"""֔z-111~/o)י~~h&ȣ֖|.11t+1ܔz-11v+}.ܔz-111~/o)Ͽ1111z-s*z-11v+{f%ze%ԛ/111v+}.n)o)ո֖|.11t+1ܔz-11v+}.<<<!!!TTT!!!PPPz-111~/o)k'p)Ԗ|.11t+1ܔz-11v+}.ºz-111~/o)񭭭|1111~/s*z-11v+ır*ZKҺԛ/111v+}.˒}t+s*Ԗ|.11t+1ܔz-11v+}.555444###ڦ___ 888yyyPPP GGGaaaFFFJJJ---{-111~/o)xoPs*q*Ǝ|.11t+1ʔz-11v+}.{-111~/o)/1110Ǝk'z-11v+Ǝȸz-jX [Kԛ/111v+}.wtl~h&z-r*|.11t+1ʔz-11v+}.ZZZ''':::XXX췷xxx999FFFߦ___111ooo@@@ggg---LLLt`#~.111~/o)PB|f&z-p)^\VE9D8G:|}.11t+1z-11v+}.p]"}.111~/o)|wjr*0111^\VE9D8G:̫n["{-11v+^\VE9D8G:ƚ/n)VGM@ԛ/111v+}.嗖\VFgUx,|.r*|}.11t+1z-11v+}. eee222齽FFF ...lll񼼼vvv555 AAA𽽽pppgggnnn ǀzfRDo)0111~/k'xrc?4J=p]"z-}.s*qeCr^#n[!VG_ַjbGyd%/11t+1kX |.11v+}.廹}iNAk'0111~/k'ƞa]PN@vb$~.111qeCr^#n[!VG_̇|ZTEq]"}.11v+qeCr^#n[!VG_ȝ0~.ze%SDA6>3SEhЛ/111v+p)ױ|pf`N=3I=eSr*0|.u+ַjbGyd%/11t+1kX |.11v+}.MMMPPPFFF]]]עbbb!!! 999222,,,jjj;1@5L?n["{-1111/wc$K>?4>3>3>3?4@5D8H;QCmZ!w,0~.r*͢`}.{-i'l=3C7YJr*011t+1;1M@|f&/11v+}.=2A6K>jX y-1111/wc$K>?4?4@5E9TEt`#z-11͢`}.{-i'l1J=D8XHn)011v+͢`}.{-i'lڝ01}.j'eSPBI<E9C7A6?4M@~h&/111w,ZJB6B6C7D8G:L?ZKu`$v+01|.t+=3C7YJr*011t+1;1M@|f&/11v+}.Ԫuuu<<<ZZZϓYYY JJJ[[[ !!!&&&'''"""OOOѡ11/ʷž111t+1øǬŶ11v+}.ѡ11/ȵ¶0111v+ѡ11/ʷž111t+1øǬŶ11v+}.~~~ŐXXX(((...^^^777999bbbhhh333FFFTTT\\\\\\WWWKKK999###ZZZ666iii111ͨwwwAAA GGG|||OOOVVV BBB!!!???YYYrrrxxxaaaGGGWWWeee (((999׳fff===)))aaazzz[[[222QQQpppȲyyy[[[uuu崴mmm111VVV:::nnnýxxx___GGG*** 888^^^ ///ggg555TTTsssѸ|||aaaKKK!!!///<<ԓp 5R8B `~#2Y6nSkSci닃m!$OO[;cM 8,p4[5HwاEcpdjx-ĸ}EKF` Du}c/z 8p[/4,B4bMmxVg7pd`XsnLeXwt44XkunpJgva&#&URߢ:829ޖb٠}*L>gk@&Gln(iLÙBX!vqPR?2UX YjUη?ܒQLQʶuПh† HM>3F61i!J)C)Յ\[RtKϵ7 a6N M#d֮]UvM&(&¹J޳UpXi>!D=P>%QJy.;NM$~^o> nvc8?#U͂Rm@bM&I;g7h,X] ua}~0:;;$ z\.RdY?/_~݊+o!Æa$dMd @ov17"z0¦kHrD "-I;nX/Mյ`0/H&!LsK.ӟAJ .1UQ/@Y< <]hdQrJ,lX`u6:v\w룷H$B$.0~ǃRt:M<g||Q-ZtÅ^x=Ba*s!HCN`gD6"P6#-$qvGy p `XPhfa$ȃ>D3zFCψUx#>owO   蠳n:;; Bx^{6? )S֦bYH+$9лS@ d;wƐ*K1`k0Na- @Vilߟj(ͻg!ָ= ߏa&P(DGGH|>|X,"ˑJH$UVrʇa)o#$8Ю.C`'P9dGyԦ}"` ;iګGÂKO nlmD):,#ȮYjq:+,&(4T@.8EFؚ}kV"v.=a8ƦZ4;4{j66}ߟ?rY.6M,`^(xc0 ^z饷! v_HXljd#"W!9]m{?|Z'dWַW33rh=G)/B,G#nUVZ5bc7f3+[dR(e-ˑdHӌNd2r5o+VlLRgQ"uSe#0Sh# {)Ƚ~GS:dIV%Be$ #uEر܌( <_B U91w 5-|l6K.#ˑfIӤR)$Xl0hD"A2,L6%>b ?44<ޏE(p*劖OR)N4}|Al$h%1;LH5*9[B\DnATD3g@d/"v+ f va9wYX,VTٺn ~0XTFzOQiњiͬ潘MҋKANEc0[@6RzȂ7šn,0`{D"̎P@ PtVJ" F#_[ JV-޾Zfmx>g+0u۾ǘ[(vY4N@vǀ0T[ջ+9@]$l6kvX$jaݼ˩=5]`A Zl[)88 *`MlLցv[ծÐ)m# +\ݯj)e+d?b83g#GT݌7 )GGL!Dt5~_uww~5|``5o<DT(RUcU["lAɤZ5r7-!"Q4lهRn[nMvAßq=qQUݘwq'Um$WPTj}G,A< >Pd{Ǐ5{tma}"Z^lMb1E؉}0e.E,[kβ{aj{ѵ1.Bw [rU m#RcѮ~tΫԏ~e;EC:k.Wf~\C-֣}Q+w5p|fEb ٖjWDͫz.:Ksg{ Zq?ۮu\+:9RH7Vdʬ#$ߤP"h>ӈa%|և\ݬ|bS5+,ȴ/<}Rd 3y\dk)ѮIY+;>eaIVLUJyR~TX)ա )|&E`"$GՌ/"g-_)խSJ+B؎BL \k &]l׷+ Įc~Lj:7'GR?|RJJRR K)P4gkH0Q5 Yx'}I)Rji-QJRx? kNuk/uCkvǗ>WqRZ!A@kLv@T ;F!"{M~b`T؅FuOǃ/"F'{(FͤPgx122{R }HѥEޞka&e㟍8d_A /M S]Gu(>;Qgv]{;?GEa,Ùѝv_+WkaKţr1ӹY@ ĭb*&HEH:% R|Gi R#x~(kYq?Xt3S1 c3qќ6p \-hA]KyayY/9>Rʽ|c7m%Ϸ_GGKR|x^G)9UvMzD 7N a5BӌJ5H R Wߡ\F p(]]0B I/-̟?l5 CW bMB!Ğ0>D*F,FŬ}>"h)^?`peOOOjGGpD*"Nc=;(AJ71ބ5)H}yJJ#ac (XwL@w7" NC"O:/Jea# :O>䕹\Rx?wLv1 Dm@8UdVcB4@:@0;K]$sys㱱1ϟE]D4o?`~5H.@ NRE R"-T+:ClYauu twvM <$8$~r!&F>Zn~힪 aA>,dvEf*KQLTt;)*i)0pX28wuuaÆ."BΠf.,EV/RNB)VQE6 ۟Jϰ`̛Wj)'{zwn5k Q!9u}~7H$UH=zEIi&4g5킫xq}}}L`0d2*E[nexxqO>qD!Y]HZ"IJoء!v5ґ|Oɀ?9#_v@D ]]rTJvQ[=kϹ{eW_{p@w7>.e+-K+V,뮻d*Y4}$s+BaXQ o#nhy= Λ7~̄200P$]WvC",CCC V_gS"ΦzIO8,D0(t%ܒ?>%B @$"D졉bx`pЈzw|W&#t} |G/w~M K;^{N3[$,do1SFݤ,: TzB!"tvv-ǃftttkv %Ap!*?>qjb1Q'"- |=6^/ hrIoo73ݸqx.t4'}}nc7{v nܸ't[ èe@]Bsb;~> $h ,JD"^9 gru%]jr9ds>JYtv 1x^0 v/9Qtr-W +mxHvD'lzR;HَB\.W,?*P<gddA(d\*xƍFXfTDAqH*}َ5` ҧPHP%ŔyI|w F|^"jhQb[.,d}. kDbOﻏ ロ7SPzR!*ڞׅ!ISL0zhډDh4"NFQbdx~&!#~4귞NC}엩3~r9[Z#:/m4 '; Gr|fK; e2g_#ֳdc/+w-|y];CdݱiW5jDk4^ؙ?C#\$R[ccc\ ###xX~||6$Bd9ı0 =pH>LJh"ѻHo`X[̳C\Nvx\vDB$\NRүYD]u"@b'e C!鑚H25u`eu5tzHrza R^(m IfX|Se¯?{}}%͖M } uC!~5__aX^vTo JBz5FE>cB$ff^_beoT8h$E[ƵvJ \(vDײ3I2hL۵ <9JۅSΥJq4R7o߭본cy܊7v=/)|*].rȦɎ i-~q@)'/S] x7.9sd%k1J f$O3!h$lF0W.$+Ŕ+a?o\+oWJ '),}ddO&C$*TlGߺ\tu&2جp8'`׃vad(*TieK/q*_J DnFԦfF/w"y*7$_3hl= d2FGEE }W1Et8ňx%MթY͛0˱Pk2s:-3BFefBz,O=/l jE행B"b+Y׏GǑHȽReDo%rLl&SVoH'}Y McX{E$kF6@yU8J122RhC`m=>>~Db*Vr_0CzwH&KW %Ϗ?.w !KJy:*sl Y*Zn&mC/#0iV R6:*cI$ݶ{kS{?-/b8F;q<]#{jּ V'8? +Yw($s[EU!0Ku%B##kd%ju o=,٥tZ&Biu"KnLFv1֯wdY˯Ed?{J}*|j#5 f"J)rކ|dGT('Rr=w#ID̴ۜ'ZBτdX;cZ('a$8rMf]uɤvLF~ J{z ڽ+ұ1n;Tn`v9 QV"s9fB<DsRLж1<Ջ\Dp*:kW=Mvsv.g|#ϛ5o8T0Xhn^.~^UEN4cJim{'pI%rA.G0}Xx4=Ǽ)S9DnV7(=^ҠaS74~MCHU HS^MG{Z#9]ʑ\v['jT<VNYܪ 5ҿify72_XdUd+oK]o^ޫz,C uT$b= N&FG&CC& hd\/ yKYOKQS(9 rvLs7I. !@fse7L,f^8Rm׀f>l;81축X4v@gkchڅ@ވ}WZƫ x4*w}{[2;ѻ}RD̑T!`hS@'%\m` |"-|ٸ38Xt*["I!"pBdb(',*DVCkxIih/sa|e܇_=dD`- :6&K`QXLH$R`M\hwS!\' N1k٫ކ7SNDvs&۹./Ɉ\Hژr&MKs &K=:TJTTɕziy @k ;Xk;i܍UY!NLߎ̟i24F?9ġGwG>TCv\Nn dd5gd& sBQk73r9aaOǣQPio'1$,qh($/EoCl^vgˆNSՔЉ莰Y !xzQ1 ;!,?|UXOBX.|~mbu7sws,9Ո兇3U0Q)NSV?ecTNH-JC9LAD`J|V_f Ȗlϋ9DnF߯۞ mXp}ehA9baښl:Ѧ nwyw'͝;M73Ȯgh4.d3Q4%Ad726<<8%2H;k_}^)llWջbVHi,E%㙂  jJէ p]3~@p!N=ٮXO*MȪ5b~-POWjuW,QjRr|@@@@g1U*c_(c ߤUN;inl鈦g(=ݲ±J>k P~zhBR_Sj|/σu $XǑD 4a 3Ugf~"ϝBvv_I_U5v@4n ~a;FjIg PgmTc 2VQ#Cժ)ᰪVe2G]Ŏyژg|.n~*kf{#y@Ǚ.p[g s4)E%c"Թ3@U[u!x1EjnORЃs6?L./AC0@5l\o>DUA<_, Cu߯nc>zW`PҵZ3U8"F^#kVMplΈǀ] .^IJl:_lؒj8+bnONj Q'xW3QO5ݰr4|v$VlYXI^AQ'oIF0@^ЯB,#*zi)]Aϖ<|q3}ƻ>G"pZi2#zYw 6J}o~=tz }3|DNg>]VMح8D;Tir5ԎCؓJ*Dk3{?lGM`~h]$sC(c{ym "TwaUGM)R3a{al7,\pWm7a-6Af; VՄ6L!q+q>tGDm7I9C &wk*ی`˨.STj/#F*ϴݧlm wl?L{,m&̓Y%<ە:a">mbe/9G!7bu]H"<\ف/Gy b;D:qkA#a_vi}[)1!ے=k*]5!al$~TZcea.~m\A{ʚ )#>Wag=څڷx2DsɶcAgkҰ.g7h`}3O'BlT)3Rw Zjr`x_Wsk&:_fn</p5DɝA|&R5zrOr|f}Sc6bVHI-ZSu RuH('s5/RdM~fi2^7NrL`}{꽰9.s Vo&8{`O5;S2ÇT/'Ҽvݷ9ن2gxx.0T+˰qE~_M4,-\]!DY+Vt8p!wz.ztA?`Q+Q J54RΏ(:s.GҨawgЏ5aX5qp-d)z1hHX]HVA{ ;wR]O9~@Y^Wd{4y]m]~ۉ?5.W1؄~oU/uH~6]"{hX-uyeJ1.DUSjfuK"eWP.tc;wn\RsHm HfO~~sk +XzH$nafnƑkVgRR .xHk "+kYB: }Cp\ DX#6GZWOͳ ~Cww7]]]a ~KRe2$>sΥK,Yp #4cE_,G8>F$-Nmq#/: q|Y]f # 5.gE"{{{=D""]]]tuu x<t5rۻLmC [';@ bB@Đ$Sߗ&9FJ~H/" ph"фD׋RD"Q$ax<]uU# 0 բrm–ݦU5[mD=mLV'Glf{@t9DgIkELr R"7 Ϛhp*Bxx<|>~?~`0HGGtwwrDQRi~}>=7GΖ,߀li [S`8@DÍn#arpſ^׋#I?H(s<n|ȳ=# G5 ھO7}Oq,u&3 0p_l\l6K6-t(Id22 lVk_Rihv3V(ĐfIӤiRdX,VT|>|QśH$HR3 ֭Gd@yڭuѭCOd2I*"HEy*bq$dM6ujZ@jJjtN f|Ed2ECljFF$ &Ds!℧q0XoNj.% J&EWTX,c||B$k`EUfwSX8HB7*\΢RJL&cS"8IDATa1>>ؘo|}O?MH o !zxDt,OIx<$eX,ffnǷqLO>ׇv ;;;(ka]{jѻJRt`~C ÕHv@V, zhWxzxmX?TԟIEx҄ўimCB &C=,WN5nHZe6!Pg[Ӯ0!Vh-bк9p!.&zbv q08GɻыKr0{TJڬ(5J9g5e߻CrvNprK:Sؙꉤ^$*O#g~</s6G:H݁E\1d {DNq8p`t)ùPIENDB`periodictable-1.5.0/doc/sphinx/_static/logo_small.png000066400000000000000000000210111310514471200226560ustar00rootroot00000000000000PNG  IHDRdq#|bKGDC pHYs__]݋ vpAgdq IDATxy|U쓙,fk4MwhKk[H/"X\Upa"K]6p /ޟ"ʵ(A(@k ҽٛm2̜&& 5N'<9/猓\د,0>8:`#Wc\3N  H-ұ ;(pX \ lAD0qv 8{\sI˭vƻZ`(-mE#ׁEc=#\nF@`'v$ix 7xIpRUD`!=1 (kpXOb®BR{ g'Vd86`MKzRoeT%ü4QNj=Jjⱞ[(ixZ<\Σ,!U(.Ȏ̸x&)@rygO(V0 NEv;ʱdo)Yo & u80^ r?;?LϭL̞=) 6!"F1&D9A(CBUNtd?6!5Hƃڇ~SNe͚5 B,((p.))y~ٲeZlKc*)d"p&JMʐ*\:`R[k@RWlR2yu8[ J. ɓ'SXX.F֭[;= 7nX"ø~!n+FZ`(uь1$->ZAR"Wy~j D\Iv 5K̷Ne}v_^PP,)) rrrhnn{M>QUU5\31$ĸ^(QTNx6;AsP"v{1fi!N$H!U3z Q7, v AQ-˺8~?@&OL(vDmmxdqawk#iDrPsJQ `b5(n T;kO>\êaݣ!X?_h)3ƐJHR$IbHD"A*"Hxv9O`֭l!Iz(es" l$]g.qZ{c蹣Nd[v!#mH"t>J!6~Cvz?{7prss x<R444P[[Kmm-޽|L6g}&hg6)BH"1l ~ 5G 9 +x2␑vdh#)ED" p8QZ[[d}{ȉ7oTH6qaD@{7#+!adKN3:HLpA^^.x Ex^STTd*++ʹiLEE)((0g0JÏ nȬ0qKcH鼹zp#wz- ;hs]y"$,8t:HYyALC:t=cp+@"[ E)hFD |^ E*~nF-g|\<roF.~^caZk!f<{N/ tR^V!׷7)v6"aQld غo_5:ۋ0c&c 1O8CėA>XN Eכp1N{eƘrcL᭷ZzWCȮ|%'01|N!kь^1D)k֬)Xx̙Ss))--EbF`MeȎ9QPG/?yLB!Xe,ysK[Y Ulmu8SFh@QM8ZA刳\VV6kZm۶ٱX,KgQ\.o+**Ι3ٳg3sLL墦_H$yk͛ 6Qpa{ծP(tqn.K(lPl +&(n7TWî]|mm-{\$JJسdyj;oskjj5ƸDs6q&bIH~\WXvzA())!//OKKˢ|Az5{aΧCiH>SPg֫ zlFzB!B($) i+˯>~?gìްN0x6 NeYGybڥk!5;(o}gnׂt:$HňF466v qhpǎU $t(uuǵq85ʠBHO'}sCM$ 3: SVjldҮ]\95/<;oqw}E!Á@Uo!8؁4HV b1N'---444l% ,?#"QQEd08P%$I0@˲b455zGGS{`. VX[HVۄDi`"Ѩ$$y3l%N|r(,`.Sk)f?)F"jͺW$onJ-tF]އb{kd~ѷET(rJЁ`GQסChjjcYV~D:;;NמWP&Oe6AbH"c@*hlOR6Ai)NIR6=C^O"T uNw :;鰬K{ӫ/j_h=ٝmb~wH(A(uvvwvv=S  l#ړ=ۀf NWdhA#ǥrr 1*+%=(9LB{jkXq~fؠ I3HFERn3YHA)/svF$fIh!$E$k_w}v TMF [^pBg])r)ڍnNKr:;EXLoY`YœNЙpagс}aPrtt,o9\ͩE3 wGx=\TYk/xJ;\$ZwVwNlj b3y&^C$mm 55"H2)JAA 93+ZW9[\ X_sU 4ًMː7V$^CݰDbmbAW WII HN~ɛj]фfLEP8ɱ?n#eS^IH %-or_RRamiZ'چkf$hA[I|:gj'TXֶesUʢ/ېcmk$0]v& ̂P6Dy4ٱ`*%IM_Wy^+EP2leMqs 6ʇGZ|i,{|:yW`6d{O|EZÇeiҵt w1c&TNS)nNh%b:"D]ܰpᆆ_ R\O6!áK.QhHtK/Gr-=0񸏆Yt­ԥJË\9fdaCvBM-8\p8 jj:io/q{ 2n ھ uH~[=(I 61f ۾I6!/E[G^˜UHG@"@u8tx\|s3q-J%C ʟn%xc26ԇu?RC1&֢Lcx H-EW5Nrѕ23p7 cYx+M31Vs5|;uW<_"p c.c~crrt、sQLd'RUCb:UaܫOXpFMd!i߻^0K,Y1IY >3y1'lyz1W_mg4w,ٚwi&62j1]'8~b66 CY PdPrĩ^E88`_=!K z^XۚT 1NnxhmW="D%Yb O38nA]_D S."?%ގw_Af'3߀%,z^Ϙcʌ:՘)S)*2&k9ݞݶGc(#Ѐb; T{{Q|H`=8PHQ)t6k^kvz2 >_5;=sk,DeFT(G^.՘-cO*zRPþH!u FݎD /^k{xLgHoG[ tec5bꟁv%=q!o%'rȵ ^ԾR(!-Ȉ! %{s`C(#2Xr-yy(JmBYB۾=)QNl}|~B緐9Z>!l. ^ĩiT?͍Ն3D]tG:zS E½8 CK?eKzriwd Ghh@:C'`k>ZV.U2(?ZsmG d= Hh EBĺz&tN}QhkFRystb i؏ne>?X 5,_I!ZQ==&Bʍ #z?Zh?q!UE|1е#\Tp#2+7T$a{yeKQՌ(FڃD8i@?e`ŧ˝B9g y(OQE>d p#A62C/yQTeNc؍\ 䟁#՘t:F)oC{0.!QıEiF6ĠHȠ֢9s0+{=Α<:s؅L= #P U! qiZא~ԟ"d`; `NE6T).C4*7 U4y$.>S|pG ~2 3/_;wo/>ovm0='M {΍H @Q9b|$9R홒ClpM]IIjEkcy~>w_I* ~RYYyә:u*x^iiii+/ñ73Ϝ=& GTҕˬSf6rȳlIhCQ,yABFзgWVT*,k9B&MDUU`Çk׮ ;v|~53Q~@*a)ICk#^}h r_t?$9"p |r9 0a&NH2$+7o|矿yȜ>>Ʌ{b3`.0!JI<hkk#ǭL'\r(Lwǟa@%tEXtcreate-date2010-06-07T12:10:07-04:00&vU%tEXtmodify-date2010-06-07T12:06:42-04:00uJtEXtsignature0e01bf9867259504bafb2500fbe0349c617f86978b0c8db4bbe20c0009914703ptdIENDB`periodictable-1.5.0/doc/sphinx/_static/mathconf.js000066400000000000000000000001301310514471200221540ustar00rootroot00000000000000MathJax.Hub.Config({ TeX: { Macros: { AA: '\\unicode{x212B}', } } }); periodictable-1.5.0/doc/sphinx/_static/site.css000066400000000000000000000203751310514471200215120ustar00rootroot00000000000000/** * Alternate Sphinx design * Originally created by Armin Ronacher for Werkzeug, adapted by Georg Brandl. */ body { font-family: 'Lucida Grande', 'Lucida Sans Unicode', 'Geneva', 'Verdana', sans-serif; font-size: 14px; letter-spacing: -0.01em; line-height: 150%; text-align: center; /*background-color: #AFC1C4; */ background-color: #BFD1D4; color: black; padding: 0; border: 1px solid #aaa; margin: 0px 80px 0px 80px; min-width: 740px; } #banner { background-color: white; text-align: left; vertical-align: middle; padding: 10px 10px 15px 15px; font-size: 100px; } a { color: #CA7900; text-decoration: none; } a:hover { color: #2491CF; } pre { font-family: 'Consolas', 'Deja Vu Sans Mono', 'Bitstream Vera Sans Mono', monospace; font-size: 0.95em; letter-spacing: 0.015em; padding: 0.5em; border: 1px solid #ccc; background-color: #f8f8f8; overflow: auto; } td.linenos pre { padding: 0.5em 0; border: 0; background-color: transparent; color: #aaa; } table.highlighttable { margin-left: 0.5em; } table.highlighttable td { padding: 0 0.5em 0 0.5em; } cite, code, tt { font-family: 'Consolas', 'Deja Vu Sans Mono', 'Bitstream Vera Sans Mono', monospace; font-size: 0.95em; letter-spacing: 0.01em; } hr { border: 1px solid #abc; margin: 2em; } tt { background-color: #f2f2f2; border-bottom: 1px solid #ddd; color: #333; } tt.descname { background-color: transparent; font-weight: bold; font-size: 1.2em; border: 0; } tt.descclassname { background-color: transparent; border: 0; } tt.xref { background-color: transparent; font-weight: bold; border: 0; } a tt { background-color: transparent; font-weight: bold; border: 0; color: #CA7900; } a tt:hover { color: #2491CF; } dl { margin-bottom: 15px; } dd p { margin-top: 0px; } dd ul, dd table { margin-bottom: 10px; } dd { margin-top: 3px; margin-bottom: 10px; margin-left: 30px; } .refcount { color: #060; } dt:target, .highlight { background-color: #fbe54e; } dl.class, dl.function { border-top: 2px solid #888; } dl.method, dl.attribute { border-top: 1px solid #aaa; } dl.glossary dt { font-weight: bold; font-size: 1.1em; } pre { line-height: 120%; } pre a { color: inherit; text-decoration: underline; } .first { margin-top: 0 !important; } div.document { background-color: white; text-align: left; background-image: url(contents.png); background-repeat: repeat-x; } /* div.documentwrapper { width: 100%; } */ div.clearer { clear: both; } div.related h3 { display: none; } div.related ul { background-image: url(navigation.png); height: 2em; list-style: none; border-top: 1px solid #ddd; border-bottom: 1px solid #ddd; margin: 0; padding-left: 10px; } div.related ul li { margin: 0; padding: 0; height: 2em; float: left; } div.related ul li.right { float: right; margin-right: 5px; } div.related ul li a { margin: 0; padding: 0 5px 0 5px; line-height: 1.75em; color: #EE9816; } div.related ul li a:hover { color: #3CA8E7; } div.body { margin: 0; padding: 0.5em 20px 20px 20px; } div.bodywrapper { margin: 0 240px 0 0; border-right: 1px solid #ccc; } div.body a { text-decoration: underline; } div.sphinxsidebar { margin: 0; padding: 0.5em 15px 15px 0; width: 210px; float: right; text-align: left; /* margin-left: -100%; */ } div.sphinxsidebar h4, div.sphinxsidebar h3 { margin: 1em 0 0.5em 0; font-size: 0.9em; padding: 0.1em 0 0.1em 0.5em; color: white; border: 1px solid #86989B; background-color: #AFC1C4; } div.sphinxsidebar ul { padding-left: 1.5em; margin-top: 7px; list-style: none; padding: 0; line-height: 130%; } div.sphinxsidebar ul ul { list-style: square; margin-left: 20px; } p { margin: 0.8em 0 0.5em 0; } p.rubric { font-weight: bold; } h1 { margin: 0; padding: 0.7em 0 0.3em 0; font-size: 1.5em; color: #11557C; } h2 { margin: 1.3em 0 0.2em 0; font-size: 1.35em; padding: 0; } h3 { margin: 1em 0 -0.3em 0; font-size: 1.2em; } h1 a, h2 a, h3 a, h4 a, h5 a, h6 a { color: black!important; } h1 a.anchor, h2 a.anchor, h3 a.anchor, h4 a.anchor, h5 a.anchor, h6 a.anchor { display: none; margin: 0 0 0 0.3em; padding: 0 0.2em 0 0.2em; color: #aaa!important; } h1:hover a.anchor, h2:hover a.anchor, h3:hover a.anchor, h4:hover a.anchor, h5:hover a.anchor, h6:hover a.anchor { display: inline; } h1 a.anchor:hover, h2 a.anchor:hover, h3 a.anchor:hover, h4 a.anchor:hover, h5 a.anchor:hover, h6 a.anchor:hover { color: #777; background-color: #eee; } table { border-collapse: collapse; margin: 0 -0.5em 0 -0.5em; } table td, table th { padding: 0.2em 0.5em 0.2em 0.5em; } div.footer { background-color: #E3EFF1; color: #86989B; padding: 3px 8px 3px 0; clear: both; font-size: 0.8em; text-align: right; } div.footer a { color: #86989B; text-decoration: underline; } div.pagination { margin-top: 2em; padding-top: 0.5em; border-top: 1px solid black; text-align: center; } div.sphinxsidebar ul.toc { margin: 1em 0 1em 0; padding: 0 0 0 0.5em; list-style: none; } div.sphinxsidebar ul.toc li { margin: 0.5em 0 0.5em 0; font-size: 0.9em; line-height: 130%; } div.sphinxsidebar ul.toc li p { margin: 0; padding: 0; } div.sphinxsidebar ul.toc ul { margin: 0.2em 0 0.2em 0; padding: 0 0 0 1.8em; } div.sphinxsidebar ul.toc ul li { padding: 0; } div.admonition, div.warning { font-size: 0.9em; margin: 1em 0 0 0; border: 1px solid #86989B; background-color: #f7f7f7; } div.admonition p, div.warning p { margin: 0.5em 1em 0.5em 1em; padding: 0; } div.admonition pre, div.warning pre { margin: 0.4em 1em 0.4em 1em; } div.admonition p.admonition-title, div.warning p.admonition-title { margin: 0; padding: 0.1em 0 0.1em 0.5em; color: white; border-bottom: 1px solid #86989B; font-weight: bold; background-color: #AFC1C4; } div.warning { border: 1px solid #940000; } div.warning p.admonition-title { background-color: #CF0000; border-bottom-color: #940000; } div.admonition ul, div.admonition ol, div.warning ul, div.warning ol { margin: 0.1em 0.5em 0.5em 3em; padding: 0; } div.versioninfo { margin: 1em 0 0 0; border: 1px solid #ccc; background-color: #DDEAF0; padding: 8px; line-height: 1.3em; font-size: 0.9em; } a.headerlink { color: #c60f0f!important; font-size: 1em; margin-left: 6px; padding: 0 4px 0 4px; text-decoration: none!important; visibility: hidden; } h1:hover > a.headerlink, h2:hover > a.headerlink, h3:hover > a.headerlink, h4:hover > a.headerlink, h5:hover > a.headerlink, h6:hover > a.headerlink, dt:hover > a.headerlink { visibility: visible; } a.headerlink:hover { background-color: #ccc; color: white!important; } table.indextable td { text-align: left; vertical-align: top; } table.indextable dl, table.indextable dd { margin-top: 0; margin-bottom: 0; } table.indextable tr.pcap { height: 10px; } table.indextable tr.cap { margin-top: 10px; background-color: #f2f2f2; } img.center { text-align: center; margin-left: auto; margin-right: auto; display: block; } img.toggler { margin-right: 3px; margin-top: 3px; cursor: pointer; } img.inheritance { border: 0px } form.pfform { margin: 10px 0 20px 0; } table.contentstable { width: 90%; } table.contentstable p.biglink { line-height: 150%; } a.biglink { font-size: 1.3em; } span.linkdescr { font-style: italic; padding-top: 5px; font-size: 90%; } ul.search { margin: 10px 0 0 20px; padding: 0; } ul.search li { padding: 5px 0 5px 20px; background-image: url(file.png); background-repeat: no-repeat; background-position: 0 7px; } ul.search li a { font-weight: bold; } ul.search li div.context { color: #888; margin: 2px 0 0 30px; text-align: left; } ul.keywordmatches li.goodmatch a { font-weight: bold; } periodictable-1.5.0/doc/sphinx/_templates/000077500000000000000000000000001310514471200205345ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/_templates/layout.html000066400000000000000000000011131310514471200227330ustar00rootroot00000000000000{% extends "!layout.html" %} {% set script_files = script_files + ["_static/mathconf.js"] %} {% block rootrellink %}
  • home
  • search
  • {% endblock %} {% block relbar1 %} {{ super() }} {% endblock %} {# put the sidebar before the body #} {% block sidebar1 %}{{ sidebar() }}{% endblock %} {% block sidebar2 %}{% endblock %} periodictable-1.5.0/doc/sphinx/api/000077500000000000000000000000001310514471200171505ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/api/activation.rst000066400000000000000000000006711310514471200220470ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Neutron activation ****************************************************************************** :mod:`periodictable.activation` ============================================================================== .. automodule:: periodictable.activation :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/constants.rst000066400000000000000000000006721310514471200217230ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Fundamental constants ****************************************************************************** :mod:`periodictable.constants` ============================================================================== .. automodule:: periodictable.constants :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/core.rst000066400000000000000000000006451310514471200206370ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Core table ****************************************************************************** :mod:`periodictable.core` ============================================================================== .. automodule:: periodictable.core :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/covalent_radius.rst000066400000000000000000000007001310514471200230610ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Covalent radius ****************************************************************************** :mod:`periodictable.covalent_radius` ============================================================================== .. automodule:: periodictable.covalent_radius :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/cromermann.rst000066400000000000000000000007161310514471200220470ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** X-ray scattering factor f0 calculations ****************************************************************************** :mod:`periodictable.cromermann` ============================================================================== .. automodule:: periodictable.cromermann :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/crystal_structure.rst000066400000000000000000000007061310514471200235060ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Crystal structure ****************************************************************************** :mod:`periodictable.crystal_structure` ============================================================================== .. automodule:: periodictable.crystal_structure :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/density.rst000066400000000000000000000006501310514471200213620ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Density ****************************************************************************** :mod:`periodictable.density` ============================================================================== .. automodule:: periodictable.density :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/formulas.rst000066400000000000000000000006761310514471200215430ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Chemical formula operations ****************************************************************************** :mod:`periodictable.formulas` ============================================================================== .. automodule:: periodictable.formulas :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/index.rst000066400000000000000000000010161310514471200210070ustar00rootroot00000000000000.. Autogenerated by genmods.py .. _api-index: ############################################################################## Reference ############################################################################## .. only:: html :Release: |version| :Date: |today| .. toctree:: core.rst formulas.rst covalent_radius.rst constants.rst crystal_structure.rst density.rst fasta.rst magnetic_ff.rst mass.rst activation.rst nsf.rst xsf.rst cromermann.rst plot.rst util.rst periodictable-1.5.0/doc/sphinx/api/magnetic_ff.rst000066400000000000000000000006751310514471200221540ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Magnetic Form Factor ****************************************************************************** :mod:`periodictable.magnetic_ff` ============================================================================== .. automodule:: periodictable.magnetic_ff :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/mass.rst000066400000000000000000000006371310514471200206530ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Mass ****************************************************************************** :mod:`periodictable.mass` ============================================================================== .. automodule:: periodictable.mass :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/nsf.rst000066400000000000000000000006661310514471200205000ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Neutron scattering potentials ****************************************************************************** :mod:`periodictable.nsf` ============================================================================== .. automodule:: periodictable.nsf :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/plot.rst000066400000000000000000000006521310514471200206630ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Element plotter ****************************************************************************** :mod:`periodictable.plot` ============================================================================== .. automodule:: periodictable.plot :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/util.rst000066400000000000000000000006541310514471200206640ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** Utility functions ****************************************************************************** :mod:`periodictable.util` ============================================================================== .. automodule:: periodictable.util :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/api/xsf.rst000066400000000000000000000006641310514471200205100ustar00rootroot00000000000000.. Autogenerated by genmods.py ****************************************************************************** X-ray scattering potentials ****************************************************************************** :mod:`periodictable.xsf` ============================================================================== .. automodule:: periodictable.xsf :members: :undoc-members: :inherited-members: :show-inheritance: periodictable-1.5.0/doc/sphinx/conf.py000066400000000000000000000202711310514471200177000ustar00rootroot00000000000000# -*- coding: utf-8 -*- # # Periodic Table documentation build configuration file, created by # sphinx-quickstart on Tue Jun 2 11:16:08 2009. # # This file is execfile()d with the current directory set to its containing dir. # # Note that not all possible configuration values are present in this # autogenerated file. # # All configuration values have a default; values that are commented out # serve to show the default. import sys, os # If extensions (or modules to document with autodoc) are in another directory, # add these directories to sys.path here. If the directory is relative to the # documentation root, use os.path.abspath to make it absolute, like shown here. #sys.path.append(os.path.abspath('_extensions'+(os.path.dirname('../../periodictable')))) import glob sys.path.insert(0, os.path.abspath('.')) # needed for extension tests #buildpath = glob.glob('../../build/lib*')[0] #sys.path.insert(0, os.path.abspath(buildpath)) sys.path.insert(0, os.path.abspath('../..')) sys.path.insert(0, os.path.abspath('_extensions')) import periodictable # -- General configuration ----------------------------------------------------- # Add any Sphinx extension module names here, as strings. They can be extensions # coming with Sphinx (named 'sphinx.ext.*') or your custom ones. extensions = ['sphinx.ext.autodoc', 'sphinx.ext.doctest', 'sphinx.ext.coverage', #'sphinx.ext.pngmath', 'sphinx.ext.mathjax', #'only_directives', #'matplotlib.sphinxext.mathmpl', 'matplotlib.sphinxext.only_directives', 'matplotlib.sphinxext.plot_directive', 'dollarmath', ] # MathJax CDN is discontinued mathjax_path = "https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.1/MathJax.js?config=TeX-MML-AM_CHTML" # Add any paths that contain templates here, relative to this directory. templates_path = ['_templates'] # The suffix of source filenames. source_suffix = '.rst' # The encoding of source files. #source_encoding = 'utf-8' # The master toctree document. master_doc = 'index' # General information about the project. project = 'Periodic Table' copyright = '2009, Paul Kienzle' # The version info for the project you're documenting, acts as replacement for # |version| and |release|, also used in various other places throughout the # built documents. # # The short X.Y version. version = periodictable.__version__ # The full version, including alpha/beta/rc tags. release = version # The language for content autogenerated by Sphinx. Refer to documentation # for a list of supported languages. #language = None # There are two options for replacing |today|: either, you set today to some # non-false value, then it is used: #today = '' # Else, today_fmt is used as the format for a strftime call. #today_fmt = '%B %d, %Y' # List of documents that shouldn't be included in the build. #unused_docs = [] # List of directories, relative to source directory, that shouldn't be searched # for source files. exclude_trees = ['_*','build','plots','shelltable','discoverer'] # The reST default role (used for this markup: `text`) to use for all documents. #default_role = None # If true, '()' will be appended to :func: etc. cross-reference text. #add_function_parentheses = True # If true, the current module name will be prepended to all description # unit titles (such as .. function::). #add_module_names = True # If true, sectionauthor and moduleauthor directives will be shown in the # output. They are ignored by default. #show_authors = False # The name of the Pygments (syntax highlighting) style to use. pygments_style = 'sphinx' # A list of ignored prefixes for module index sorting. #modindex_common_prefix = [] # -- Options for HTML output --------------------------------------------------- # The theme to use for HTML and HTML Help pages. Major themes that come with # Sphinx are currently 'default' and 'sphinxdoc'. html_theme = 'default' html_theme_options = { "rightsidebar":"False", "relbarbgcolor": "Gainsboro", #"codebgcolor": "Beige", "footertextcolor": "orange", "relbartextcolor": "Blue", "sidebarbgcolor": "white", "sidebarlinkcolor": "OrangeRed", "sidebartextcolor": "Navy", "linkcolor": "Blue", "relbarlinkcolor": "Blue" #"headtextcolor": "Teal" #"headbgcolor": "Oldlace", } html_style = 'site.css' # Theme options are theme-specific and customize the look and feel of a theme # further. For a list of options available for each theme, see the # documentation PaleTurquoise. #html_theme_options = {} # Add any paths that contain custom themes here, relative to this directory. #html_theme_path = [] # The name for this set of Sphinx documents. If None, it defaults to # " v documentation". html_title = "PeriodicTable" # A shorter title for the navigation bar. Default is the same as html_title. html_short_title = "Home" # The name of an image file (relative to this directory) to place at the top # of the sidebar. #html_logo = '_static/periodic_logo.png' # The name of an image file (within the static path) to use as favicon of the # docs. This file should be a Windows icon file (.ico) being 16x16 or 32x32 # pixels large. #html_favicon = None # Add any paths that contain custom static files (such as style sheets) here, # relative to this directory. They are copied after the builtin static files, # so a file named "default.css" will overwrite the builtin "default.css". html_static_path = ['_static'] # If not '', a 'Last updated on:' timestamp is inserted at every page bottom, # using the given strftime format. #html_last_updated_fmt = '%b %d, %Y' # If true, SmartyPants will be used to convert quotes and dashes to # typographically correct entities. #html_use_smartypants = True # Custom sidebar templates, maps document names to template names. #html_sidebars = {} # Additional templates that should be rendered to pages, maps page names to # template names. #html_additional_pages = {} # If false, no module index is generated. #html_use_modindex = True # If false, no index is generated. #html_use_index = True # If true, the index is split into individual pages for each letter. #html_split_index = False # If true, links to the reST sources are added to the pages. html_show_sourcelink = False # If true, an OpenSearch description file will be output, and all pages will # contain a tag referring to it. The value of this option must be the # base URL from which the finished HTML is served. #html_use_opensearch = '' # If nonempty, this is the file name suffix for HTML files (e.g. ".xhtml"). #html_file_suffix = '' # Output file base name for HTML help builder. htmlhelp_basename = 'PeriodicTabledoc' # -- Options for LaTeX output -------------------------------------------------- # The paper size ('letter' or 'a4'). #latex_paper_size = 'letter' # The font size ('10pt', '11pt' or '12pt'). #latex_font_size = '10pt' # Grouping the document tree into LaTeX files. List of tuples # (source start file, target name, title, author, documentclass [howto/manual]). latex_documents = [ ('index', 'PeriodicTable.tex', 'Periodic Table Documentation', 'Paul Kienzle', 'manual'), ] # The name of an image file (relative to this directory) to place at the top of # the title page. #latex_logo = None # For "manual" documents, if this is true, then toplevel headings are parts, # not chapters. #latex_use_parts = False # Additional stuff for the LaTeX preamble. #latex_preamble = '' LATEX_PREAMBLE=r""" \renewcommand{\AA}{\text{\r{A}}} % Allow \AA in math mode \usepackage[utf8]{inputenc} % Allow unicode symbols in text \DeclareUnicodeCharacter {00B7} {\ensuremath{\cdot}} % cdot \DeclareUnicodeCharacter {00B0} {\ensuremath{^\circ}} % degrees \DeclareUnicodeCharacter {212B} {\AA} % Angstrom """ latex_elements = {'preamble' : LATEX_PREAMBLE} # Documents to append as an appendix to all manuals. #latex_appendices = [] # If false, no module index is generated. #latex_use_modindex = True # Which class/__init__ docstring to use: class, init, or both autoclass_content = 'both' # Autodoc member sort order: by class or by type autodoc_member_order = 'groupwise' if os.path.exists('rst_prolog'): with open('rst_prolog') as fid: rst_prolog = fid.read() periodictable-1.5.0/doc/sphinx/discoverer/000077500000000000000000000000001310514471200205445ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/discoverer/__init__.py000066400000000000000000000005061310514471200226560ustar00rootroot00000000000000import periodictable.core # Delayed loading of the element discoverer information def _load_discoverer(): """ The name of the person or group who discovered the element. """ from . import core core.init(periodictable.core.default_table()) periodictable.core.delayed_load(['discoverer'], _load_discoverer) periodictable-1.5.0/doc/sphinx/discoverer/core.py000066400000000000000000000013611310514471200220470ustar00rootroot00000000000000""" Partial table of element discoverers. From http://en.wikipedia.org/wiki/Discoveries_of_the_chemical_elements. """ import periodictable.core def init(table, reload=False): if 'discoverer' in table.properties and not reload: return table.properties.append('discoverer') # Set the default, if any periodictable.core.Element.discoverer = "Unknown" # Not numeric, so no discoverer_units # Load the data for name,person in data.items(): el = table.name(name) el.discoverer = person data = dict( arsenic="Jabir ibn Hayyan", antimony="Jabir ibn Hayyan", bismuth="Jabir ibn Hayyan", phosphorus="H. Brand", cobalt="G. Brandt", platinum="A. de Ulloa", nickel="A.F. Cronstedt", magnesium="J. Black", ) periodictable-1.5.0/doc/sphinx/genmods.py000066400000000000000000000040451310514471200204100ustar00rootroot00000000000000from __future__ import with_statement import os.path MODULE_TEMPLATE=""".. Autogenerated by genmods.py ****************************************************************************** %(name)s ****************************************************************************** :mod:`%(package)s.%(module)s` ============================================================================== .. automodule:: %(package)s.%(module)s :members: :undoc-members: :inherited-members: :show-inheritance: """ INDEX_TEMPLATE=""".. Autogenerated by genmods.py .. _api-index: ############################################################################## %(package_name)s ############################################################################## .. only:: html :Release: |version| :Date: |today| .. toctree:: %(rsts)s """ def genfiles(package, package_name, modules, dir='api'): if not os.path.exists(dir): os.makedirs(dir) for module,name in modules: with open(os.path.join(dir,module+'.rst'), 'w') as f: f.write(MODULE_TEMPLATE%locals()) rsts = "\n ".join(module+'.rst' for module,name in modules) with open(os.path.join(dir,'index.rst'),'w') as f: f.write(INDEX_TEMPLATE%locals()) modules=[ #('__init__', 'Top level namespace'), ('core', 'Core table'), ('formulas', 'Chemical formula operations'), #('chemicals', 'Chemical database'), ('covalent_radius', 'Covalent radius'), ('constants', 'Fundamental constants'), ('crystal_structure', 'Crystal structure'), ('density', 'Density'), ('fasta', 'FASTA format for DNA/RNA and amino acid sequences'), ('magnetic_ff', 'Magnetic Form Factor'), ('mass', 'Mass'), ('activation', 'Neutron activation'), ('nsf', 'Neutron scattering potentials'), ('xsf', 'X-ray scattering potentials'), ('cromermann', 'X-ray scattering factor f0 calculations'), ('plot', 'Element plotter'), ('util', 'Utility functions'), ] package='periodictable' package_name='Reference' genfiles(package, package_name, modules) periodictable-1.5.0/doc/sphinx/guide/000077500000000000000000000000001310514471200174745ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/guide/bundle.rst000066400000000000000000000013021310514471200214730ustar00rootroot00000000000000 .. bundling: ******************** Bundling with py2exe ******************** When using periodictable as part of a bundled package, you need to be sure to include the data associated with the tables. This can be done by adding a periodictable entry into the `package_data` property of the distutils setup file:: import periodictable ... setup(..., package_data=periodictable.package_data, ...) If you have a number of packages which add package data (for example, periodic table extensions), then you can use the following:: import periodictable package_data = {} ... package_data.update(periodictable.package_data) ... setup(..., package_data=package_data, ...) periodictable-1.5.0/doc/sphinx/guide/contributing.rst000066400000000000000000000040611310514471200227360ustar00rootroot00000000000000.. _contributing: ******************** Contributing Changes ******************** The best way to contribute to the periodic table package is to work from a copy of the source tree in the revision control system. The source is available via git:: git clone https://github.com/pkienzle/periodictable.git cd periodictable python setup.py develop By using the *develop* keyword on setup.py, changes to the files in the package are immediately available without the need to run setup.py install each time. Track updates to the original package using:: git pull If you find you need to modify the periodic table package, please update the documentation and add tests for your changes. We use doctests on all of our examples that we know our documentation is correct. More thorough tests are found in test directory. Using the the nose test package, you can run both sets of tests:: easy_install nose python2.6 tests.py python2.7 tests.py python3.3 tests.py When all the tests run, generate a patch and send it to the `DANSE `_ Project mailing list at danse-dev@cacr.caltech.edu:: git diff > patch Alternatively, create a project fork at github and we can pull your changes directly from your repository. Windows user can use `TortoiseGit `_ package which provides similar operations. You can then build the documentation as follows:: easy_install sphinx (cd doc/sphinx && make clean html pdf) You can see the result by pointing your browser to:: periodictable/doc/sphinx/_build/html/index.html periodictable/doc/sphinx/_build/latex/PeriodicTable.pdf ReStructured text format does not have a nice syntax for superscripts and subscripts. Units such as |g/cm^3| are entered using macros such as \|g/cm^3| to hide the details. The complete list of macros is available in doc/sphinx/rst_prolog In addition to macros for units, we also define cdot, angstrom and degrees unicode characters here. The corresponding latex symbols are defined in doc/sphinx/conf.py. periodictable-1.5.0/doc/sphinx/guide/customizing.rst000066400000000000000000000043431310514471200226050ustar00rootroot00000000000000.. _custom-table: ************* Custom tables ************* You can create your own private instance of PeriodicTable and populate it with values. Example: .. doctest:: >>> import periodictable >>> from periodictable import core, mass, density, elements, formula >>> mytable = core.PeriodicTable(table="H=1") >>> mass.init(mytable) >>> density.init(mytable) >>> # Reset mass to H=1 rather than C=12 >>> scale = elements.H[1].mass >>> for el in mytable: ... el._mass /= scale ... if hasattr(el,'_density') and el._density != None: ... el._density /= scale ... for iso in el: ... iso._mass /= scale >>> print("%.10f %.10f"%(mytable.H[1].mass, mytable.C[12].mass)) 1.0000000000 11.9068286833 >>> print("%.10f %.10f"%(periodictable.H[1].mass, periodictable.C[12].mass)) 1.0078250321 12.0000000000 >>> print("%.10f"%formula('2H[1]', table=mytable).mass) 2.0000000000 You will need to add individual properties by hand for all additional desired properties using ``module.init(elements)``. The table name (*H=1* above) must be unique within the session. If you are pickling elements from a custom table, you must create a custom table of the same name before attempting to restore them. The default table is just a custom table with the name *public*. .. Note: If you are using chemical formulas, you will need to define your own parser using:: from periodictable.formulas import formula_grammar parser = formula_grammar(table=elements) Support for custom tables could be made much smoother by delegating all properties not defined in the custom table back to the base table, much like is currently done for :class:`Isotopes ` and :class:`Ions `. That way you only need to replace the properties of interest rather than defining all new properties. The alternative to using custom tables is to replace a dataset in the base table using e.g., ``custom_mass.init(elements, reload = True)``, where custom_mass is your own version of the periodic table values. Be aware, however, that this will have a global effect, changing the mass used by all packages, so you are strongly discouraged from doing so. periodictable-1.5.0/doc/sphinx/guide/data_sources.rst000066400000000000000000000023121310514471200227000ustar00rootroot00000000000000.. _data-sources: ************ Data Sources ************ Physical constants `NIST Physics Laboratory - Constants, units and uncertainty `_ Atomic and isotope mass `NIST Physics Laboratory - Atomic weights and isotope composition `_ Atomic density ILL Neutron Data Booklet Covalent Radii Cordero, et al., Dalton Trans., 2008, 2832-2838, `doi:10.1039/801115j `_ Magnetic form factors Brown. P. J., In International Tables for Crystallography, Volume C, Wilson. A. J. C (ed), section 4.4.5 Neutron scattering factors `Atomic Institute for Austrian Universities `_ X-ray scattering factors `Center for X-Ray Optics `_ Crystal structure Ashcroft and Mermin Oxidation states wikipedia: List of oxidation states of the elements Greenwood, Norman N.; Earnshaw, Alan (1997). Chemistry of the Elements (2nd ed.). Butterworth-Heinemann. pp. 27–28. ISBN 0-08-037941-9. FASTA and biomolecule formulas Perkins, Modern Physical Methods in Biochemistry Part B, 143-265 (1988)periodictable-1.5.0/doc/sphinx/guide/extending.rst000066400000000000000000000100341310514471200222110ustar00rootroot00000000000000.. _extending: ***************** Adding properties ***************** The periodic table is extensible. Third party packages can add attributes to the table, and they will appear in all of the elements. In order to add a new property to the table, you need to define a python package which contains the required information, and can attach the information to the periodic table so that it is available on demand. This is done with the function ``init(table)`` in your table extension. This example adds the attribute ``discoverer`` to each element. First create the file ``discoverer/core.py``: .. literalinclude:: /discoverer/core.py :language: python Now that we have defined the ``init(table)`` function, we need a way to call it. The simplest solution is to load it directly when your package is imported. In the current example, this could be done by adding the following line to the end of the file:: init(periodictable.core.elements) This would be fine for the current example because the table size is small and load time is fast. For large tables, you may wish to delay loading the table data until it is needed. To do this, we use the :func:`delayed_load ` function in our package init file ``discoverer/__init__.py``: .. literalinclude:: /discoverer/__init__.py :language: python The first argument to delayed_load is the list of all attributes that will be defined when the module is loaded. The second argument is the loading function, whose docstring will appear as the attribute description for each attribute in the first list. Check that it works: .. doctest:: >>> import discoverer >>> import periodictable >>> print(periodictable.magnesium.discoverer) J. Black Isotope and ion specific data is also supported. In this case we need a data table that contains information for each isotope of each element. The following example uses a dictionary of elements, with a dictionary of isotopes for each. It adds the ``shells`` attribute to Fe[56] and Fe[58]. Define ``shelltable/core.py``: .. literalinclude:: /shelltable/core.py :language: python Again, we are going to initialize the table with delayed loading. In this case it is very important that we set the ``isotope=True`` keyword in the ``delayed_load`` call. If we don't, then the magic we use to return the correct value after loading the new table information fails. Since unknown attributes are delegated to the underlying element, the value for the natural abundance will be returned instead. On subsequent calls the isotope specific value will be returned. This is demonstrated in ``shelltable/__init__.py``: .. literalinclude:: /shelltable/__init__.py :language: python Check that it works: .. doctest:: >>> import shelltable >>> import periodictable >>> print(periodictable.Fe[56].shells) 56-Fe shell info >>> print(periodictable.Ni[58].shells) None Ion specific data is more complicated, particularly because of the interaction with isotopes. For example, ``Ni[58].ion[3]`` should have the same neutron scattering factors as ``Ni[58]`` (the neutron is only sensitive to the nucleus), but different scattering factors from ``Ni.ion[3]``. X-rays are sensitive to the electronic structure of the atom and not the nucleus, so ``Ni[58].ion[3].xray.f0(Q)`` and ``Ni.ion[3].xray.f0(Q)`` are the same but different from ``Ni.xray.f0(Q)``. Current support for ion dependent properties is awkward. The X-ray table :mod:`periodictable.xsf` creates a specialized structure for each ion as it is requested. The magnetic form factor table :mod:`periodictable.magnetic_ff` does not try to support ``ion.magnetic_ff`` directly, but instead the user must request ``ion.magnetic_ff[ion.charge]``. Support for ion mass, which is isotope mass adjusted for the number of electrons is built into the Ion class. There are not yet any examples of extension tables that depend on both isotope and ion. Be sure to use the ``ion=True`` keyword for ``delayed_load`` when the table extension contains ion specific information. periodictable-1.5.0/doc/sphinx/guide/formula_grammar.rst000066400000000000000000000231531310514471200234050ustar00rootroot00000000000000.. _formula: ******************** Chemical Composition ******************** Some properties are available for groups of elements. Groups are specified as a chemical formula string and either density or cell volume for the crystal structure. While it does not provide any information about molecular structure, a formula does provide complete control over chemical composition. A formula string is translated into a formula using :func:`periodictable.formulas.formula`: * Formula strings consist of counts and atoms, where individual atoms are represented by periodic table symbol. The atoms are case sensitive, so "CO" is different from "Co". Here is an example of calcium carbonate: >>> from periodictable import formula >>> print(formula("CaCO3")) CaCO3 * Formulas can contain multiple groups separated by space or plus or by using parentheses. Whole groups can have a repeat count. The following are equivalent definitions of hydrated calcium carbonate: >>> print(formula("CaCO3+6H2O")) CaCO3(H2O)6 >>> print(formula("CaCO3 6H2O")) CaCO3(H2O)6 >>> print(formula("CaCO3(H2O)6")) CaCO3(H2O)6 * Parentheses can nest, e.g., in polyethylene glycol: >>> print(formula("HO ((CH2)2O)6 H")) HO((CH2)2O)6H * Isotopes are represented by index, such as O[18] = :sup:`18`\ O: >>> print(formula("CaCO[18]3+6H2O")) CaCO[18]3(H2O)6 * Ions are represented by charge, such as O{2-} = O\ :sup:`2-`: >>> print(formula("P{5+}O{2-}4")) P{5+}O{2-}4 If charge is +/- 1 then the number is optional: >>> print(formula("Na{+}Cl{1-}")) Na{+}Cl{-} When specifying both charge and isotope, isotope comes first: >>> print(formula("Fe[56]{2+}")) Fe[56]{2+} Even though the charge is on the individual atoms, the entire formula has a charge: >>> print(formula("P{5+}O{2-}4").charge) -3 * Counts can be integer or decimal: >>> print(formula("CaCO3+(3HO1.5)2")) CaCO3((HO1.5)3)2 * Formula density can be specified using the special '@' tag: >>> print(formula("NaCl@2.16").density) 2.16 Density gives the isotopic density of the compound, so for example, D2O could be specified using: >>> print("%.3f"%formula("D2O@1.112").density) 1.112 It can also be specified using the natural density of the compound, assuming the isotopes substitution does not change the unit cell volume: >>> print("%.3f"%formula("D2O@1n").density) 1.112 Density applies to the entire formula, so for example a D2O-H2O 2:1 mixture (not by mass or by volume) would be: >>> print("%.3f"%formula("2D2O + H2O@1n").density) 1.074 * Mass fractions use %wt, with the final portion adding to 100%: >>> print(formula("10%wt Fe // 15% Co // Ni")) FeCo1.4214Ni7.13602 Only the first item needs to specify that it is a mass fraction, and the remainder can use a bare %. * Volume fractions use %vol, with the final portion adding to 100%: >>> print(formula("10%vol Fe // Ni")) FeNi9.68121 Only the first item needs to specify that it is a volume fraction, and the remainder can use a bare %. Volume fraction mixing is only possible if the densities are known for the individual components, which will require the formula density tag if the component is not an element. A density estimate is given for the mixture but in general it will not be correct, and should be set explicitly for the resulting compound. * Specific mass can be giving with count follwed by mass units: >>> print(formula("5g NaCl // 50mL H2O@1")) NaCl(H2O)32.4407 Density will be required for materials given by volume. Mass will be stored in the *total_mass* attribute of the resulting formula. * Multilayers can be specified by thickness: >>> print(formula("1 um Si // 5 nm Cr // 10 nm Au")) Si119.99CrAu1.41722 Density will be required for each layer. Thickness will be stored in the *total_thickness* attribute of the resulting formula. Thickness can be converted to *total_volume* by multiplying by cross section, and to *total_mass* by multiplying that by *density*. * Mixtures can nest. The following is a 10% salt solution by weight mixed 20:80 by volume with D2O: >>> print(formula("20%vol (10%wt NaCl@2.16 // H2O@1) // D2O@1n")) NaCl(H2O)29.1966(D2O)122.794 * Empty formulas are supported, e.g., for air or vacuum: >>> print(formula()) >>> formula() formula('') The grammar used for parsing formula strings is the following: :: formula :: compound | mixture | nothing mixture :: quantity | percentage quantity :: count unit part ('//' count unit part)* percentage :: count '%wt|%vol' part ('//' count '%' part)* '//' part part :: compound | '(' mixture ')' compound :: group (separator group)* density? group :: count element+ | '(' formula ')' count element :: symbol isotope? ion? count? symbol :: [A-Z][a-z]* isotope :: '[' number ']' ion :: '{' number? [+-] '}' density :: '@' count count :: number | fraction number :: [1-9][0-9]* fraction :: ([1-9][0-9]* | 0)? '.' [0-9]* separator :: space? '+'? space? unit :: mass | volume | length mass :: 'kg' | 'g' | 'mg' | 'ug' | 'ng' volume :: 'L' | 'mL' | 'uL' | 'nL' length :: 'cm' | 'mm' | 'um' | 'nm' Formulas can also be constructed from atoms or other formulas: * A simple formula can be created from a bare atom: >>> from periodictable import Ca, C, O, H >>> print(formula(Ca)) Ca * More complex structures will require a sequences of counts and fragments. The fragment itself can be a structure: >>> print(formula( [ (1,Ca), (1,C), (3,O), (6,[(2,H),(1,O)]) ] )) CaCO3(H2O)6 * Structures can also be built with simple formula math: >>> print(formula("CaCO3") + 6*formula("H2O")) CaCO3(H2O)6 * Formulas can be easily cloned: >>> print(formula( formula("CaCO3+6H2O"))) CaCO3(H2O)6 Density ------- Density can be specified directly when the formula is created, or updated within a formula. For isotope specific formulas, the density can be given either as the density of the formula using naturally occurring abundance if the unit cell is approximately the same, or using the density specific to those isotopes used. This makes heavy water density easily specified as: >>> D2O = formula('D2O',natural_density=1) >>> print("%s %.4g"%(D2O,D2O.density)) D2O 1.112 Density can also be estimated from the volume of the unit cell, either by using the covalent radii of the constituent atoms and assuming some packing factor, or by knowing the lattice parameters of the crystal which makes up the material. Standard packing factors for hcp, fcc, bcc, cubic and diamond on uniform spheres can be used if the components are of about the same size. The formula should specify the number of atoms in the unit cell, which is 1 for cubic, 2 for bcc and 4 for fcc. Be sure to use the molecular mass (M.molecular_mass in g) rather than the molar mass (M.mass in u = g/mol) in your calculations. Because the packing fraction method relies on the covalent radius estimate it is not very accurate: >>> from periodictable import elements, formula >>> Fe = formula("2Fe") # bcc lattice has 2 atoms per unit cell >>> Fe.density = Fe.molecular_mass/Fe.volume('bcc') >>> print("%.3g"%Fe.density) 6.55 >>> print("%.3g"%elements.Fe.density) 7.87 Using lattice parameters the results are much better: >>> Fe.density = Fe.molecular_mass/Fe.volume(a=2.8664) >>> print("%.3g"%Fe.density) 7.88 >>> print("%.3g"%elements.Fe.density) 7.87 Mixtures -------- Mixtures can be created by weight or volume ratios, with the density of the result computed from the density of the materials. For example, the following is a 2:1 mixture of water and heavy water: >>> from periodictable import formula, mix_by_volume, mix_by_weight >>> H2O = formula('H2O',natural_density=1) >>> D2O = formula('D2O',natural_density=1) >>> mix = mix_by_volume(H2O,2,D2O,1) >>> print("%s %.4g"%(mix,mix.density)) (H2O)2D2O 1.037 Note that this is different from a 2:1 mixture by weight: >>> mix = mix_by_weight(H2O,2,D2O,1) >>> print("%s %.4g"%(mix,mix.density)) (H2O)2.2234D2O 1.035 Except in the simplest of cases, the density of the mixture cannot be computed from the densities of the components, and the resulting density should be set explicitly. Derived values -------------- Once a formula has been created, it can be used for summary calculations. The following is an example of hydrated quartz, which shows how to compute molar mass and neutron/xray scattering length density: >>> import periodictable >>> SiO2 = periodictable.formula('SiO2') >>> hydrated = SiO2 + periodictable.formula('3H2O') >>> print('%s mass %s'%(hydrated,hydrated.mass)) SiO2(H2O)3 mass 114.13014 >>> rho,mu,inc = periodictable.neutron_sld('SiO2+3H2O',density=1.5,wavelength=4.75) >>> print('%s neutron sld %.3g'%(hydrated,rho)) SiO2(H2O)3 neutron sld 0.849 >>> rho,mu = periodictable.xray_sld(hydrated,density=1.5, ... wavelength=periodictable.Cu.K_alpha) >>> print('%s X-ray sld %.3g'%(hydrated,rho)) SiO2(H2O)3 X-ray sld 13.5 Biomolecules ------------ The :mod:`periodictable.fasta` module can be used to load and manage bio molecules. These can be used to compute molecular weights, approximate volumes and scattering for various lipids and proteins. In addition it supports labile hydrogen calculations, allowing you to compute the neutron scattering length density of the molecule in the presence of D2O as a solvent, assuming all labile hydrogens are substituted. periodictable-1.5.0/doc/sphinx/guide/index.rst000066400000000000000000000011011310514471200213260ustar00rootroot00000000000000.. _users-guide-index: ############ User's Guide ############ This section gives an overview and introduction to Periodic Table. Read this to have an idea about what Periodic Table can do for you (and how) and if you want to know in detail about Periodic Table, refer to the :ref:`Periodic Table Modules Reference `. .. htmlonly: :Release: |version| :Date: |today| .. toctree:: :maxdepth: 2 intro.rst using.rst formula_grammar.rst bundle.rst extending.rst customizing.rst data_sources.rst contributing.rst license.rst periodictable-1.5.0/doc/sphinx/guide/intro.rst000066400000000000000000000035511310514471200213650ustar00rootroot00000000000000.. _introduction: ########################## Periodic Table of Elements ########################## The periodictable package provides an extensible periodic table with various properties of the elements like name, symbol, mass, desnity etc and also provides data important to neutron and X-ray scattering experiments. With the elements package you can compute the scattering potential of a compound at a given wavelength. There is a wealth of possible information that could be stored in such a table, and collecting it all is far beyond the scope of this project. Instead, we provide an extensible table in which third party packages can provide properties in addition to the base properties we define here. .. plot:: plots/sld_plot.py Neutron SLD as a function of element. ******** Features ******** Standard properties Name, symbol, :mod:`mass ` and :mod:`density ` of elements are built in. :class:`Chemical Formula ` Parses chemical formula and computes properties such as molar mass. :class:`Isotopes ` Mass and relative abundance of isotopes are included for known isotopes. Formulas can include isotope composition. :class:`Ions ` Magnetic form factors and ionic radii for various ions. :mod:`Neutron ` and :mod:`X-ray Scattering Factors ` Provides neutron and wavelength dependent X-ray scattering factors for elements, isotopes, and formulas. :ref:`Extensible ` New properties can be added to the :class:`Periodic Table ` from outside the package. Specialized tables can be created with alternatives to the standard values. :ref:`Data Sources ` References are available for all information in the table. periodictable-1.5.0/doc/sphinx/guide/license.rst000066400000000000000000000024751310514471200216600ustar00rootroot00000000000000.. _license: ******* License ******* This package is in the public domain. Individual files may hold separate copyright and licensing terms. See the file header for details. ********** Disclaimer ********** This data has been compiled from a variety of sources for the user's convenience and does not represent a critical evaluation by the authors. While we have made efforts to verify that the values we use match published values, the values themselves are based on measurements whose conditions may differ from those of your experiment. ******* Credits ******* Periodictable was written by Paul Kienzle with contributions from the `DANSE `_ project. The DANSE/Reflectometry team is supported by the University of Maryland Department of Materials Science and Engineering, the NIST Center for Neutron Research and the US National Science Foundation grant DMR-0520547. Any opinions, findings and recommendations expressed in this material are those of the author(s) and do not necessarily reflect the view of the supporting institutions. We are grateful for the existence of many fine open source packages such as `Pyparsing `_, `NumPy `_ and `Python `_ without which this package would be much more difficult to write. periodictable-1.5.0/doc/sphinx/guide/using.rst000066400000000000000000000102301310514471200213470ustar00rootroot00000000000000.. _using: *********** Basic usage *********** The periodic table is available on `PyPI `_, and can be obtained simply with:: easy_install periodictable This will install pyparsing if it is not already available. The numpy package must already be installed. Access particular elements by name: .. doctest:: >>> from periodictable import hydrogen >>> print("H mass %s %s"%(hydrogen.mass, hydrogen.mass_units)) H mass 1.00794 u Access particular elements as symbols: .. doctest:: >>> from periodictable import H,B,Cu,Ni >>> print("B absorption %s"%B.neutron.absorption) B absorption 767.0 >>> print("Ni f1/f2 for Cu K-alpha X-rays %s"%str(Ni.xray.scattering_factors(wavelength=Cu.K_alpha))) Ni f1/f2 for Cu K-alpha X-rays (25.022929905648375, 0.52493074546535157) Access isotopes using mass number subscripts: .. doctest:: >>> print("58-Ni vs 62-Ni scattering %s:%s"%(Ni[58].neutron.coherent, Ni[62].neutron.coherent)) 58-Ni vs 62-Ni scattering 26.1:9.5 Access elements indirectly: .. doctest:: >>> import periodictable >>> print("Cd density %.2f %s"%(periodictable.Cd.density, periodictable.Cd.density_units)) Cd density 8.65 g/cm^3 Import all elements: .. doctest:: >>> from periodictable import * >>> print(periodictable.H) H >>> print(periodictable.H.mass) 1.00794 Deuterium and tritium are special isotopes named D and T some neutron information is available as 'n': .. doctest:: >>> print("D mass %s"%D.mass) D mass 2.014101778 >>> print("neutron mass %s"%n.mass) neutron mass 1.00866491597 Process all the elements: .. doctest:: >>> import periodictable >>> for el in periodictable.elements: # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE ... print("%s %s"%(el.symbol,el.name)) n neutron H hydrogen He helium ... Og oganesson Another example for processing all elements: .. doctest:: >>> from periodictable import elements >>> for el in elements: # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE ... print("%s %s"%(el.symbol,el.number)) n 0 H 1 He 2 ... Process all the :class:`isotopes ` for an element: .. doctest:: >>> for iso in periodictable.H: ... print("%s %s"%(iso,iso.mass)) 1-H 1.0078250321 D 2.014101778 T 3.0160492675 4-H 4.02783 5-H 5.03954 6-H 6.04494 You can create a unique handle to an individual ion. In addition to storing the ion charge, this can be used to reference the underlying properties of the element or isotope: .. doctest:: >>> Ni58_2 = periodictable.Ni[58].ion[2] >>> Ni_2 = periodictable.Ni.ion[2] >>> print("charge for Ni2+ is %d"%Ni_2.charge) charge for Ni2+ is 2 >>> print("mass for Ni[58] and for natural abundance: %.4f %.4f"%(Ni58_2.mass, Ni_2.mass)) mass for Ni[58] and for natural abundance: 57.9343 58.6923 The ion specific properties can be accessed from the ion using ion.charge for the ion index: .. doctest:: >>> import pylab >>> import periodictable >>> Fe_2 = periodictable.Fe.ion[2] >>> print(Fe_2.magnetic_ff[Fe_2.charge].M_Q([0,0.1,0.2])) [ 1. 0.99935255 0.99741366] The following is a plot of the magnetic form factor vs. Q: >>> Q = pylab.linspace(0,16,200) >>> M = Fe_2.magnetic_ff[Fe_2.charge].j0_Q(Q) >>> pylab.xlabel(r'Magnetic Form Factor for Fe') # doctest: +SKIP >>> pylab.ylabel(r'$\AA^{-1}$') # doctest: +SKIP >>> pylab.title('Ion specific property for Fe') # doctest: +SKIP >>> pylab.plot(Q,M) # doctest: +SKIP .. plot:: plots/magnetic_ff.py Missing properties generally evaluate to *None*: .. doctest:: >>> print("Radon density %s"%periodictable.Rn.density) Radon density None Specific defined properties related to elements can be accessed in a table format as shown in following example : .. doctest:: >>> elements.list('symbol','K_alpha',format="%s K-alpha = %s") # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE Ne K-alpha = 14.6102 Na K-alpha = 11.9103 Mg K-alpha = 9.8902 Al K-alpha = 8.3402 ... Cf K-alpha = 0.1094 Es K-alpha = 0.1067 Fm K-alpha = 0.104 periodictable-1.5.0/doc/sphinx/index.rst000066400000000000000000000013501310514471200202370ustar00rootroot00000000000000.. Periodic Table documentation master file, created by sphinx-quickstart on Tue Jun 2 11:16:08 2009. You can adapt this file completely to your liking, but it should at least contain the root `toctree` directive. Introduction ============ The periodictable package provides an extensible periodic table of the elements pre-populated with data important to neutron and X-ray scattering experiments. Periodic table is written entirely in Python and does not require any external libraries. .. htmlonly:: :Release: |version| :Date: |today| .. toctree:: :maxdepth: 2 guide/index.rst api/index.rst Indices and Tables ================== * :ref:`genindex` * :ref:`modindex` .. htmlonly:: * :ref:`search` periodictable-1.5.0/doc/sphinx/make.bat000066400000000000000000000056371310514471200200170ustar00rootroot00000000000000@ECHO OFF REM Command file for Sphinx documentation set SPHINXBUILD=sphinx-build set ALLSPHINXOPTS=-d _build/doctrees %SPHINXOPTS% . if NOT "%PAPER%" == "" ( set ALLSPHINXOPTS=-D latex_paper_size=%PAPER% %ALLSPHINXOPTS% ) if "%1" == "" goto help if "%1" == "help" ( :help echo.Please use `make ^` where ^ is one of echo. html to make standalone HTML files echo. dirhtml to make HTML files named index.html in directories echo. pickle to make pickle files echo. json to make JSON files echo. htmlhelp to make HTML files and a HTML help project echo. qthelp to make HTML files and a qthelp project echo. latex to make LaTeX files, you can set PAPER=a4 or PAPER=letter echo. changes to make an overview over all changed/added/deprecated items echo. linkcheck to check all external links for integrity echo. doctest to run all doctests embedded in the documentation if enabled goto end ) if "%1" == "clean" ( for /d %%i in (_build\*) do rmdir /q /s %%i del /q /s _build\* goto end ) if "%1" == "html" ( %SPHINXBUILD% -b html %ALLSPHINXOPTS% _build/html echo. echo.Build finished. The HTML pages are in _build/html. goto end ) if "%1" == "dirhtml" ( %SPHINXBUILD% -b dirhtml %ALLSPHINXOPTS% _build/dirhtml echo. echo.Build finished. The HTML pages are in _build/dirhtml. goto end ) if "%1" == "pickle" ( %SPHINXBUILD% -b pickle %ALLSPHINXOPTS% _build/pickle echo. echo.Build finished; now you can process the pickle files. goto end ) if "%1" == "json" ( %SPHINXBUILD% -b json %ALLSPHINXOPTS% _build/json echo. echo.Build finished; now you can process the JSON files. goto end ) if "%1" == "htmlhelp" ( %SPHINXBUILD% -b htmlhelp %ALLSPHINXOPTS% _build/htmlhelp echo. echo.Build finished; now you can run HTML Help Workshop with the ^ .hhp project file in _build/htmlhelp. goto end ) if "%1" == "qthelp" ( %SPHINXBUILD% -b qthelp %ALLSPHINXOPTS% _build/qthelp echo. echo.Build finished; now you can run "qcollectiongenerator" with the ^ .qhcp project file in _build/qthelp, like this: echo.^> qcollectiongenerator _build\qthelp\Periodic Table.qhcp echo.To view the help file: echo.^> assistant -collectionFile _build\qthelp\Periodic Table.ghc goto end ) if "%1" == "latex" ( %SPHINXBUILD% -b latex %ALLSPHINXOPTS% _build/latex echo. echo.Build finished; the LaTeX files are in _build/latex. goto end ) if "%1" == "changes" ( %SPHINXBUILD% -b changes %ALLSPHINXOPTS% _build/changes echo. echo.The overview file is in _build/changes. goto end ) if "%1" == "linkcheck" ( %SPHINXBUILD% -b linkcheck %ALLSPHINXOPTS% _build/linkcheck echo. echo.Link check complete; look for any errors in the above output ^ or in _build/linkcheck/output.txt. goto end ) if "%1" == "doctest" ( %SPHINXBUILD% -b doctest %ALLSPHINXOPTS% _build/doctest echo. echo.Testing of doctests in the sources finished, look at the ^ results in _build/doctest/output.txt. goto end ) :end periodictable-1.5.0/doc/sphinx/plots/000077500000000000000000000000001310514471200175405ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/plots/density_plot.py000066400000000000000000000007221310514471200226300ustar00rootroot00000000000000import periodictable import pylab params = {'figure.figsize': (10,8)} pylab.rcParams.update(params) D = [(el.number,el.density,el.symbol) for el in periodictable.elements] bbox = dict(boxstyle="round",lw=1,ec=(0,0,0),fc=(0.85,0.8,0.8)) for Z,density,sym in D: if density is not None: pylab.text(Z,density,sym,bbox=bbox) pylab.axis([0,110,0,25]) pylab.xlabel('Element number') pylab.ylabel('Density of element') pylab.title('Density for elements') periodictable-1.5.0/doc/sphinx/plots/magnetic_ff.py000066400000000000000000000006221310514471200223540ustar00rootroot00000000000000import pylab import periodictable fig_width = 10 fig_height = 8 fig_size = [fig_width,fig_height] params = {'figure.figsize': fig_size} pylab.rcParams.update(params) Fe_2 = periodictable.Fe.ion[2] Q = pylab.linspace(0,16,200) M = Fe_2.magnetic_ff[Fe_2.charge].j0_Q(Q) pylab.xlabel(r'Magnetic Form Factor for Fe') pylab.ylabel(r'$\AA^{-1}$') pylab.title('Ion specific property for Fe') pylab.plot(Q,M) periodictable-1.5.0/doc/sphinx/plots/sld_plot.py000066400000000000000000000002071310514471200217310ustar00rootroot00000000000000import pylab import periodictable.nsf params = {'figure.figsize': (10,8)} pylab.rcParams.update(params) periodictable.nsf.sld_plot() periodictable-1.5.0/doc/sphinx/rst_prolog000066400000000000000000000010301310514471200205060ustar00rootroot00000000000000.. |Ang| unicode:: U+212B .. |cdot| unicode:: U+00B7 .. |deg| unicode:: U+00B0 .. |cm^2| replace:: cm\ :sup:`2` .. |cm^3| replace:: cm\ :sup:`3` .. |1/cm| replace:: cm\ :sup:`-1` .. |1/cm^3| replace:: cm\ :sup:`-3` .. |Ang^2| replace:: |Ang|\ :sup:`2` .. |Ang^3| replace:: |Ang|\ :sup:`3` .. |1/Ang| replace:: |Ang|\ :sup:`-1` .. |1/Ang^2| replace:: |Ang|\ :sup:`-2` .. |1e-6/Ang^2| replace:: 10\ :sup:`-6`\ |Ang|\ :sup:`-2` .. |g/cm^3| replace:: g\ |cdot|\ cm\ :sup:`-3` .. |fm^2| replace:: fm\ :sup:`2` .. |Js| replace:: J\ |cdot|\ s periodictable-1.5.0/doc/sphinx/shelltable/000077500000000000000000000000001310514471200205165ustar00rootroot00000000000000periodictable-1.5.0/doc/sphinx/shelltable/__init__.py000066400000000000000000000005471310514471200226350ustar00rootroot00000000000000import periodictable.core # Delayed loading of the element discoverer information def _load(): """ The name of the person or group who discovered the element. """ from . import core core.init(periodictable.core.default_table()) periodictable.core.delayed_load(['shells'], _load, isotope=True, element=False) periodictable-1.5.0/doc/sphinx/shelltable/core.py000066400000000000000000000014341310514471200220220ustar00rootroot00000000000000""" Example of isotope specific extensions to the periodic table. """ from periodictable.core import Isotope def init(table, reload=False): if 'shells' in table.properties and not reload: return table.properties.append('shells') # Set the default. This is required, even if it is only # setting it to None. If the attribute is missing then # the isotope data reverts to the element to supply the # value, which is almost certainly not what you want. Isotope.shells = None # Load the data for symbol,eldata in data.items(): el = table.symbol(symbol) for iso,isodata in eldata.items(): el[iso].shells = isodata # Define the data data = dict( Fe = {56: "56-Fe shell info", 58: "58-Fe shell info", }, ) periodictable-1.5.0/fix_setuptools_chmod.py000066400000000000000000000032341310514471200211360ustar00rootroot00000000000000# Quick and dirty trick to fix executable permissions spuriously # set by the setuptools. __all__ = [] # version __id__ = "$Id$" import os import stat import setuptools from pkg_resources import parse_version # adjusted from setuptools-0.6c8 try: from os import chmod as _chmod except ImportError: # Jython compatibility def _chmod(*args): pass def chmod(path, mode): from distutils import log log.debug("changing mode of %s to %o", path, mode) try: _chmod(path, mode) except os.error as e: log.debug("chmod failed: %s", e) def fixed_unpack_and_compile(self, egg_path, destination): from setuptools.archive_util import unpack_archive to_compile = []; to_chmod = [] def pf(src,dst): if dst.endswith('.py') and not src.startswith('EGG-INFO/'): to_compile.append(dst) to_chmod.append(dst) elif dst.endswith('.dll') or dst.endswith('.so'): to_chmod.append(dst) self.unpack_progress(src,dst) return not self.dry_run and dst or None unpack_archive(egg_path, destination, pf) self.byte_compile(to_compile) if not self.dry_run: for f in to_chmod: # mode = ((os.stat(f)[stat.ST_MODE]) | 0555) & 07755 mode = ((os.stat(f)[stat.ST_MODE]) | 0o444) & 0o7755 chmod(f, mode) to_compile = []; to_chmod = [] return # Hack the easy_install class for versions compatible with # fixed_unpack_and_compile if parse_version(setuptools.__version__) <= parse_version('0.6c9'): from setuptools.command.easy_install import easy_install easy_install.unpack_and_compile = fixed_unpack_and_compile # End of file periodictable-1.5.0/periodictable/000077500000000000000000000000001310514471200171275ustar00rootroot00000000000000periodictable-1.5.0/periodictable/__init__.py000066400000000000000000000216661310514471200212530ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ Extensible periodic table of elements The periodictable package contains mass for the isotopes and density for the elements. It calculates xray and neutron scattering information for isotopes and elements. Composite values can be calculated from chemical formula and density. The table is extensible. See the user manual for details. ---- Disclaimer: This data has been compiled from a variety of sources for the user's convenience and does not represent a critical evaluation by the authors. While we have made efforts to verify that the values we use match published values, the values themselves are based on measurements whose conditions may differ from those of your experiment. ---- """ __docformat__ = 'restructuredtext en' __all__ = ['elements', 'neutron_sld', 'xray_sld', 'formula', 'mix_by_weight', 'mix_by_volume'] # and all elements __version__ = "1.5.0" from . import core from . import mass from . import density # Always make mass and density available elements = core.PUBLIC_TABLE mass.init(elements) density.init(elements) # Data needed for setup.py when bundling the package into an exe def data_files(): """ Return the data files associated with all periodic table attributes. The format is a list of (directory, [files...]) pairs which can be used directly in setup(..., data_files=...) for setup.py. """ import os import glob def _finddata(ext, patterns): files = [] path = core.get_data_path(ext) for p in patterns: files += glob.glob(os.path.join(path, p)) return files data_files = [('periodictable-data/xsf', _finddata('xsf', ['*.nff', 'read.me', 'f0_WaasKirf.dat'])), ('periodictable-data', _finddata('.', ['activation.dat']))] return data_files # Export variables for each element name and symbol. __all__ += core.define_elements(elements, globals()) def _load_covalent_radius(): """ covalent radius: average atomic radius when bonded to C, N or O. """ from . import covalent_radius covalent_radius.init(elements) core.delayed_load(['covalent_radius', 'covalent_radius_units', 'covalent_radius_uncertainty'], _load_covalent_radius) def _load_crystal_structure(): """ Add crystal_structure property to the elements. Reference: *Ashcroft and Mermin.* """ from . import crystal_structure crystal_structure.init(elements) core.delayed_load(['crystal_structure'], _load_crystal_structure) def _load_neutron(): """ Neutron scattering factors, *nuclear_spin* and *abundance* properties for elements and isotopes. Reference: *Rauch. H. and Waschkowski. W., ILL Nuetron Data Booklet.* """ from . import nsf nsf.init(elements) core.delayed_load(['neutron'], _load_neutron, isotope=True) def _load_neutron_activation(): """ Neutron activation calculations for isotopes and formulas. Reference: *IAEA 273: Handbook on Nuclear Activation Data.* *NBSIR 85-3151: Compendium of Benchmark Neutron Field.* """ from . import activation activation.init(elements) core.delayed_load(['neutron_activation'], _load_neutron_activation, element=False, isotope=True) def _load_xray(): """ X-ray scattering properties for the elements. Reference: *Center for X-Ray optics. Henke. L., Gullikson. E. M., and Davis. J. C.* """ from . import xsf xsf.init(elements) core.delayed_load(['xray'], _load_xray, ion=True) def _load_emission_lines(): """ X-ray emission lines for various elements, including Ag, Pd, Rh, Mo, Zn, Cu, Ni, Co, Fe, Mn, Cr and Ti. *K_alpha* is the average of K_alpha1 and K_alpha2 lines. """ from . import xsf xsf.init_spectral_lines(elements) core.delayed_load(['K_alpha', 'K_beta1', 'K_alpha_units', 'K_beta1_units'], _load_emission_lines) def _load_magnetic_ff(): """ Magnetic Form Fators. These values are directly from CrysFML. Reference: *Brown. P. J.(Section 4.4.5) International Tables for Crystallography Volume C, Wilson. A.J.C.(ed).* """ from . import magnetic_ff magnetic_ff.init(elements) core.delayed_load(['magnetic_ff'], _load_magnetic_ff) # Constructors and functions def formula(*args, **kw): """ Chemical formula representation. Example initializers: string: m = formula( "CaCO3+6H2O" ) sequence of fragments: m = formula( [(1, Ca), (2, C), (3, O), (6, [(2, H), (1, O)]] ) molecular math: m = formula( "CaCO3" ) + 6*formula( "H2O" ) another formula (makes a copy): m = formula( formula("CaCO3+6H2O") ) an atom: m = formula( Ca ) nothing: m = formula() Additional information can be provided: density (|g/cm^3|) material density natural_density (|g/cm^3|) material density with natural abundance name (string) common name for the molecule table (PeriodicTable) periodic table with customized data Operations: m.atoms returns a dictionary of isotope: count for the entire molecule Formula strings consist of counts and atoms such as "CaCO3+6H2O". Groups can be separated by '+' or space, so "CaCO3 6H2O" works as well. Groups and be defined using parentheses, such as "CaCO3(H2O)6". Parentheses can nest: "(CaCO3(H2O)6)1" Isotopes are represented by index, e.g., "CaCO[18]3+6H2O". Counts can be integer or decimal, e.g. "CaCO3+(3HO0.5)2". For full details see help(periodictable.formulas.formula_grammar) The chemical formula is designed for simple calculations such as molar mass, not for representing bonds or atom positions. However, we preserve the structure of the formula so that it can be used as a basis for a rich text representation such as matplotlib TeX markup. """ from . import formulas return formulas.formula(*args, **kw) def mix_by_weight(*args, **kw): """ Generate a mixture which apportions each formula by weight. :Parameters: *formula1* : Formula OR string Material *quantity1* : float Relative quantity of that material *formula2* : Formula OR string Material *quantity2* : float Relative quantity of that material ... *density* : float Density of the mixture, if known *natural_density* : float Density of the mixture with natural abundances, if known. *name* : string Name of the mixture :Returns: *formula* : Formula If density is not given, then it will be computed from the density of the components, assuming equal volume. """ from . import formulas return formulas.mix_by_weight(*args, **kw) def mix_by_volume(*args, **kw): """ Generate a mixture which apportions each formula by volume. :Parameters: *formula1* : Formula OR string Material *quantity1* : float Relative quantity of that material *formula2* : Formula OR string Material *quantity2* : float Relative quantity of that material ... *density* : float Density of the mixture, if known *natural_density* : float Density of the mixture with natural abundances, if known. *name* : string Name of the mixture :Returns: *formula* : Formula Densities are required for each of the components. If the density of the result is not given, it will be computed from the components assuming the components take up no more nor less space because they are in the mixture. """ from . import formulas return formulas.mix_by_volume(*args, **kw) def neutron_sld(*args, **kw): """ Compute neutron scattering length densities for molecules. Returns scattering length density (real, imaginary and incoherent). See :class:`periodictable.nsf.neutron_sld` for details. """ from . import nsf return nsf.neutron_sld(*args, **kw) def neutron_scattering(*args, **kw): """ Compute neutron scattering cross sections for molecules. Returns scattering length density (real, imaginary and incoherent), cross sections (coherent, absorption, incoherent) and penetration depth. See :func:`periodictable.nsf.neutron_scattering` for details. """ from . import nsf return nsf.neutron_scattering(*args, **kw) def xray_sld(*args, **kw): """ Compute neutron scattering length densities for molecules. Either supply the wavelength (A) or the energy (keV) of the X-rays. Returns scattering length density (real, imaginary). See :class:`periodictable.xsf.Xray` for details. """ from . import xsf return xsf.xray_sld(*args, **kw) #del core, mass, density periodictable-1.5.0/periodictable/activation.dat000066400000000000000000001546551310514471200220020ustar00rootroot00000000000000 Computational note: For some numerical combinations with very large half-lives the numerical precision is inadequate and you get negative results. This can be corrected by reformulation or approximations but has not been done. " Remember, the X in EXP(X) is limited to |X|<709" ********************************************************************** WARNING: If you SORT this table take care to include all columns!!! Otherwise all is lost and you have no means to unscramble your action "WARNING: A relative reference is used in the daughter nuclide entry. That is, the parent must be on the line directly above the daughter!" " DO NOT change the order of the parent daughter pairs, upon pain of erroneous results" " This caution applies to both ""b"" and ""2n"" mode production." ********************************************************************** Notes: Simplifications have been made as indicated in the comments column. "Typically, for a decay chain where the daughter is also produced (isomers)" the s of the parent has been added to that of the daughter when the daughter t1/2 is much longer (true for most cases) and the parent " t1/2 is relatively short, e.g. less than 1 day, so that allthe daughter" will be made relatively promptly. In cases where the above condition is not met an * is put next to the nuclide name to warn that the daughter production has not been accounted for. In most cases the daughter is in a simple decay equilibrium. Where the decay product is a new nuclide a line has been added to the database to account for this. This production mode is indicated in the reaction column by 'b'. Where both m and g state contribute to daughter " production it is simplified to a single parent, that with the greater" cross-section or that with the longer half-life together with the sum of the cross-sections. In a few cases where the parent nuclide t1/2 is very short all production " is assigned to the daughter and no entry is made for the parent, as" noted in the comments column. No correction for neutron burn up has been made Most cross-section data is from IAEA 273. "Fast neutron data from NBSIR 85-3151, Compendium of Benchmark Neutron Fields" " is for reaction above the Cd cutooff, .4eV. Noted in comment column" Fast neutron reaction data from IAEA 273 has been weighted by a unit fluence " fast maxwellian spectrum as described in NBSIR 85-3151, but no further" weighting for a 1/v or thermal component has been made. Only selected reactions have been included. fast? : identifies fast neutron reactions so fast fluence reduction factor can be applied. "isomer : identifies isomers, and is used to flag radioactive daughter info" %IT : Info only. Not used in any spreadsheet calculation. Resonance: the cross-section above the nominal Cd cutoff. Basically useful if you already know the answer. Notation on nuclide name "m,m1,m2 indicate metastable states. Decay may be the ground state or another nuclide." + indicates radioactive daughter production already included in daughter listing several parent t1/2's required to acheive calculated daughter activity. All act. assigned at end of irradiation. In most cases the added activity to the daughter is small. "* indicates radioactive daughter production NOT calculated, approx secular equilibrium" s indicates radioactive daughter of this nuclide in secular equilibrium after several daughter t1/2's t indicates transient equil via beta decay. Accumulation of that nuclide during irradiation is separately calculated. Reaction = b indicates production via decay from an activation produced parent |..............| Target Element Isotopic Reaction Cross-section b or 2n mode production Index Symbol % Resulting t1/2 isomer ^ Thermal Resonance t1/2 t1/2 of Cross-section (b) of 2n precursor Z ^ A Abund Nuclide t1/2 unit ^ %IT fast (b) g(T) (b) t1/2 as text parent & burnup X-sect of 2n parent ? in hr thermal resonance Comments H 1 1 H 2 H-2 0.015 H-3 12.346 y act n 0.000519 0.0006298 108150.96 12.346y He 2 2 He 3 He-3 0.00013 H-3 12.346 y "n,p" n 5333 2401 108150.96 12.346y Li 3 3 Li 7 Li-7 92.5 Li-8 0.844 s act n 0.0454 0.01756 0.000234444 0.844 s Li 4 3 Li 6 Li-6 7.5 H-3 12.346 y "n,a" n 940 425.5 108150.96 12.346y Be 5 4 Be 9 Be-9 100 Be-10 1600000 y act n 0.0076 0.004 14016000000 1.6 My Be 6 4 Be 9 Be-9 100 He-6 0.805 s "n,a" y 0.0328 0.000223611 0.805 s IAEA156 B 7 5 B 11 B-11 80 B-12 0.0203 s act n 0.0055 0.0757 5.63889E-06 0.020 s B 8 5 B 11 B-11 80 Li-8 0.844 s "n,a" y 0.00014 0.000234444 0.844 s IAEA156 C 9 6 C 12 C-12 98.9 C-11 20.3 m "n,2n" y 4.2E-10 0.338333333 20.30 m IAEA156 C 10 6 C 13 C-13 1.11 C-14 5736 y act n 0.00137 0.0017 50247360 5736 y N 11 7 N 14 N-14 99.64 C-14 5736 y "n,p" n 0.00183 50247360 5736 y N 12 7 N 15 N-15 0.36 N-16 7.14 s act n 0.000024 0.00011 0.001983333 7.14 s O 13 8 O 16 O-16 99.75 N-16 7.14 s "n,p" y 0.000019 0.001983333 7.14 s IAEA156 O 14 8 O 16 O-16 99.75 O-15 122 s "n,2n" y 5.3E-10 0.033888889 122 s IAEA156 O 15 8 O 17 O-17 0.039 C-14 5736 y "n,a" n 0.235 50247360 5736 y O 16 8 O 17 O-17 0.039 N-17 4.17 s "n,p" y 0.0000086 0.001158333 4.2 s IAEA156 O 17 8 O 18 O-18 0.205 O-19 27.1 s act n 0.00016 0.00087 0.007527778 27.1 s F 18 9 F 19 F-19 100 F-20 11 s act n 0.0096 0.039 0.003055556 11.0 s F 19 9 F 19 F-19 100 O-19 26.9 s "n,p" y 0.00135 0.007472222 26.9 s IAEA156 F 20 9 F 19 F-19 100 N-16 7.14 s "n,a" y 0.00785 0.001983333 7.1 s IAEA156 F 21 9 F 19 F-19 100 F-18 109.8 m "n,2n" y 0.0000073 1.83 110 m Ne 22 10 Ne 22 Ne-22 9.23 Ne-23 38 s act n 0.0455 0.023 0.010555556 38.0 s Na 23 11 Na 23 Na-23 100 Na-24m+ 0.02 s m+ act n 0.4 5.55556E-06 0.020 s Na 24 11 Na 23 Na-23 100 Na-24 15.03 h g act n 0.53 0.32 15.03 15.0 h s for .02s isomer added to ground state Na 25 11 Na 23 Na-23 100 Na-22 2.602 y "n,2n" y 0.0000022 22793.52 2.602 y "IAEA156, fission averaged" Na 26 11 Na 23 Na-23 100 Ne-23 37.2 s "n,p" y 0.0015 0.010333333 37.2 s IAEA156 Na 27 11 Na 23 Na-23 100 F-20 11 s "n,a" y 0.000765 0.003055556 11.0 s IAEA156 Mg 28 12 Mg 25 Mg-25 10 Na-25 59.3 s "n,p" y 0.0032 0.016472222 59.3 s IAEA156 Mg 29 12 Mg 26 Mg-26 11.01 Mg-27 9.46 m act n 0.035 0.027 0.157666667 9.46 m 0.07 Mg 30 12 Mg 26 Mg-26 11.01 Mg-28 21 h 2n n 0.035 0.027 21 21.0 h 0.157666667 0.07 Mg 31 12 Mg 24 Mg-24 78.99 Na-24 15.03 h "n,p" y 0.00153 15.03 15.03 h "IAEA156, fission averaged, an adopted std." Al 32 13 Al 27 Al-27 100 Al-28 2.246 m act n 0.232 0.175 0.037433333 2.25 m Al 33 13 Al 27 Al-27 100 Na-24 15.03 h "n,a" y 0.000725 15.03 15.03 h "from NBSIR 85-3151, IAEA 156" Al 34 13 Al 27 Al-27 100 Mg-27 9.458 m "n,p" y 0.004 0.157633333 9.458 m "IAEA156, fission averaged" Si 35 14 Si 28 Si-28 92.23 Al-28 2.25 m "n,p" y 0.0064 0.0375 2.250 m "IAEA156, fission averaged" Si 36 14 Si 29 Si-29 4.67 Al-29 6.5 m "n,p" y 0.0033 0.108333333 6.5 m "IAEA156, fission averaged" Si 37 14 Si 30 Si-30 3.1 Si-31 2.62 h act n 0.107 0.66 2.62 2.62 h 0.18 Si 38 14 Si 30 Si-30 3.1 Si-32 100 y 2n n 0.107 0.66 876000 100 y 2.62 0.18 Si 39 14 Si 30 Si-30 3.1 Mg-27 9.458 m "n,a" y 0.000155 0.157633333 9.458 m "IAEA156, fission averaged" P 40 15 P 31 P-31 100 P-32 14.3 d act n 0.172 0.085 343.2 14.3 d P 41 15 P 31 P-31 100 P-33 25.3 d 2n n 10 0 607.2 25.3 d 343.2 0.17 0.085 "dummy entry, a guess" P 42 15 P 31 P-31 100 Si-31 2.62 h "n,p" y 0.036 2.62 2.62 h 0.18 "IAEA156, fission averaged" P 43 15 P 31 P-31 100 Si-32 100 y 2n n 0.036 876000 100 y 2.62 0.18 "produced via P(n,p) then Si-31 (n,g)" S 44 16 S 32 S-32 95.02 P-32 14.3 d "n,p" y 0.069 343.2 14.3 d "IAEA156, fission averaged, an adopted std." S 45 16 S 33 S-33 0.75 P-33 25.3 d "n,p" n 0.002 607.2 25.3 d "IAEA273, thermal only" S 46 16 S 33 S-33 0.75 P-33 25.3 d "n,p" y 0.076 607.2 25.3 d "IAEA156, fission averaged" S 47 16 S 33 S-33 0.75 P-33 25.3 d "n,p" y 0.076 607.2 25.3 d "IAEA156, fission averaged" S 48 16 S 34 S-34 4.2 S-35 87.2 d act n 0.24 0.534 2092.8 87.2 d "IAEA273, note- no entry for A+1 nuclide" S 49 16 S 34 S-34 4.2 P-34 12.4 s "n,p" y 0.00043 0.003444444 12.40 s "IAEA156, fission averaged" S 50 16 S 36 S-36 0.015 S-37 5.1 m act n 0.15 0.17 0.085 5.10 m Cl 51 17 Cl 35 Cl-35 75.77 Cl-36 300000 y act n 43.6 18 2628000000 0.3 My Cl 52 17 Cl 35 Cl-35 75.77 S-35 87.2 d "n,p" n 0.489 2092.8 87.2 d "iaea273, thermal only" Cl 53 17 Cl 35 Cl-35 75.77 S-35 87.2 d "n,p" y 0.078 2092.8 87.2 d "IAEA156, fission averaged" Cl 54 17 Cl 35 Cl-35 75.77 P-32 14.3 d "n,a" n 0.00008 343.2 14.3 d "iaea273, thermal only" Cl 55 17 Cl 35 Cl-35 75.77 P-32 14.3 d "n,a" y 0.0088 343.2 14.3 d "IAEA156, fission averaged" Cl 56 17 Cl 37 Cl-37 24.23 Cl-38m+ 1 s m+ 100 act n 0.047 0.000277778 1.00 s Cl 57 17 Cl 37 Cl-37 24.23 Cl-38 37.18 m g act n 0.423 0.3 0.619666667 37.2 m s for 1s isomer added to ground state Cl 58 17 Cl 37 Cl-37 24.23 S-37 5.05 m "n,p" y 0.00038 0.084166667 5.1 m "IAEA156, fission averaged" Ar 59 18 Ar 36 Ar-36 0.34 Ar-37 34.8 d act n 5.2 2.5 835.2 34.8 d 1970 Ar 60 18 Ar 38 Ar-38 0.07 Ar-39 269 y act n 0.8 0.4 2356440 269 y 600 Ar 61 18 Ar 40 Ar-40 99.59 Ar-41 1.83 h act n 0.66 0.42 1.83 1.83 h 0.5 Ar 62 18 Ar 40 Ar-40 99.59 Ar-42 33 y 2n n 0.66 0.42 289080 33.00 y 1.83 0.5 K 63 19 K 39 K-39 93.3 Cl-36 300000 y "n,a" y 0.008 2628000000 0.3 My "IAEA156, fission averaged" K 64 19 K 39 K-39 93.3 Cl-36 300000 y "n,a" n 0.0043 2628000000 0.3 My "IAEA273, thermal only" K 65 19 K 39 K-39 93.3 K-40 1300000000 y act n 2.1 1.1 1.1388E+13 1.3 Gy 34.8 15 "IAEA273, thermal only" K 66 19 K 41 K-41 6.7 K-42 12.36 h act n 1.46 1.4 12.36 12.36 h K 67 19 K 41 K-41 6.7 Ar-41 1.83 h "n,p" y 0.0021 1.83 1.83 h 0.5 "IAEA156, fission averaged" K 68 19 K 41 K-41 6.7 Ar-42 33 y 2n n 0.0021 289080 33.00 y 1.83 0.5 produced from Ar-41 K 69 19 K 41 K-41 6.7 Cl-38 37.18 m "n,a" y 0.00076 0.619666667 37.2 m "IAEA156, fission averaged" Ca 70 20 Ca 40 Ca-40 96.94 Ca-41 130000 y act n 0.41 0.22 1138800000 0.13My 4 Ca 71 20 Ca 40 Ca-40 96.94 Ar-37 34.8 d "n,a" y 0.013 835.2 34.8 d 1970 "IAEA156, fission averaged" Ca 72 20 Ca 40 Ca-40 96.94 Ar-37 34.8 d "n,a" n 0.0025 835.2 34.8 d 1970 "IAEA273, thermal only" Ca 73 20 Ca 43 Ca-43 0.135 K-43 22.3 h "n,p" y 0.0003 22.3 22.30 h "IAEA156, fission averaged" Ca 74 20 Ca 44 Ca-44 2.08 Ca-45 165 d act n 0.88 0.56 3960 165 d 15 Ca 75 20 Ca 44 Ca-44 2.08 Ar-41 1.83 h "n,a" y 0.0000611 1.83 1.83 h 0.5 "IAEA156, fission averaged" Ca 76 20 Ca 44 Ca-44 2.08 Ar-42 33 y 2n n 0.0000611 289080 33.00 y 1.83 0.5 produced from Ar-41 Ca 77 20 Ca 46 Ca-46 0.003 Ca-47* 4.54 d * act n 0.74 0.32 108.96 4.54 d Ca 78 20 Ca 48 Ca-48 0.19 Ca-49t 8.72 m t act n 1.09 0.9 0.145333333 8.72 m Ca 79 20 Ca 48 Ca-48 0.19 Sc-49 57.3 m b n 1.09 0.9 0.955 57.3 m 0.145333333 Ca 80 20 Ca 48 Ca-48 0.19 Ca-47* 4.54 d "n,2n" y 0.00036 108.96 4.54 d "IAEA156, fission averaged" Sc 81 21 Sc 45 Sc-45 100 Sc-46m+ 18.7 s m+ 100 act n 9.8 5.4 0.005194444 18.7 s Sc 82 21 Sc 45 Sc-45 100 Sc-46 84 d g act n 27.2 11.5 2016 84.0 d 8 s for 19s isomer added to ground state Sc 83 21 Sc 45 Sc-45 100 Sc-47 3.34 d g 2n n 27.2 11.5 80.16 3.3 d 2016 8 Sc 84 21 Sc 45 Sc-45 100 Ca-45 165 d "n,p" y 0.015 3960 165.0 d "IAEA156, fission averaged" Sc 85 21 Sc 45 Sc-45 100 K-42 12.36 h "n,a" y 0.000182 12.36 12.36 h "IAEA156, fission averaged" Ti 86 22 Ti 46 Ti-46 8 Sc-46 84 d "n,p" y 0.0118 2016 84 d 8 from NBSIR 85-3151 Ti 87 22 Ti 46 Ti-46 8 Sc-47 3.34 d 2n n 0.0118 80.16 3 d 2016 8 produced via Sc-46 Ti 88 22 Ti 46 Ti-46 8 Ti-45 3.078 h "n,2n" y 0.0000078 3.078 3.08 h "IAEA156, fission averaged" Ti 89 22 Ti 47 Ti-47 7.3 Sc-47 3.422 d "n,p" y 0.018 82.128 3.422 d from NBSIR 85-3151 Ti 90 22 Ti 48 Ti-48 73.8 Sc-48 43.67 h "n,p" y 0.000397 43.67 43.67 h from NBSIR 85-3151 Ti 91 22 Ti 48 Ti-48 73.8 Ca-45 165 d "n,a" y 0.000013 3960 165.0 d "IAEA156, fission averaged" Ti 92 22 Ti 50 Ti-50 5.3 Ti-51 5.8 m act n 0.179 0.12 0.096666667 5.80 m Ti 93 22 Ti 50 Ti-50 5.3 Ca-47* 4.54 d "n,a" y 0.00000046 108.96 4.5 d "IAEA156, fission averaged" V 94 23 V 51 V-51 99.75 V-52 3.75 m act n 4.93 2.6 0.0625 3.75 m V 95 23 V 51 V-51 99.75 Ti-51 5.76 m "n,p" y 0.00087 0.096 5.76 m "IAEA156, fission averaged" V 96 23 V 51 V-51 99.75 Sc-48 43.67 h "n,a" y 0.000022 43.67 43.67 h "IAEA156, fission averaged" Cr 97 24 Cr 50 Cr-50 4.35 Cr-51 27.7 d act n 15.9 8.1 664.8 27.7 d Cr 98 24 Cr 50 Cr-50 4.35 Cr-49 42.1 m "n,2n" y 0.000006 0.701666667 42.10 m "IAEA156, fission averaged" Cr 99 24 Cr 52 Cr-52 83.79 V-52 3.75 m "n,p" y 0.00109 0.0625 3.75 m "IAEA156, fission averaged" Cr 100 24 Cr 53 Cr-53 9.5 V-53 1.61 m "n,p" y 0.00044 0.026833333 1.61 m "IAEA156, fission averaged" Cr 101 24 Cr 54 Cr-54 2.36 Cr-55 3.6 m act n 0.36 0.08 0.06 3.60 m Mn 102 25 Mn 55 Mn-55 100 Mn-56 2.58 h act n 13.3 13.8 2.58 2.58 h Mn 103 25 Mn 55 Mn-55 100 Mn-54 312.7 d "n,2n" y 0.000258 7504.8 312.7 d 38 17 "IAEA156, fission averaged" Mn 104 25 Mn 55 Mn-55 100 V-52 3.75 m "n,a" y 0.00011 0.0625 3.75 m "IAEA156, fission averaged" Fe 105 26 Fe 54 Fe-54 5.8 Fe-55 2.7 y act n 2.25 1.2 23652 2.70 y Fe 106 26 Fe 54 Fe-54 5.8 Mn-54 312.7 d "n,p" y 0.0817 7504.8 312.7 d 38 17 from NBSIR 85-3151 Fe 107 26 Fe 54 Fe-54 5.8 Cr-51 27.7 d "n,a" y 0.0006 664.8 27.7 d "IAEA156, fission averaged" Fe 108 26 Fe 54 Fe-54 5.8 Fe-53 8.51 m "n,2n" y 0.000005 0.141833333 8.51 m "IAEA156, fission averaged" Fe 109 26 Fe 56 Fe-56 91.72 Mn-56 2.58 h "n,p" y 0.00107 2.58 2.58 h "IAEA156, fission averaged" Fe 110 26 Fe 58 Fe-58 0.31 Fe-59 44.6 d act n 1.28 1.4 1070.4 44.6 d Co 111 27 Co 59 Co-59 100 Co-60m+ 10.5 m m+ 99.7 act n 18.8 39.7 0.175 10.5 m 58 230 Co 112 27 Co 59 Co-59 100 Co-61 1.65 h 2n n 18.8 39.7 1.65 1.7 h 0.175 58 230 Co-61 prod from Co-60m only Co 113 27 Co 59 Co-59 100 Co-60 5.272 y g act n 37.45 71.1 46182.72 5.27 y 2 4.1 s for 10m isomer added to ground state Co 114 27 Co 59 Co-59 100 Co-61 1.65 h 2n n 37.45 71.1 1.65 1.65 h 46182.72 2 4.1 Co-61 prod assuming all Co-60m has decayed to Co-60 Co 115 27 Co 59 Co-59 100 Fe-59 44.6 d "n,p" y 0.00142 1070.4 44.6 d "IAEA156, fission averaged" Co 116 27 Co 59 Co-59 100 Mn-56 2.58 h "n,a" y 0.000156 2.58 2.58 h "IAEA156, fission averaged" Co 117 27 Co 59 Co-59 100 Co-58 70.8 d "n,2n" y 0.0004 1699.2 70.8 d 1880 6890 "IAEA156, fission averaged" Ni 118 28 Ni 58 Ni-58 67.76 Ni-57 36.1 h "n,2n" y 0.0000049 36.1 36.10 h "IAEA156, fission averaged" Ni 119 28 Ni 58 Ni-58 67.76 Ni-59 75000 y act n 4.6 2.8 657000000 75000y 77.7 140 Ni 120 28 Ni 58 Ni-58 67.76 Fe-55 2.7 y "n,a" y 0.003 23652 2.70 y "iaea156, fission averaged" Ni 121 28 Ni 58 Ni-58 67.76 Fe-55 2.7 y "n,a" n 0.00003 23652 2.70 y "IAEA273, thermal only" Ni 122 28 Ni 58 Ni-58 67.76 Fe-55 2.7 y "n,a" y 0.003 23652 2.7 y "IAEA273, fission maxwellian weighted, IAEA156" Ni 123 28 Ni 58 Ni-58 67.76 Co-58 70.8 d "n,p" y 0.111 1699.2 70.8 d 1880 6890 from NBSIR 85-3151 Ni 124 28 Ni 58 Ni-58 67.76 Co-58m+ 9.1 h "n,p" y 0.0354 9.1 9.10 h 140000 540000 "IAEA156, fission averaged" Ni 125 28 Ni 60 Ni-60 26.1 Co-60 5.272 y "n,p" y 0.0023 46182.72 5.272 y 2 4.1 "IAEA156, fission averaged" Ni 126 28 Ni 60 Ni-60 26.1 Co-60m+ 10.48 m "n,p" y 0.0021 0.174666667 10.48 m 58 230 "IAEA156, fission averaged" Ni 127 28 Ni 60 Ni-60 26.1 Co-61 1.65 h 2n n 0.0021 1.65 1.65 h 0.174666667 58 230 produced via Co-60 Ni 128 28 Ni 61 Ni-61 1.13 Co-61 1.65 h "n,p" y 0.0014 1.65 1.65 h "IAEA156, fission averaged" Ni 129 28 Ni 62 Ni-62 3.71 Ni-63 100 y act n 14.5 8.1 876000 100 y 24.4 Ni 130 28 Ni 62 Ni-62 3.71 Fe-59 44.6 d "n,a" y 0.00009 1070.4 44.6 d "IAEA156, fission averaged" Ni 131 28 Ni 64 Ni-64 0.95 Ni-65 2.52 h act n 1.58 1.19 2.52 2.52 h 22.4 Cu 132 29 Cu 63 Cu-63 69.1 Cu-62 9.74 m "n,2n" y 0.000124 0.162333333 9.74 m "IAEA156, fission averaged" Cu 133 29 Cu 63 Cu-63 69.1 Cu-64 12.7 h act n 4.5 4.94 12.7 12.7 h Cu 134 29 Cu 63 Cu-63 69.1 Co-60 5.272 y "n,a" y 0.0006 46182.72 5.272 y 2 4.1 from NBSIR 85-3151 Cu 135 29 Cu 63 Cu-63 69.1 Co-61 1.65 h 2n n 0.0006 1.65 1.650 h 46182.72 2 4.1 produced via Co-60 Cu 136 29 Cu 65 Cu-65 30.9 Cu-66 5.1 m act n 2.17 2.32 0.085 5.10 m 135 Cu 137 29 Cu 65 Cu-65 30.9 Cu-67 61.9 h 2n n 2.17 2.32 61.9 61.90 h 0.085 135 Cu 138 29 Cu 65 Cu-65 30.9 Ni-65 2.52 h "n,p" y 0.00048 2.52 2.5 h 22.4 "IAEA156, fission averaged" Cu 139 29 Cu 65 Cu-65 30.9 Ni-66s 54.8 h 2n n 0.00048 54.8 54.8 h 2.52 22.4 produced via Ni-65 Zn 140 30 Zn 64 Zn-64 48.9 Zn-65 265 d act n 0.76 1.4 6360 265 d 250 Zn 141 30 Zn 64 Zn-64 48.9 Cu-64 12.7 h "n,p" y 0.031 12.7 12.7 h "IAEA156, fission averaged" Zn 142 30 Zn 66 Zn-66 27.9 Zn-65 265 d "n,2n" y 0.005 6360 265 d 250 "IAEA156, fission averaged [cross-section is <5 mb. Hence this is a max. calc.]" Zn 143 30 Zn 66 Zn-66 27.9 Cu-66 5.1 m "n,p" y 0.00062 0.085 5.1 m 135 "IAEA156, fission averaged" Zn 144 30 Zn 66 Zn-66 27.9 Cu-67 61.9 h 2n n 0.00062 61.9 61.9 h 0.085 135 produced via Cu-66 Zn 145 30 Zn 67 Zn-67 4.1 Cu-67 61.9 h "n,p" y 0.00107 61.9 61.9 h "IAEA156, fission averaged" Zn 146 30 Zn 68 Zn-68 18.6 Zn-69ms 13.9 h m* 99 act n 0.072 0.24 13.9 13.9 h s not added to ground state Zn 147 30 Zn 68 Zn-68 18.6 Zn-69 56 m g act n 1 3.36 0.933333333 56.0 m Zn 148 30 Zn 68 Zn-68 18.6 Ni-65 2.52 h "n,a" y 0.000074 2.52 2.5 h 22.4 "IAEA156, fission averaged" Zn 149 30 Zn 68 Zn-68 18.6 Ni-66s 54.8 h 2n n 0.000074 54.8 54.8 h 2.52 22.4 produced via Ni-65 Zn 150 30 Zn 70 Zn-70 0.62 Zn-71m 3.9 h m 0 act n 0.0087 3.9 3.90 h Zn 151 30 Zn 70 Zn-70 0.62 Zn-71 2.4 m g act n 0.083 0.04 2.40 m Ga 152 31 Ga 69 Ga-69 60 Ga-70 21.1 m act n 1.68 15.5 0.351666667 21.1 m Ga 153 31 Ga 69 Ga-69 60 Zn-69ms 13.8 h "n,p" y 0.000496 13.8 13.8 h "IAEA156, fission averaged" Ga 154 31 Ga 71 Ga-71 40 Ga-72m+ 0.036 s m+ 100 act n 0.15 0.00001 0.036 s Ga 155 31 Ga 71 Ga-71 40 Ga-72 14.1 h g act n 4.71 31.1 14.1 14.1 h 4.25 25.7 s for 36ms isomer added to ground state Ga 156 31 Ga 71 Ga-71 40 Ga-73 4.87 h 2n n 4.71 31.1 4.87 4.9 h 14.1 4.25 25.7 Ge 157 32 Ge 70 Ge-70 20.7 Ge-69 39.1 h "n,2n" y 0.0018 39.1 39.1 h "IAEA156, fission averaged" Ge 158 32 Ge 70 Ge-70 20.7 Ge-71m+ 0.02 s m+ 100 act n 0.28 5.55556E-06 0.020 s Ge 159 32 Ge 70 Ge-70 20.7 Ge-71 11.2 d g act n 3.43 1.5 268.8 11.2 d s for 20ms isomer added to ground state Ge 160 32 Ge 72 Ge-72 27.5 Ge-73m 0.53 s m 100 act n 0.98 0.76 0.000147222 0.530 s assigned m+g barns to m state. g is stable Ge 161 32 Ge 72 Ge-72 27.5 Ga-72 14.1 h "n,p" y 0.000022 14.1 14.1 h 4.25 25.7 "IAEA156, fission averaged" Ge 162 32 Ge 72 Ge-72 27.5 Ga-73 4.87 h 2n n 0.000022 4.87 4.9 h 14.1 4.25 25.7 produced via Ga-72 Ge 163 32 Ge 72 Ge-72 27.5 Zn-69ms 13.8 h "n,a" y 0.000025 13.8 13.8 h "IAEA156, fission averaged" Ge 164 32 Ge 74 Ge-74 36.4 Ge-75m+ 48 s m+ 99 act n 0.17 0.41 0.013333333 48.0 s Ge 165 32 Ge 74 Ge-74 36.4 Ge-75 83 m g act n 0.51 1 1.383333333 83.0 m s for 48s isomer added to ground state Ge 166 32 Ge 74 Ge-74 36.4 Zn-71ms 3.9 h "n,a" y 0.0000025 3.9 3.9 h "IAEA156, fission averaged" Ge 167 32 Ge 76 Ge-76 7.7 Ge-77m+ 54 s m+ 19.8 act n 0.1 1.2 0.015 54.0 s 1.48 7.01 Ge 168 32 Ge 76 Ge-76 7.7 Ge-77 11.3 h g act n 0.16 2 11.3 11.3 h 1.48 7.01 s for 54s isomer added to ground state Ge 169 32 Ge 76 Ge-76 7.7 Ge-78s 1.45 h 2n n 0.1 1.2 1.45 1.5 h 11.3 1.48 7.01 As 170 33 As 75 As-75 100 As-74 17.78 d "n,2n" y 0.00033 426.72 17.8 d "IAEA156, fission averaged" As 171 33 As 75 As-75 100 As-76 26.4 h act n 4.48 61 26.4 26.4 h 60.8 216.1 As 172 33 As 75 As-75 100 As-77 38.8 h 2n n 4.48 61 38.8 38.8 h 26.4 60.8 216.1 As 173 33 As 75 As-75 100 Ge-75 83 m "n,p" y 0.00045 1.383333333 83.00 m "IAEA156, fission averaged" Se 174 34 Se 74 Se-74 0.9 Se-75 120 d act n 51.8 514 2880 120 d Se 175 34 Se 74 Se-74 0.9 As-74 17.78 d "n,p" y 0.0066 426.72 18 d "IAEA156, fission averaged" Se 176 34 Se 76 Se-76 9 Se-77m 17.5 s m 100 act n 22 17 0.004861111 17.5 s Se 177 34 Se 77 Se-77 7.6 Se-77m 17.5 s "n,n'" y 0.733 0.004861111 17.5 s "IAEA156, fission averaged [max. cross-section]" Se 178 34 Se 78 Se-78 23.5 Se-77m 17.5 s "n,2n" y 0.001 0.004861111 17.5 s "IAEA156, fission averaged [max. cross-section]" Se 179 34 Se 78 Se-78 23.5 Se-79m+ 3.9 m m+ 100 act n 0.38 3.7 0.065 3.90 m 3.28 36 Se 180 34 Se 78 Se-78 23.5 Se-79 65000 y g act n 0.43 4.76 569400000 65000y 3.28 36 s for 4m isomer added to ground state Se 181 34 Se 80 Se-80 50 Se-79m 3.9 m "n,2n" y 0.01 0.065 3.9 m 3.28 36 "IAEA156, fission averaged [max. cross-section]" Se 182 34 Se 80 Se-80 50 Se-81m* 57.3 m m* 99 act n 0.08 0.42 0.955 57.3 m Se 183 34 Se 80 Se-80 50 Se-81 18 m g act n 0.53 1.28 0.3 18.0 m Se 184 34 Se 82 Se-82 9.1 Se-83m+ 69 s m+ 0 act n 0.039 0.019166667 69.0 s Se 185 34 Se 82 Se-82 9.1 Se-83t 22.4 m t act n 0.044 0.08 0.373333333 22.4 m s for 69s isomer added to ground state Se 186 34 Se 82 Se-82 9.1 Br-83 2.39 h b n 0.044 0.08 2.39 2.39 h 0.373333333 Br 187 35 Br 79 Br-79 50.69 Br-80m* 4.42 h m* 100 act n 2.4 35.7 4.42 4.42 h Br 188 35 Br 79 Br-79 50.69 Br-80 18 m g act n 8.6 95.7 0.3 18.0 m Br 189 35 Br 79 Br-79 50.69 As-76 26.4 h "n,a" y 0.00002 26.4 26.40 h 60.8 216.1 "IAEA156, fission averaged" Br 190 35 Br 79 Br-79 50.69 As-77 38.8 h 2n n 0.00002 38.8 38.80 h 26.4 60.8 216.1 produced via As-76 Br 191 35 Br 81 Br-81 49.31 Br-82m+ 6.1 m m+ 97.6 act n 2.43 41.3 0.101666667 6.10 m 18.09 90.46 Br 192 35 Br 81 Br-81 49.31 Br-82 35.34 h g act n 2.7 50.2 35.34 35.3 h 18.09 90.46 s for 6m isomer added to ground state Br 193 35 Br 81 Br-81 49.31 Br-83 2.39 h 2n n 2.7 50.2 2.39 2.4 h 35.34 18.09 90.46 Br 194 35 Br 81 Br-81 49.31 Se-81m* 57.3 m "n,p" y 0.0000145 0.955 57.30 m "IAEA156, fission averaged" Kr 195 36 Kr 78 Kr-78 0.35 Kr-79m+ 50 s m+ 100 act n 0.17 0.013888889 50.0 s Kr 196 36 Kr 78 Kr-78 0.35 Kr-79 34.9 h g act n 6.2 20 34.9 34.9 h s for 50s isomer added to ground state Kr 197 36 Kr 80 Kr-80 2.25 Kr-81m+ 13.3 s m+ 100 act n 4.55 0.003694444 13.3 s Kr 198 36 Kr 80 Kr-80 2.25 Kr-81 210000 y g act n 11.5 56 1839600000 0.21My s for 13s isomer added to ground state Kr 199 36 Kr 82 Kr-82 11.6 Kr-83m 1.83 h m 100 act n 14 1.83 1.83 h Kr 200 36 Kr 84 Kr-84 57 Kr-85m+ 4.48 h m+ 21.2 act n 0.09 2.4 4.48 4.48 h Kr 201 36 Kr 84 Kr-84 57 Kr-85 10.76 y g act n 0.0589 1.3 94257.6 10.76 y 1.66 1.8 21% of s for 4.4h isomer added to ground state Kr 202 36 Kr 86 Kr-86 17.3 Kr-87 76.3 m act n 0.003 0.1 1.271666667 76.3 m 12600 270 IAEA273: max burnup cross-sections Kr 203 36 Kr 86 Kr-86 17.3 Kr-88 2.84 h 2n n 0.003 0.1 2.84 2.8 h 1.271666667 12600 270 Rb 204 37 Rb 85 Rb-85 72.17 Rb-84 32.9 d "n,2n" y 0.0002 789.6 32.9 d 12 "IAEA156, fission averaged" Rb 205 37 Rb 85 Rb-85 72.17 Rb-86m+ 1.02 m m+ 100 act n 0.053 1.74 0.017 1.02 m 4.92 33 Rb 206 37 Rb 85 Rb-85 72.17 Rb-86 18.7 d g act n 0.48 5.5 448.8 18.7 d 4.92 33 s for 1m isomer added to ground state Rb 207 37 Rb 87 Rb-87 27.83 Rb-88 17.8 m act n 0.12 2.2 0.296666667 17.8 m 1 Rb 208 37 Rb 87 Rb-87 27.83 Rb-89* 15.2 m 2n n 0.12 2.2 0.253333333 15.2 m 0.296666667 1 decays to Sr-89 (not calculated) Sr 209 38 Sr 84 Sr-84 0.56 Sr-85m+ 67.7 m m+ 87 act n 0.6 4.59 1.128333333 67.7 m Sr 210 38 Sr 84 Sr-84 0.56 Sr-85 64.9 d g act n 0.87 10.6 1557.6 64.9 d 87% of s for 67m isomer added to ground state Sr 211 38 Sr 86 Sr-86 9.9 Sr-87m 2.81 h m 99.7 act n 0.84 4.79 2.81 2.81 h Sr 212 38 Sr 87 Sr-87 7 Sr-87m 2.81 h "n,n'" y 0.112 2.81 2.81 h "IAEA156, fission averaged [max. cross-section]" Sr 213 38 Sr 88 Sr-88 82.6 Sr-87m 2.81 h "n,2n" y 0.01 2.81 2.81 h "IAEA156, fission averaged [max. cross-section]" Sr 214 38 Sr 88 Sr-88 82.6 Sr-89 50.5 d act n 0.0058 0.06 1212 50.5 d 0.42 0.56 "IAEA273 value (.058) is in error, should be .0058" Sr 215 38 Sr 88 Sr-88 82.6 Sr-90 29 y 2n n 0.0058 0.06 254040 29.0 y 1212 0.42 0.56 Sr 216 38 Sr 88 Sr-88 82.6 Rb-88 15.2 m "n,p" y 0.00001 0.253333333 15.2 m 1 "IAEA156, fission averaged" Y 217 39 Y 89 Y-89 100 Y-88 106.61 d "n,2n" y 0.000156 2558.64 106.6 d "IAEA156, fission averaged" Y 218 39 Y 89 Y-89 100 Y-89m 15.7 s "n,n'" y 0.128 0.004361111 15.7 s "IAEA156, fission averaged" Y 219 39 Y 89 Y-89 100 Y-90m+ 3.19 h m+ 99 act n 0.001 3.19 3.19 h 6.5 3 Y 220 39 Y 89 Y-89 100 Y-90 64.1 h g act n 1.28 0.85 64.1 64.1 h 6.5 3 s for 3h isomer added to ground state Y 221 39 Y 89 Y-89 100 Y-91 58.5 d 2n n 1.28 0.85 1404 58.5 d 64.1 6.5 3 Y 222 39 Y 89 Y-89 100 Sr-89 50.5 d "n,p" y 0.00031 1212 50.5 d 0.42 0.56 "IAEA156, fission averaged" Y 223 39 Y 89 Y-89 100 Sr-90 29 y 2n n 0.00031 254040 29.0 y 1212 0.42 0.56 produced via Sr-89 Y 224 39 Y 89 Y-89 100 Rb-86 18.7 d "n,a" y 0.000002 448.8 18.7 d 4.92 33 "IAEA156, fission averaged" Zr 225 40 Zr 90 Zr-90 51.45 Zr-89 78.4 h "n,2n" y 0.000076 78.4 78.4 h "IAEA156, fission averaged" Zr 226 40 Zr 90 Zr-90 51.45 Y-90 64.1 h "n,p" y 0.00018 64.1 64.1 h 6.5 3 "IAEA156, fission averaged" Zr 227 40 Zr 90 Zr-90 51.45 Y-91 58.5 d 2n n 0.00018 1404 58.5 d 64.1 6.5 3 produced via Y-90 Zr 228 40 Zr 92 Zr-92 17.1 Zr-93 1500000 y act n 0.22 0.63 13140000000 1.5 My 2.6 20 Zr 229 40 Zr 92 Zr-92 17.1 Sr-89 50.5 d "n,a" y 0.000014 1212 50.5 d 0.42 0.56 "IAEA156, fission averaged" Zr 230 40 Zr 92 Zr-92 17.1 Sr-90s 29 y 2n n 0.000014 254040 29.0 y 1212 0.42 0.56 produced via Sr-89 Zr 231 40 Zr 94 Zr-94 17.5 Zr-95s 64 d s act n 0.0499 0.3 1536 64.0 d 0.49 6.5 Zr 232 40 Zr 96 Zr-96 2.8 Zr-97s 16.8 h s act n 0.023 5.6 16.8 16.8 h 0.202 1.55 2n addition results in 2 nuclides with t1/2's of <30 sec Nb 233 41 Nb 93 Nb-93 100 Nb-92mt 10.13 d "n,2n" y 0.00048 243.12 10.1 d "IAEA156, fission averaged" Nb 234 41 Nb 93 Nb-93 100 Nb-92 37000000 y b y 0.00048 3.2412E+11 37.00My 243.12 "IAEA156, fission averaged [as produced via isomer decay]" Nb 235 41 Nb 93 Nb-93 100 Nb-94m+ 6.2 m m+ 99.5 act n 1.15 8.2 0.103333333 6.20 m assigned m+g barns to both states Nb 236 41 Nb 93 Nb-93 100 Nb-94 20000 y g act n 1.15 8.2 175200000 20000y assigned m+g barns to both states Nb 237 41 Nb 93 Nb-93 100 Nb-93m 14.6 y m "n,n'" y 0.164 127896 14.6 y NBSIR 85-3151 Nb 238 41 Nb 93 Nb-93 100 Y-90 64.1 h "n,a" y 0.0000707 64.1 64.1 h 6.5 3 "IAEA156, fission averaged" Mo 239 42 Mo 92 Mo-92 14.8 Mo-93m+ 6.9 h m+ 99.8 act n 0.019 0.81 6.9 6.90 h assigned m+g barns to both states Mo 240 42 Mo 92 Mo-92 14.8 Mo-93 3500 y g act n 0.019 0.81 30660000 3500 y assigned m+g barns to both states Mo 241 42 Mo 92 Mo-92 14.8 Nb-92mt 10.13 d "n,p" y 0.007 243.12 10.13 d "IAEA156, fission averaged" Mo 242 42 Mo 92 Mo-92 14.8 Nb-92 37000000 y b y 0.007 3.2412E+11 37.00My 243.12 "IAEA156, fission averaged" Mo 243 42 Mo 92 Mo-92 14.8 Zr-89 78.4 h "n,a" y 0.00004 78.4 78.40 h "IAEA156, fission averaged" Mo 244 42 Mo 95 Mo-95 15.92 Nb-95 34.98 d "n,p" y 0.00014 839.52 34.98 d 7 24 "IAEA156, fission averaged" Mo 245 42 Mo 95 Mo-95 15.92 Nb-96 23.4 h 2n n 0.00014 23.4 23.40 h 839.52 7 24 produced via Nb-95 Mo 246 42 Mo 96 Mo-96 23.4 Nb-96 23.4 h "n,p" y 0.00023 23.4 23.40 h "IAEA156, fission averaged" Mo 247 42 Mo 98 Mo-98 24.4 Mo-99st 66 h st act n 0.13 7.3 66 66.00 h 1.733 26 Mo 248 42 Mo 98 Mo-98 24.4 Tc-99 210000 y b n 0.13 7.3 1839600000 0.21 My 66 20 230 2n addition results in 16 sec product. Burnup not calculated. Mo 249 42 Mo 98 Mo-98 24.4 Zr-95 64 d "n,a" y 0.0000139 1536 64.00 d 0.49 6.5 "IAEA156, fission averaged" Mo 250 42 Mo 100 Mo-100 9.6 Mo-101s 14.6 m s act n 0.199 4.2 0.243333333 14.6 m "daughter is = t1/2, only quasi-equilibrium" Tc 251 43 Tc 98 Tc-98 100 Tc-99m+ 6 h m+ 99 act n 0.93 6 6.00 h 1.62 26.7 Tc 252 43 Tc 98 Tc-98 100 Tc-99 210000 y g act n 2.6 1839600000 0.21My 20 230 s for 6h isomer added to ground state Ru 253 44 Ru 96 Ru-96 5.5 Ru-97t 2.9 d t act n 0.29 5.8 69.6 2.90 d Ru 254 44 Ru 96 Ru-96 5.5 Tc-97 2600000 y b n 0.29 5.8 22776000000 3 My 69.6 Ru 255 44 Ru 102 Ru-102 31.6 Ru-103 39.35 d act n 1.21 4.6 944.4 39.4 d 7.71 60 Ru 256 44 Ru 104 Ru-104 18.6 Ru-105t 4.44 h t act n 0.32 5.2 4.44 4.44 h 0.39 6.4 Ru106 2n product not calculated Ru 257 44 Ru 104 Ru-104 18.6 Rh-105 35.4 h b n 0.32 5.2 35.4 35.4 h 4.44 5000 WARNING!: Large burnup cross-section (5000 b). Burnup not calculated. Rh 258 45 Rh 103 Rh-103 100 Rh-103m 56.12 m "n,n'" y 0.533 0.935333333 56.12 m "IAEA156, fission averaged" Rh 259 45 Rh 103 Rh-103 100 Rh-104m 4.4 m m 99.8 act n 10 83 0.073333333 4.40 m 800 Rh 260 45 Rh 103 Rh-103 100 Rh-105 35.4 h 2n n 10 83 35.4 35.40 h 0.073333333 800 Rh 261 45 Rh 103 Rh-103 100 Rh-104 42 s g act n 135 993 0.011666667 42.0 s 800 Rh 262 45 Rh 103 Rh-103 100 Rh-105 35.4 h 2n n 10 83 35.4 35.40 h 0.011666667 800 Rh 263 45 Rh 103 Rh-103 100 Ru-103 39.35 d "n,p" y 0.000107 944.4 39.4 d 7.71 60 "IAEA156, fission averaged" Pd 264 46 Pd 102 Pd-102 1 Pd-103 17 d act n 3.4 10 408 17.0 d Pd 265 46 Pd 106 Pd-106 27.3 Pd-107m+ 21.3 s m+ 100 act n 0.013 0.005916667 21.3 s 1.8 77 Pd 266 46 Pd 106 Pd-106 27.3 Pd-107 6500000 y g act n 0.305 5.9 56940000000 6.5 My 1.8 77 s for 21s isomer added to ground state Pd 267 46 Pd 108 Pd-108 26.7 Pd-109m+ 4.69 m m+ 100 act n 0.183 2.26 0.078166667 4.69 m 5.24 60.6 Pd 268 46 Pd 108 Pd-108 26.7 Pd-109 13.46 h g act n 8.483 227 13.46 13.5 h 5.24 60.6 s for 4m isomer added to ground state Pd 269 46 Pd 110 Pd-110 11.8 Pd-111m* 5.5 h m* 71 act n 0.037 0.6 5.5 5.50 h Pd 270 46 Pd 110 Pd-110 11.8 Pd-111t 22 m t act n 0.19 4.5 0.366666667 22.0 m Pd 271 46 Pd 110 Pd-110 11.8 Ag-111 7.47 d b n 0.227 5.1 179.28 7.47 d 0.366666667 3 105 "m+g s, burnup not calculated" Ag 272 47 Ag 107 Ag-107 51.83 Ag-106ms 8.5 d "n,2n" y 0.00046 204 8.50 d "IAEA156, fission averaged" Ag 273 47 Ag 107 Ag-107 51.83 Ag-108m* 127 y m* 8.5 act n 0.33 1.26 1112520 127 y Ag 274 47 Ag 107 Ag-107 51.83 Ag-108 2.41 m g act n 37.27 93.74 0.040166667 2.41 m Ag 275 47 Ag 109 Ag-109 48.17 Ag-110m* 250.4 d m* 1.5 act n 4.7 1.0048 72.8 6009.6 250 d 82 41.3 Ag 276 47 Ag 109 Ag-109 48.17 Ag-110 24.6 s g act n 86.3 1377.2 0.006833333 24.6 s 82 41.3 Ag 277 47 Ag 109 Ag-109 48.17 Ag-111 7.47 d 2n n 86.3 1377.2 179.28 7.5 d 0.006833333 82 41.3 Ag 278 47 Ag 109 Ag-109 48.17 Pd-109 13.46 h "n,p" y 0.00006 13.46 13.46 h 5.24 60.6 "IAEA156, fission averaged" Cd 279 48 Cd 106 Cd-106 1.2 Cd-107 6.5 h act n 1 4 6.5 6.50 h Cd 280 48 Cd 106 Cd-106 1.2 Ag-106 24 m "n,p" y 0.0033 0.4 24.00 m "IAEA156, fission averaged" Cd 281 48 Cd 108 Cd-108 0.9 Cd-109 453 d act n 1.1 11 10872 453 d 700 Cd 282 48 Cd 110 Cd-110 12.4 Cd-111m 49 m m 100 act n 0.14 2.5 0.816666667 49.0 m Cd 283 48 Cd 110 Cd-110 12.4 Ag-110 24.6 s "n,p" y 0.0033 0.006833333 24.6 s 82 41.3 "IAEA156, fission averaged" Cd 284 48 Cd 110 Cd-110 12.4 Ag-111 7.47 d 2n n 0.0033 179.28 7.5 d 0.006833333 82 41.3 produced via Ag-110 Cd 285 48 Cd 111 Cd-111 12.8 Cd-111m 49 m "n,n'" y 0.288 0.816666667 49.00 m "IAEA156, fission averaged" Cd 286 48 Cd 112 Cd-112 24 Cd-111m 49 m "n,2n" y 0.00042 0.816666667 49.00 m "IAEA156, fission averaged" Cd 287 48 Cd 112 Cd-112 24 Cd-113m 14.6 y m 0.1 act n 2.2 13.5 127896 14.6 y assigned m+g barns to both states Cd 288 48 Cd 112 Cd-112 24 Cd-113 9E+15 y g act n 2.2 13.5 7.884E+19 9000 Ty 20600 388 assigned m+g barns to both states Cd 289 48 Cd 114 Cd-114 28.8 Cd-115ms 44.8 d ms 0 act n 0.036 3.1 1075.2 44.8 d 31.2 195.9 Cd 290 48 Cd 114 Cd-114 28.8 Cd-115s 53.38 h gs act n 0.3 19.9 53.38 53.38 h 5.43 79.9 Cd 291 48 Cd 116 Cd-116 7.6 Cd-117ms 3.31 h ms 0 act n 0.025 0.422 3.31 3.31 h Cd 292 48 Cd 116 Cd-116 7.6 Cd-117s 2.42 h gs act n 0.05 0.928 2.42 2.42 h In 293 49 In 113 In-113 4.3 In-114m2+ 0.042 s m2+ 100 act n 3.1 1.16667E-05 0.042 s In 294 49 In 113 In-113 4.3 In-114m1* 49.5 d m1* act n 8.1 220 1188 49.5 d "s for 42ms isomer added to m1 state, also m1 is in secular equil w/g state" In 295 49 In 113 In-113 4.3 In-114 71.9 s g act n 3.9 90 0.019972222 71.9 s In 296 49 In 115 In-115 95.7 In-116m2+ 2.2 s m2+ 100 act n 81 0.000611111 2.20 s In 297 49 In 115 In-115 95.7 In-116m1 54 m m1 act n 162.3 2605 0.9 54.0 m s for 2s isomer added to m1 state In 298 49 In 115 In-115 95.7 In-116 14 s g act n 40 655 0.003888889 14.0 s In 299 49 In 115 In-115 95.7 In-115m 4.36 h m "n,n'" y 0.19 4.36 4.36 h NBSIR 85-3151 Sn 300 50 Sn 112 Sn-112 1 Sn-113m+ 20 m m+ 91 act n 0.3 0.333333333 20.0 m Sn 301 50 Sn 112 Sn-112 1 Sn-113 115 d g act n 0.98 34 2760 115 d 91% of s for 20m isomer added to ground state Sn 302 50 Sn 116 Sn-116 14.4 Sn-117m 14 d m 100 act n 0.006 0.49 336 14.0 d Sn 303 50 Sn 118 Sn-118 24.1 Sn-119m 245 d m 100 act n 0.01 1.26 5880 245 d Sn 304 50 Sn 120 Sn-120 32.8 Sn-121m 55 y m 0 act n 0.001 481800 55.0 y 5.77 26.29 Sn 305 50 Sn 120 Sn-120 32.8 Sn-121 27 h g act n 0.14 1.25 27 27.0 h 5.77 26.29 Sn 306 50 Sn 122 Sn-122 4.7 Sn-123m 40.1 m m 0 act n 0.001 0.668333333 40.1 m 0.033 2.53 Sn 307 50 Sn 122 Sn-122 4.7 Sn-123 129.2 d g act n 0.18 0.84 3100.8 129 d 0.033 2.53 Sn 308 50 Sn 124 Sn-124 5.8 Sn-125t 9.64 d t act n 0.004 0.032 231.36 9.64 d 0.55 14.26 Sn 309 50 Sn 124 Sn-124 5.8 Sn-125m 9.5 m m 0 act n 0.13 8.5 0.158333333 9.50 m 0.55 14.26 Sn 310 50 Sn 124 Sn-124 5.8 Sb-125 2.76 y b n 0.134 8.532 24177.6 2.76 y 0.158333333 "both m&g go to Sb-125, use m t1/2 (major contributor)" Sn 311 50 Sn 124 Sn-124 5.8 Sn-126 100000 y 0 2n n 0.13 8.5 876000000 100000 y 0.158333333 0.55 14.26 Sb 312 51 Sb 121 Sb-121 57.3 Sb-122m+ 4.2 m m+ 100 act n 0.06 13 0.07 4.20 m 21.5 159 Sb 313 51 Sb 121 Sb-121 57.3 Sb-122 2.7 d g act n 5.9 202 64.8 2.70 d 21.5 159 s for 4m isomer added to ground state Sb 314 51 Sb 123 Sb-123 42.7 Sb-124m2* 20 m m2* 100 act n 0.019 0.333333333 20.0 m Sb 315 51 Sb 123 Sb-123 42.7 Sb-124m1+ 1.6 m m1+ 80 act n 0.037 0.026666667 1.60 m Sb 316 51 Sb 123 Sb-123 42.7 Sb-124 60.3 d g act n 4.145 128 1447.2 60.3 d 17.4 22.83 80% of s for both isomer added to ground state Sb 317 51 Sb 123 Sb-123 42.7 Sb-125 2.76 y 2n n 4.145 128 24177.6 2.8 y 1447.2 17.4 22.83 Te 318 52 Te 120 Te-120 0.09 Te-121m* 154 d m* 90.2 act n 0.34 3696 154 d Te 319 52 Te 120 Te-120 0.09 Te-121 16.8 d g act n 2 403.2 16.8 d Te 320 52 Te 122 Te-122 2.4 Te-123m* 119.7 d m* 100 act n 1.1 2872.8 119.7 d 42.89 273.1 Te 321 52 Te 122 Te-122 2.4 Te-123 1.2E+13 y g act n 2.3 1.0512E+17 12 Ty 418 5547 Te 322 52 Te 124 Te-124 4.6 Te-125m 58 d m 100 act n 0.04 1392 58.0 d 11.09 78.85 Te 323 52 Te 126 Te-126 18.7 Te-127m* 109 d m* 97.6 act n 0.135 1.04 2616 109 d 3380 1140 Te 324 52 Te 126 Te-126 18.7 Te-127 9.35 h g act n 0.9 8.56 9.35 9.35 h 2.76 48.2 Te 325 52 Te 128 Te-128 31.8 Te-129ms 33.6 d ms 63.4 act n 0.015 0.0774 806.4 33.6 d 1.11 20.51 Te 326 52 Te 128 Te-128 31.8 Te-129t 69.6 m t act n 0.1997 1.54 1.16 69.6 m 0.37 7.41 Te 327 52 Te 128 Te-128 31.8 I-129 16000000 y b n 0.1997 1.54 1.4016E+11 16 My 1.16 27 37 "use g s, m is a minor contributor. Burnup not calculated" Te 328 52 Te 130 Te-130 34.5 Te-131m 30 h m 18 act n 0.02 0.0485 30 30.0 h 0.11 0.16 Te 329 52 Te 130 Te-130 34.5 Te-132 78.2 h 2n n 0.27 0.446 78.2 78.2 h 30 0.04 0.05 Te 330 52 Te 130 Te-130 34.5 Te-131t 25 m t act n 0.27 0.446 0.416666667 25.0 m 0.04 0.05 2n prod calculated for both isomer and ground state since the larger producer is time dependent Te 331 52 Te 130 Te-130 34.5 I-131 8.04 d b n 0.27 0.446 192.96 8.04 d 0.416666667 0.7 8.5 burnup not calculated. Te 332 52 Te 130 Te-130 34.5 Te-132 78.2 h 2n n 0.27 0.446 78.2 78.2 h 0.416666667 0.04 0.05 I 333 53 I 127 I-127 100 I-126 13 d "n,2n" y 0.0009 312 13.00 d 5960 40600 "IAEA156, fission averaged" I 334 53 I 127 I-127 100 I-128 24.99 m act n 6.2 148 0.4165 25.0 m I 335 53 I 127 I-127 100 Te-127m* 109 d "n,p" y 0.0000128 2616 109.00 d 3380 1140 "IAEA156, fission averaged" I 336 53 I 127 I-127 100 Te-127 9.5 h "n,p" y 0.0000088 9.5 9.5 h 2.76 48.2 "IAEA156, fission averaged" Xe 337 54 Xe 124 Xe-124 0.096 Xe-125m+ 55 s m+ 100 act n 28 600 0.015277778 55.0 s Xe 338 54 Xe 124 Xe-124 0.096 Xe-125t 16.8 h t act n 165 3145 16.8 16.8 h s for 55s isomer added to ground state Xe 339 54 Xe 124 Xe-124 0.096 I-125 59.9 d b n 165 3145 1437.6 59.9 d 16.8 894 13730 burnup not calculated Xe 340 54 Xe 126 Xe-126 0.09 Xe-127m+ 75 s m+ 100 act n 0.45 8 0.020833333 75.0 s Xe 341 54 Xe 126 Xe-126 0.09 Xe-127 36.41 d g act n 3.5 50 873.84 36.4 d s for 75s isomer added to ground state Xe 342 54 Xe 128 Xe-128 1.919 Xe-129m 8.9 d m 100 act n 0.48 20 213.6 8.90 d Xe 343 54 Xe 130 Xe-130 4.08 Xe-131m 11.8 d m 100 act n 0.45 1.17 283.2 11.8 d Xe 344 54 Xe 132 Xe-132 26.89 Xe-133m+ 2.26 d m+ 100 act n 0.05 0.9 54.24 2.26 d Xe 345 54 Xe 132 Xe-132 26.89 Xe-133 5.72 d g act n 0.45 4.6 137.28 5.72 d 190 356.3 s for 2d isomer added to ground state Xe 346 54 Xe 134 Xe-134 10.4 Xe-135m+ 15.6 m m+ 99 act n 0.003 0.1 0.26 15.6 m Xe 347 54 Xe 134 Xe-134 10.4 Xe-135 9.14 h g act n 0.265 0.3 9.14 9.14 h 2650000 7475 s for 15m isomer added to ground state Xe 348 54 Xe 136 Xe-136 8.87 Xe-137t 3.9 m t act n 0.26 0.74 0.065 3.90 m Xe 349 54 Xe 136 Xe-136 8.87 Cs-137s 30.17 y b n 0.26 0.74 264289.2 30.17y 0.065 0.11 0.43 burnup not calculated. Cs 350 55 Cs 133 Cs-133 100 Cs-134m+ 2.89 h m+ 100 act n 2.5 30 2.89 2.89 h Cs 351 55 Cs 133 Cs-133 100 Cs-134 2.05 y g act n 29 422 17958 2.05 y 140 54.2 s for 3h isomer added to ground state Cs 352 55 Cs 133 Cs-133 100 Cs-135 3000000 y 2n n 29 422 26280000000 3 My 17958 140 54.2 Cs 353 55 Cs 133 Cs-133 100 I-130 12.36 h "n,a" y 0.0000033 12.36 12.36 h 18 178 "IAEA156, fission averaged" Cs 354 55 Cs 133 Cs-133 100 I-131 8.04 d 2n n 0.0000033 192.96 8.04 d 12.36 18 178 produced via I-130 Ba 355 56 Ba 130 Ba-130 0.101 Ba-131m+ 14.5 m m+ 100 act n 2.5 0.241666667 14.5 m Ba 356 56 Ba 130 Ba-130 0.101 Ba-131s 11.6 d gs act n 11.3 235 278.4 11.6 d s for 15m isomer added to ground state Ba 357 56 Ba 132 Ba-132 0.097 Ba-133m+ 39 h m+ 99 act n 0.5 3.3 39 39.0 h Ba 358 56 Ba 132 Ba-132 0.097 Ba-133 10.5 y g act n 7 91980 10.5 y s for 39h isomer added to ground state Ba 359 56 Ba 132 Ba-132 0.097 Cs-132 6.47 d "n,p" y 0.012 155.28 6.5 d "IAEA156, fission averaged" Ba 360 56 Ba 134 Ba-134 2.42 Ba-135m 29 h m 100 act n 0.158 24 29 29.0 h Ba 361 56 Ba 135 Ba-135 6.59 Ba-136m 0.32 s m 100 act n 0.0139 0.465 8.88889E-05 0.320 s Ba 362 56 Ba 136 Ba-136 7.81 Ba-137m 2.6 m m 100 act n 0.01 0.75 0.043333333 2.60 m Ba 363 56 Ba 136 Ba-136 7.81 Cs-136 13.1 d "n,p" y 0.0000035 314.4 13.1 d 1.3 44 "IAEA156, fission averaged" Ba 364 56 Ba 136 Ba-136 7.81 Cs-137 30.17 y 2n n 0.0000035 264289.2 30.2 y 314.4 1.3 44 produced via Cs-136 Ba 365 56 Ba 137 Ba-137 11.23 Ba-137m 2.552 m "n,n'" y 0.225 0.042533333 2.6 m "IAEA156, fission averaged" Ba 366 56 Ba 138 Ba-138 71.66 Ba-137m 2.552 m "n,2n" y 0.0024 0.042533333 2.6 m "IAEA156, fission averaged" Ba 367 56 Ba 138 Ba-138 71.66 Ba-139 83.3 m act n 0.36 0.32 1.388333333 83.3 m 6.2 Ba 368 56 Ba 138 Ba-138 71.66 Ba-140 12.76 d 2n n 0.36 0.32 306.24 12.8 d 1.388333333 6.2 Ba 369 56 Ba 138 Ba-138 71.66 Xe-135 9.14 h "n,a" y 0.0000019 9.14 9.1 h 2650000 7475 "IAEA156, fission averaged" La 370 57 La 139 La-139 99.911 La-140 40.22 h act n 8.93 12.2 40.22 40.2 h 2.7 69 La 371 57 La 139 La-139 99.911 La-141* 3.93 h 2n n 8.93 12.2 3.93 3.9 h 40.22 2.7 69 Ce 372 58 Ce 136 Ce-136 0.193 Ce-137m* 34.4 h m* 99.2 act n 0.95 34.4 34.4 h Ce 373 58 Ce 136 Ce-136 0.193 Ce-137t 9 h t act n 6.3 58 9 9.00 h m+g resonance s used for Ce-137 resonance Ce 374 58 Ce 136 Ce-136 0.193 La-137 60000 y b n 7.25 58 525600000 60000y 9 Ce 375 58 Ce 138 Ce-138 0.25 Ce-139m+ 55 s m+ 100 act n 0.015 0.015277778 55.0 s Ce 376 58 Ce 138 Ce-138 0.25 Ce-139 137.2 d g act n 1.115 3292.8 137 d 500 s for 55s isomer added to ground state Ce 377 58 Ce 140 Ce-140 88.48 Ce-141 32.5 d act n 0.57 0.48 780 32.5 d 29 23.7 Ce 378 58 Ce 140 Ce-140 88.48 La-140 40.22 h "n,p" y 0.0043 40.22 40.22 h 2.7 69 "IAEA156, fission averaged" Ce 379 58 Ce 140 Ce-140 88.48 La-141* 3.93 h 2n n 0.0043 3.93 3.93 h 40.22 2.7 69 produced via La-140 Ce 380 58 Ce 142 Ce-142 11.07 Ce-143t 33 h t act n 0.95 1.14 33 33.0 h 6 40 Ce 381 58 Ce 142 Ce-142 11.07 Pr-143 13.58 d b n 0.95 1.14 325.92 13.58d 33 90 185 Ce 382 58 Ce 142 Ce-142 11.07 Ce-144s 284.4 d 2n n 0.95 1.14 6825.6 284.4 d 33 6 40 Pr 383 59 Pr 141 Pr-141 100 Pr-142m+ 14.6 m m+ act n 3.9 0.243333333 14.6 m Pr 384 59 Pr 141 Pr-141 100 Pr-142 19.2 h g act n 11.5 17.8 19.2 19.2 h 20 144 s for 15m isomer added to ground state Pr 385 59 Pr 141 Pr-141 100 Pr-143 13.58 d 2n n 11.5 17.8 325.92 13.6 d 19.2 20 144 Pr 386 59 Pr 141 Pr-141 100 Ce-141 32.5 d "n,p" y 0.00012 780 32.50d 29 23.7 "IAEA156, fission averaged" Nd 387 60 Nd 146 Nd-146 17.18 Nd-147t 11.06 d t act n 1.4 2.7 265.44 11.06 d 440 540 Nd 388 60 Nd 146 Nd-146 17.18 Pm-147 2.6234 y b n 1.4 2.7 22980.984 2.62 y 265.44 181 2230 burnup not calculated Nd 389 60 Nd 148 Nd-148 5.72 Nd-149t 1.8 h t act n 2.5 14 1.8 1.80 h Nd 390 60 Nd 148 Nd-148 5.72 Pm-149 53.1 h b n 2.5 14 53.1 53.1 h 1.8 1400 825 burnup not calculated Nd 391 60 Nd 150 Nd-150 5.6 Nd-151t 12 m t act n 1.2 14.5 0.2 12.0 m "goes to Pm-151(24m), then Sm-151(90y)." Nd 392 60 Nd 150 Nd-150 5.6 Pm-151 28.4 h b n 1.2 14.5 28.4 28.4 h 0.2 173 1400 Nd 393 60 Nd 150 Nd-150 5.6 Sm-151 90 y b n 1.2 14.5 788400 90 y 0.2 15000 3100 calc ignores intermediate 24m Pm-151. Burnup not calculated Sm 394 62 Sm 144 Sm-144 3.16 Sm-145t 340 d t act n 0.7 8160 340 d Sm 395 62 Sm 144 Sm-144 3.16 Pm-145 17.7 y b n 0.7 155052 17.7 y 8160 Sm 396 62 Sm 150 Sm-150 7.47 Sm-151 93 y act n 102 280 814680 93.0 y 15000 3100 Sm 397 62 Sm 152 Sm-152 26.63 Sm-153 46.8 h act n 206 2960 46.8 46.8 h 334.5 3700 Sm 398 62 Sm 154 Sm-154 22.53 Sm-155 23.5 m act n 5.5 29 0.391666667 23.5 m Eu 399 63 Eu 151 Eu-151 47.77 Eu-152m2+ 96 m m2+ 100 act n 4.2 1.6 96.0 m Eu 400 63 Eu 151 Eu-151 47.77 Eu-152m1 9.3 h m1 0 act n 3215 0.8936 1823 9.3 9.30 h s for 96m isomer added to ground state Eu 401 63 Eu 151 Eu-151 47.77 Gd-152 1.1E+14 y b n 3215 0.8936 1823 9.636E+17 110 Ty 9.3 1100 3000 from Eu-152m1. Burnup not calculated Eu 402 63 Eu 151 Eu-151 47.77 Eu-152t 12.7 y t 0 act n 5935 0.9022 3552 111252 12.7 y Eu 403 63 Eu 151 Eu-151 47.77 Gd-152 1.1E+14 y b n 5935 0.9022 3552 9.636E+17 110 Ty 111252 1100 3000 from Eu-152. Burnup not calculated. Eu 404 63 Eu 153 Eu-153 52.23 Eu-154 8.5 y act n 603 1.029 3414 74460 8.50 y 1500 1500 Eu 405 63 Eu 153 Eu-153 52.23 Eu-155 4.73 y 2n n 603 1.029 3414 41434.8 4.73 y 74460 1500 1500 Gd 406 64 Gd 152 Gd-152 0.2 Gd-153 242 d act n 1100 3000 5808 242 d Gd 407 64 Gd 158 Gd-158 24.9 Gd-159 18 h act n 2.5 80 18 18.0 h 16.3 186.7 Gd 408 64 Gd 160 Gd-160 21.9 Gd-161t 3.7 m t act n 0.77 7 0.061666667 3.70 m Gd 409 64 Gd 160 Gd-160 21.9 Tb-161 6.91 d b n 0.77 7 165.84 6.91 d 0.061666667 96.6 655.9 burnup not calculated Tb 410 65 Tb 159 Tb-159 100 Tb-160 72.1 d act n 23.2 400 1730.4 72.1 d 525 1135 Tb 411 65 Tb 159 Tb-159 100 Tb-161 6.91 d 2n n 23.2 400 165.84 6.9 d 1730.4 525 1135 Dy 412 66 Dy 156 Dy-156 0.0524 Dy-157t 8.1 h t act n 33 960 8.1 8.10 h Dy 413 66 Dy 156 Dy-156 0.0524 Tb-157 150 y b n 33 960 1314000 150 y 8.1 Dy 414 66 Dy 158 Dy-158 0.0902 Dy-159 144 d act n 43 120 3456 144 d Dy 415 66 Dy 164 Dy-164 28.18 Dy-165m 1.15 m m 97.7 act n 1700 0.019166667 1.15 m Dy 416 66 Dy 164 Dy-164 28.18 Dy-165 2.35 h g act n 1000 2.35 2.35 h 3900 22000 Dy 417 66 Dy 164 Dy-164 28.18 Dy-166 81.6 h 2n n 1000 81.6 81.60 h 2.35 3900 22000 Ho 418 67 Ho 165 Ho-165 100 Ho-166m 1200 y m 0 act n 3.5 55 10512000 1200 y Ho 419 67 Ho 165 Ho-165 100 Ho-166 27.2 h g act n 61.2 660 27.2 27.2 h Er 420 68 Er 162 Er-162 0.136 Er-163t 75.1 m t act n 19 480 1.251666667 75.1 m Er 421 68 Er 162 Er-162 0.136 Ho-163 10 y b n 19 480 87600 10 y 1.251666667 Er 422 68 Er 164 Er-164 1.56 Er-165 10.34 h act n 13 120 10.34 10.34 h Er 423 68 Er 166 Er-166 33.41 Er-167m 2.35 s m 100 act n 15 0.000652778 2.35 s Er 424 68 Er 168 Er-168 27.07 Er-169 9.6 d act n 1.95 35 230.4 9.60 d Er 425 68 Er 170 Er-170 14.88 Er-171t 7.52 h t act n 5.7 24 7.52 7.52 h 280 Er 426 68 Er 170 Er-170 14.88 Tm-171 1.92 y b n 5.7 24 16819.2 1.92 y 7.52 4.5 118 burnup not calculated. Er 427 68 Er 170 Er-170 14.88 Er-172* 49.3 h 2n n 5.7 24 49.3 49.30 h 7.52 280 Tm 428 69 Tm 169 Tm-169 100 Tm-170 130 d g act n 103 1710 3120 130 d 92 460 "assigned m+g s, m is 4us" Tm 429 69 Tm 169 Tm-169 100 Tm-171 63.6 h 2n n 103 1710 63.6 64 h 3120 92 460 Yb 430 70 Yb 168 Yb-168 0.14 Yb-169m+ 46 s m+ 100 act n 3470 30500 0.012777778 46.0 s assigned m+g barns to both states Yb 431 70 Yb 168 Yb-168 0.14 Yb-169 31.8 d g act n 3470 30500 763.2 31.8 d assigned m+g barns to both states Yb 432 70 Yb 174 Yb-174 31.84 Yb-175m+ 0.067 s m+ 100 act n 46 1.86111E-05 0.067 s Yb 433 70 Yb 174 Yb-174 31.84 Yb-175 4.2 d g act n 65 34.5 100.8 4.20 d s for 67ms isomer added to ground state Yb 434 70 Yb 176 Yb-176 12.73 Yb-177m+ 6.5 s m+ 100 act n 2.4 8.1 0.001805556 6.50 s assigned m+g barns to both states Yb 435 70 Yb 176 Yb-176 12.73 Yb-177t 1.9 h t act n 2.4 8.1 1.9 1.90 h assigned m+g barns to both states Yb 436 70 Yb 176 Yb-176 12.73 Lu-177 6.74 d b n 2.4 8.1 161.76 6.74 d 1.9 Lu 437 71 Lu 175 Lu-175 97.4 Lu-176m 3.69 h m 0 act n 15.1 523 3.69 3.69 h Lu 438 71 Lu 175 Lu-175 97.4 Lu-176 33000000000 y g act n 7 202 2.8908E+14 0.033Ty 2100 1017 Lu 439 71 Lu 175 Lu-175 97.4 Lu-177 6.74 d 2n n 7 202 161.76 6.74 d 2.8908E+14 2100 1017 Lu 440 71 Lu 176 Lu-176 2.6 Lu-177m* 115 d m2* act n 2.1 2760 115 d note:Lu-176 is radioactive Lu 441 71 Lu 176 Lu-176 2.6 Lu-177 6.74 d g act n 2100 1.6914 1017 161.76 6.74 d added all of .16ms m1 state to 6.7d g state Hf 442 72 Hf 174 Hf-174 0.163 Hf-175 70 d act n 390 288 1680 70.0 d Hf 443 72 Hf 177 Hf-177 18.56 Hf-178m 4.3 s m 100 act n 1.1 0.001194444 4.30 s Hf 444 72 Hf 178 Hf-178 27.1 Hf-179m2 25.1 d m2 100 act n 10 602.4 25.1 d "nominal 10 b assigned, with error tolerance of m+g total" Hf 445 72 Hf 178 Hf-178 27.1 Hf-179m1 18.6 s m1 100 act n 53 0.005166667 18.6 s Hf 446 72 Hf 179 Hf-179 13.75 Hf-180m 5.5 h m 100 act n 0.34 4.75 5.5 5.50 h Hf 447 72 Hf 180 Hf-180 35.22 Hf-181 42.5 d act n 12.6 33.6 1020 42.5 d 40 Hf 448 72 Hf 180 Hf-180 35.22 Hf-182s 9000000 y 2n n 12.6 33.6 78840000000 9.00My 1020 40 Ta 449 73 Ta 181 Ta-181 99.9877 Ta-182m+ 16.5 m m+ 100 act n 0.012 0.415 0.275 16.5 m Ta 450 73 Ta 181 Ta-181 99.9877 Ta-182 115.1 d g act n 21.5 717 2762.4 115.1 d 8530 977 s for 17m isomer added to ground state Ta 451 73 Ta 181 Ta-181 99.9877 Ta-183 5.1 d 2n n 21.5 717 122.4 5.1 d 2762.4 8530 977 Ta 452 73 Ta 181 Ta-181 99.9877 Lu-178 28.5 m "n,a" y 0.00000016 0.475 28.5 m "IAEA156, fission averaged" W 453 74 W 180 W-180 0.135 W-181 121 d act n 3.5 200 2904 121 d W 454 74 W 182 W-182 26.3 Ta-182 115.1 d "n,p" y 0.000004 2762.4 115 d 8530 977 "IAEA156, fission averaged" W 455 74 W 182 W-182 26.3 Ta-183 5.1 d 2n n 0.000004 122.4 5 d 2762.4 8530 977 produced via Ta-182 W 456 74 W 183 W-183 14.3 Ta-183 5.1 d "n,p" y 0.000003 122.4 5 d "IAEA156, fission averaged" W 457 74 W 184 W-184 30.6 W-185m+ 1.62 m m+ 100 act n 0.002 0.027 1.62 m W 458 74 W 184 W-184 30.6 W-185 75 d g act n 1.8 13.4 1800 75.0 d s for 2m isomer added to ground state W 459 74 W 184 W-184 30.6 Hf-181 42.5 d "n,a" y 0.0000002 1020 42.5 d 40 "IAEA156, fission averaged" W 460 74 W 184 W-184 30.6 Hf-182s 9000000 y 2n n 0.0000002 78840000000 9.00My 1020 40 produced via Hf-181 W 461 74 W 186 W-186 28.4 W-185 75 d "n,2n" y 0.01 1800 75.0 d "IAEA156, fission averaged" W 462 74 W 186 W-186 28.4 W-187 23.9 h act n 37 490 23.9 23.9 h 64 2670 W 463 74 W 186 W-186 28.4 W-188 69.4 d 2n n 37 490 69.4 69.4 d 23.9 64 2670 Re 464 75 Re 185 Re-185 37.07 Re-184ms 165 d "n,2n" y 0.00062 3960 165.0 d "IAEA156, fission averaged" Re 465 75 Re 185 Re-185 37.07 Re-184 38 d "n,2n" y 0.0046 912 38.0 d "IAEA156, fission averaged" Re 466 75 Re 185 Re-185 37.07 Re-186 88.9 h act n 112 1718 88.9 88.9 h Re 467 75 Re 187 Re-187 62.93 Re-186 88.9 h "n,2n" y 0.01 88.9 88.9 h "IAEA156, fission averaged" Re 468 75 Re 187 Re-187 62.93 Re-188m+ 18.7 m m+ 100 act n 73 8.8 0.311666667 18.7 m Re 469 75 Re 187 Re-187 62.93 Re-188 16.7 h g act n 75 305 16.7 16.7 h s for 19m isomer added to ground state Os 470 76 Os 184 Os-184 0.018 Os-185 93.6 d act n 3005 1354 2246.4 94 d Os 471 76 Os 188 Os-188 13.3 Os-189m 5.7 h m 100 act n 4.3 135 5.7 5.70 h assigned m+g barns to m state. g is stable Os 472 76 Os 189 Os-189 16.1 Os-190m 10 m m 100 act n 0.26 0.013 0.166666667 10.00 m Os 473 76 Os 190 Os-190 26.4 Os-191m+ 15 h m+ 100 act n 13.2 26.5 15 15.0 h Os 474 76 Os 190 Os-190 26.4 Os-191 15 d g act n 17.1 58.2 360 15.0 d s for 15h isomer added to ground state Os 475 76 Os 192 Os-192 41 Os-193 31.5 h act n 1.97 5.4 31.5 31.5 h 1540 Os 476 76 Os 192 Os-192 41 Os-194s 6 y 2n n 1.97 5.4 52560 6.0 y 31.5 1540 Ir 477 77 Ir 191 Ir-191 38.5 Ir-192m2* 241 y m2* 100 act n 0.32 2111160 241 y Ir 478 77 Ir 191 Ir-191 38.5 Ir-192m1+ 1.4 m m1+ 99 act n 300 1060 0.023333333 1.40 m Ir 479 77 Ir 191 Ir-191 38.5 Ir-192 74.2 d g act n 924 4595 1780.8 74.2 d 1420 3242 "s for 1.4m isomer added to ground state, not m2 isomer" Ir 480 77 Ir 191 Ir-191 38.5 Ir-193m 10.6 d m 2n n 924 4595 254.4 10.6 d 1780.8 1420 3242 Brookhaven database Ir 481 77 Ir 193 Ir-193 61.5 Ir-194m 171 d m 0 act n 5.8 4104 171 d Ir 482 77 Ir 193 Ir-193 61.5 Ir-194 19 h g act n 110 19 19.0 h Pt 483 78 Pt 190 Pt-190 0.0127 Pt-191 3 d act n 150 72 3.00 d Pt 484 78 Pt 192 Pt-192 0.78 Pt-193m 4.4 d m 100 act n 2.2 105.6 4.40 d Pt 485 78 Pt 192 Pt-192 0.78 Pt-193 50 y g act n 14 83 438000 50.0 y assign >> from periodictable import activation >>> env = activation.ActivationEnvironment(fluence=1e5, Cd_ratio=70, fast_ratio=50, location="BT-2") >>> sample = activation.Sample("Co30Fe70", 10) >>> sample.calculate_activation(env, exposure=10, rest_times=[0, 1, 24, 360]) >>> sample.show_table() ----------------- activity (uCi) ------------------ isotope product reaction T1/2 (hrs) 0 hrs 1 hrs 24 hrs 360 hrs -------- -------- -------- ---------- ------------ ------------ ------------ ------------ Co-59 Co-60 act 5.272 y 0.000496 0.000496 0.0004958 0.0004933 Co-59 Co-60m+ act 10.5 m 1.664 0.0317 --- --- -------- -------- -------- ---------- ------------ ------------ ------------ ------------ total 1.665 0.03221 0.0005084 0.000505 -------- -------- -------- ---------- ------------ ------------ ------------ ------------ >>> print("%.3f"%sample.decay_time(0.001)) # number of hours to reach 1 nCi 2.053 The default rest times used above show the sample activity at the end of neutron activation and after 1 hour, 1 day, and 15 days. Activation cross sections are mostly from IAEA-273\ [#IAEA1987]. See activation.dat in the package directory for details on individual isotopes. Activation can be run from the command line using:: $ python -m periodictable.activation FORMULA where FORMULA is the chemical formula for the material. ..[#IAEA1987] IAEA (1987) Handbook on Nuclear Activation Data. TR 273 (International Atomic Energy Agency, Vienna, Austria, 1987). https://www-nds.iaea.org/publications/tecdocs/sti%252Fdoc%252F10%252F0273/ """ from __future__ import division, print_function from math import exp, log import os from .formulas import formula as build_formula from . import core LN2 = log(2) def NIST2001_isotopic_abundance(iso): """ Isotopic abundance in % from the periodic table package. Böhlke, et al. Isotopic Compositions of the Elements, 2001. J. Phys. Chem. Ref. Data, Vol. 34, No. 1, 2005 """ return iso.abundance def IAEA1987_isotopic_abundance(iso): """ Isotopic abundance in % from the IAEA, as provided in the activation.dat table. Note: this will return an abundance of 0 if there is no neutron activation for the isotope even though for isotopes such as H[1], the natural abundance may in fact be rather large. IAEA 273: Handbook on Nuclear Activation Data, 1987. """ try: return iso.neutron_activation[0].abundance except AttributeError: return 0 class Sample(object): """ Sample properties. *formula* : chemical formula Chemical formula. Any format accepted by :func:`periodictable.formula` can be used, including formula string. *mass* : float | g Sample mass. *name* : string Name of the sample (defaults to formula). """ def __init__(self, formula, mass, name=None): self.formula = build_formula(formula) self.mass = mass # cell F19 self.name = name if name else str(self.formula) # cell F20 self.activity = {} # The following are set in calculation_activation self.environment = None # type: "ActivationEnvironment" self.exposure = 0. self.rest_times = () def calculate_activation(self, environment, exposure=1, rest_times=(0, 1, 24, 360), abundance=NIST2001_isotopic_abundance): """ Calculate sample activation after exposure to a neutron flux. *environment* is the exposure environment. *exposure* is the exposure time in hours (default is 1 h). *rest_times* is the list of deactivation times in hours (default is [0, 1, 24, 360]). *abundance* is a function that returns the relative abundance of an isotope. By default it uses :func:`NIST2001_isotopic_abundance`, and there is the alternative :func:`IAEA273_isotopic_abundance`. """ self.activity = {} self.environment = environment self.exposure = exposure self.rest_times = rest_times for el, frac in self.formula.mass_fraction.items(): if core.isisotope(el): A = activity(el, self.mass*frac, environment, exposure, rest_times) self._accumulate(A) else: for iso in el.isotopes: iso_mass = self.mass*frac*abundance(el[iso])*0.01 if iso_mass: A = activity(el[iso], iso_mass, environment, exposure, rest_times) self._accumulate(A) def decay_time(self, target): """ After determining the activation, compute the number of hours required to achieve a total activation level after decay. """ if not self.rest_times or not self.activity: return 0 # Find the small rest time (probably 0 hr) i, To = min(enumerate(self.rest_times), key=lambda x: x[1]) # Find the activity at that time, and the decay rate data = [(Ia[i], LN2/a.Thalf_hrs) for a, Ia in self.activity.items()] # Build functions for total activity at time T - target and its derivative # This will be zero when activity is at target f = lambda t: sum(Ia*exp(-La*(t-To)) for Ia, La in data) - target df = lambda t: sum(-La*Ia*exp(-La*(t-To)) for Ia, La in data) # Return target time, or 0 if target time is negative if f(0) < target: return 0 else: t, ft = find_root(0, f, df) return t def _accumulate(self, activity): for el, activity_el in activity.items(): el_total = self.activity.get(el, [0]*len(self.rest_times)) self.activity[el] = [T+v for T, v in zip(el_total, activity_el)] def show_table(self, cutoff=0.0001, format="%.4g"): """ Tabulate the daughter products. *cutoff=1* : float | uCi The minimum activation value to show. *format="%.1f"* : string The number format to use for the activation. """ # TODO: need format="auto" which picks an appropriate precision based on # cutoff and/or activation level. # Track individual rows with more than 1 uCi of activation, and total activation # Replace any activation below the cutoff with '---' rows = [] total = [0]*len(self.rest_times) for el, activity_el in sorted_activity(self.activity.items()): total = [t+a for t, a in zip(total, activity_el)] if all(a < cutoff for a in activity_el): continue activity_str = [format%a if a >= cutoff else "---" for a in activity_el] rows.append([el.isotope, el.daughter, el.reaction, el.Thalf_str]+activity_str) footer = ["", "", "", "total"] + [format%t if t >= cutoff else "---" for t in total] # If no significant total activation then don't print the table if all(t < cutoff for t in total): print("No significant activation") return # Print the table header, with an overbar covering the various rest times # Print a dashed separator above and below each column header = ["isotope", "product", "reaction", "T1/2 (hrs)"] \ + ["%g hrs"%vi for vi in self.rest_times] separator = ["-"*8, "-"*8, "-"*8, "-"*10] + ["-"*12]*len(self.rest_times) cformat = "%-8s %-8s %8s %10s " + " ".join(["%12s"]*len(self.rest_times)) width = sum(len(c)+1 for c in separator[4:]) - 1 if width < 16: width = 16 overbar = "-"*(width//2-8) + " activity (uCi) " + "-"*((width+1)//2-8) offset = sum(len(c)+1 for c in separator[:4]) - 1 print(" "*(offset+1)+overbar) print(cformat%tuple(header)) print(cformat%tuple(separator)) # Print the significant table rows, or indicate that there were no # significant rows if the total is significant but none of the # individual isotopes if rows: for r in rows: print(cformat%tuple(r)) else: print("No significant isotope activation") print(cformat%tuple(separator)) # If there is more than one row, or if there is enough marginally # significant activation that the total is greater then the one row # print the total in the footer if len(rows) != 1 or any(c != t for c, t in zip(rows[0][4:], footer[4:])): print(cformat%tuple(footer)) print(cformat%tuple(separator)) def find_root(x, f, df, max=20, tol=1e-10): r""" Find zero of a function. Returns when $|f(x)| < tol$ or when max iterations have been reached, so check that $|f(x)|$ is small enough for your purposes. Returns x, f(x). """ fx = f(x) for _ in range(max): if abs(f(x)) < tol: break x -= fx / df(x) fx = f(x) return x, fx def sorted_activity(activity_pair): """Interator over activity pairs sorted by isotope then daughter product.""" return sorted(activity_pair, key=lambda x: (x[0].isotope, x[0].daughter)) class ActivationEnvironment(object): """ Neutron activation environment. The activation environment provides details of the neutron flux at the sample position. *fluence* : float | n/cm^2/s Thermal neutron fluence on sample. For COLD neutrons enter equivalent thermal neutron fluence. *Cd_ratio* : float Neutron cadmium ratio. Use 0 to suppress epithermal contribution. *fast_ratio* : float Thermal/fast ratio needed for fast reactions. Use 0 to suppress fast contribution. """ def __init__(self, fluence=1e5, Cd_ratio=0., fast_ratio=0., location=""): self.fluence = fluence # cell F13 self.Cd_ratio = Cd_ratio # cell F15 self.fast_ratio = fast_ratio # cell F17 self.location = location # cell F21 # Cell Q1 @property def epithermal_reduction_factor(self): """ Used as a multiplier times the resonance cross section to add to the thermal cross section for all thermal induced reactions. """ return 1./self.Cd_ratio if self.Cd_ratio >= 1 else 0 COLUMN_NAMES = [ "_symbol", # 0 AF "_index", # 1 AG "Z", # 2 AH "symbol", # 3 AI "A", # 4 AJ "isotope", # 5 AK "abundance", # 6 AL "daughter", # 7 AM "_Thalf", # 8 AN "_Thalf_unit", # 9 AO "isomer", # 10 AP "percentIT", # 11 AQ "reaction", # 12 AR "fast", # 13 AS "thermalXS", # 14 AT "gT", # 15 AU "resonance", # 16 AV "Thalf_hrs", # 17 AW "Thalf_str", # 18 AX "Thalf_parent", # 19 AY "thermalXS_parent", # 20 AZ "resonance_parent", # 21 BA "comments", # 22 BB ] INT_COLUMNS = [1, 2, 4] BOOL_COLUMNS = [13] FLOAT_COLUMNS = [6, 11, 14, 15, 16, 17, 19, 20, 21] def activity(isotope, mass, env, exposure, rest_times): """ Compute isotope specific daughter products after the given exposure time and rest period. """ result = {} if not hasattr(isotope, 'neutron_activation'): return result for ai in isotope.neutron_activation: # Ignore fast neutron interactions if not using fast ratio if ai.fast and env.fast_ratio == 0: continue # Column D: elemental % mass content of sample # mass fraction and abundance already included in mass calculation, so not needed # Column E: target nuclide and comment # str(isotope), ai.comment # Column F: Nuclide Produced # ai.daughter # Column G: Half-life # ai.Thalf_str # Column H: initial efective cross-section (b) initialXS = ai.thermalXS + env.epithermal_reduction_factor*ai.resonance # Column I: reaction # ai.reaction # Column J: fast? # ai.fast # Column K: effective reaction flux (n/cm^2/s) flux = env.fluence/env.fast_ratio if ai.fast else env.fluence # Column L: root part of activation calculation # Decay correction portion done in column M # The given mass is sample mass * sample fraction * isotope abundance root = flux * initialXS * 1e-24 * mass / isotope.isotope * 1.6278e19 # Column M: 0.69/t1/2 (1/h) lambda of produced nuclide lam = LN2/ai.Thalf_hrs #print(ai.thermalXS, ai.resonance, env.epithermal_reduction_factor) #print(isotope, "D", mass, "F", ai.daughter, "G", ai.Thalf_str, # "H", initialXS, "I", ai.reaction, "J", ai.fast, "K", flux, # "L", root, "M", lam) # Column Y: activity at the end of irradiation (uCi) if ai.reaction == 'b': # Column N: 0.69/t1/2 (1/h) lambda of parent nuclide parent_lam = LN2 / ai.Thalf_parent # Column O: Activation if "b" mode production # Note: problems resulting from precision limitiation not addredd in "b" # mode production activity = root*(1 - exp(-lam*exposure)/(1 - (lam/parent_lam)) + exp(-parent_lam*exposure)/((parent_lam/lam)-1)) #print "N", parent_lam, "O", activity elif ai.reaction == '2n': # Column N: 0.69/t1/2 (1/h) lambda of parent nuclide parent_lam = LN2 / ai.Thalf_parent # Column P: effective cross-section 2n product and n, g burnup (b) # Note: This cross-section always uses the total thermal flux effectiveXS = ai.thermalXS_parent + env.epithermal_reduction_factor*ai.resonance_parent # Column Q: 2n mode effective lambda of stable target (1/h) lam_2n = flux*initialXS*1e-24*3600 # Column R: radioactive parent (1/h) parent_activity = env.fluence*1e-24*3600*effectiveXS+parent_lam # Column S: resulting product (1/h) product_2n = lam if ai.reaction == '2n' else 0 # Column T: activity if 2n mode activity = root*lam*(parent_activity-parent_lam)*( exp(-lam_2n*exposure) / ((parent_activity-lam_2n)*(product_2n-lam_2n)) + exp(-parent_activity*exposure) / ((lam_2n-parent_activity)*(product_2n-parent_activity)) + exp(-product_2n*exposure) / ((lam_2n-product_2n)*(parent_activity-product_2n)) ) #print("N", parent_lam, "P", effectiveXS, "Q", lam_2n, # "R", parent_activity, "S", product_2n, "T", activity) else: # Provide the fix for the limitied precision (15 digits) in the # floating point calculation. For neutron fluence rates above # 1e16 the precision in certain cells needs to be improved to # avoid erroneous results. Also, burnup for single capture # reactions (excluding 'b') is included here. # See README file for details. # Column P: effective cross-section 2n product and n, g burnup (b) # Note: This cross-section always uses the total thermal flux effectiveXS = ai.thermalXS_parent + env.epithermal_reduction_factor*ai.resonance_parent # Column U: nv1s1t U = flux*initialXS*3600*1e-24*exposure # Column V: nv2s2t+L2*t V = (env.fluence*effectiveXS*3600*1e-24+lam)*exposure # Column W: L/(L-nvs1+nvs2) W = lam/(lam-flux*initialXS*3600*1e-24+env.fluence*effectiveXS*3600*1e-24) # Column X: V#*[e(-S#)-e(U#)] if abs(U) < 1e-10 and abs(V) < 1e-10: precision_correction = W * (V-U+(V+U)/2) else: precision_correction = W * (exp(-U)-exp(-V)) activity = root*precision_correction #print(ai.thermalXS_parent, ai.resonance_parent, exposure) #print("P", effectiveXS, "U", U, "V", V, "W", W, "X", # precision_correction, "Y", activity) # columns: F32 H K L U V W X #data = env.fluence, initialXS, flux, root, U, V, W, precision_correction #print " ".join("%.5e"%v for v in data) result[ai] = [activity*exp(-lam*Ti) for Ti in rest_times] #print [(Ti, Ai) for Ti, Ai in zip(rest_times, result[ai])] return result def init(table, reload=False): """ Add neutron activation levels to each isotope. """ if 'neutron_activation' in table.properties and not reload: return table.properties.append('neutron_activation') # Clear the existing activation table for el in table: for iso in el.isotopes: if hasattr(el[iso], 'neutron_activation'): del el[iso].neutron_activation path = os.path.join(core.get_data_path('.'), 'activation.dat') lastA = 0 for row in open(path, 'r'): columns = row.split('\t') if columns[0].strip() in ('', 'xx'): continue columns = [c[1:-1] if c.startswith('"') else c for c in columns] #print columns for c in INT_COLUMNS: columns[c] = int(columns[c]) for c in BOOL_COLUMNS: columns[c] = (columns[c] == 'y') for c in FLOAT_COLUMNS: columns[c] = float(columns[c]) if columns[c].strip() else 0. # clean up comment column columns[-1] = columns[-1].replace('"', '').strip() kw = dict(zip(COLUMN_NAMES, columns)) kw['Thalf_str'] = " ".join((kw['_Thalf'], kw['_Thalf_unit'])) # Strip columns whose names start with underscore kw = dict((k, v) for k, v in kw.items() if not k.startswith('_')) # Create an Activation record and add it to the isotope iso = table[kw['Z']][kw['A']] activation = getattr(iso, 'neutron_activation', []) activation.append(ActivationResult(**kw)) iso.neutron_activation = activation # Check abundance values #if abs(iso.abundance - kw['abundance']) > 0.001*kw['abundance']: # percent = 100*abs(iso.abundance - kw['abundance'])/kw['abundance'] # print "Abundance of", iso, "is", iso.abundance, \ # "but activation.dat has", kw['abundance'], "(%.1f%%)"%percent class ActivationResult(object): def __init__(self, **kw): self.__dict__ = kw def demo(): # pragma: nocover import sys formula = sys.argv[1] fluence = 1e5 exposure = 10 env = ActivationEnvironment(fluence=fluence, Cd_ratio=70, fast_ratio=50, location="BT-2") sample = Sample(formula, 1) sample.calculate_activation( env, exposure=exposure, rest_times=(0, 1, 24, 360), abundance=IAEA1987_isotopic_abundance, #abundance=NIST2001_isotopic_abundance, ) print("1g %s for %g hours at %g n/cm^2/s"%(formula, exposure, fluence)) sample.show_table(cutoff=0.0) ## Print a table of flux vs. activity so we can debug the ## precision_correction value in the activity() function. ## Note that you also need to uncomment the print statement ## at the end of activity() that shows the column values. #import numpy as np #sample = Sample('Co', mass=10) #for fluence in np.logspace(3, 20, 20-3+1): # env = ActivationEnvironment(fluence=fluence) # sample.calculate_activation( # env, exposure=exposure, rest_times=[0], # abundance=IAEA1987_isotopic_abundance) if __name__ == "__main__": demo() # pragma: nocover periodictable-1.5.0/periodictable/chemicals.py000066400000000000000000000100501310514471200214250ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ ***Not implemented*** Chemical Class following the structure of Template::chembox new from wikipedia. The basic properties are * IUCname - standard name * CASid - standard identifier * all_names - other names * formula - chemical formula string A variety of numeric properties may be available such as * density - usual density * boiling_point - boiling temperature Numeric properties are rich structures with a number of fields * value: median property value * variance: range of values for the property (1-sigma) * units: SI units for property (string, eg |g/cm^3|) * notes: caveats on value to present to user (e.g., temperature or pressure for the measurement) * reference: source of data * value_as('units'): value in particular units * variance_as('units'): variance in particular units lookup(chemical, properties=['formula', 'density']) Return information for the named chemical or formula, or *None* if the chemical is not found. This command will search for the chemical in all available sources, including a number of proprietary sources if online access is available from the current IP address. This search is repeated for all desired properties. wikipedia(chemical) Look up a chemical in wikipedia. Returns a list of chemicals which match. Wikipedia provides information on 6000+ chemicals. Though it is not necessarily complete or accurate, it is freely available. This package will include a copy of the chemical information from the latest wikipedia database at the time of release. Properties available are density, melting_point, boiling_point, chemical_formula, CAS_id, and more. The initial version extracts only chemical_formula and density. wikipedia is an instance of ChemicalDatabase (see below), so it has methods for returning sorted lists of selected chemicals. The file is opened readonly for normal usage. personal(chemical) Lookup a chemical in the personal database. Returns a list of chemicals which match. The personal list is stored as a database in the user configuration directory. Chemicals found in other sources can be added as they are used, and entirely new entries can be created. Databases can be merged, allowing sharing between groups and between machines. crc(chemical) [Not implemented] Search CRC online for the chemical information. This returns a set of matching chemicals. While not an instance of ChemicalDatabase, as much as possible it follows the same interface. This resource is only available from institutions which have purchased a license to the CRC online database. [Not implemented] Interfaces to other databases may be provided depending on demand and resources. register(source, rank=0) Add a new source to the chemical lookup function. The source should be a class which follows the ChemicalDatabase interface as closely as possible. The source should have a properties attribute indicating which properties are available. When called with a chemical name, the source should return an object with attributes for the available properties. One of the attributes of ChemicalDatabase is a rank from 0-10, with 0 being the lowest. The rank determines the order in which the sources are searched. Within a rank, sources are chosen arbitrarily. The search will stop when the required information is found. ChemicalDatabase(filename, mode=['update'|'read']) A private list of chemicals associated with each user. This class supports a dictionary interface, with multiple keys per record and with an additional iterator methods for traversing sorted subsets of the database. The values stored in the table are of class Chemical. This list will be stored in a SQLite database, which is accessible from C and other languages. """ periodictable-1.5.0/periodictable/constants.py000066400000000000000000000015261310514471200215210ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ Various fundamental constants. """ #: Avogadro's number (mol^-1) avogadro_number = 6.02214179e23 #(30) mol^-1 #: Planck's constant (eV s) plancks_constant = 4.13566733e-15 #(10) eV s #: Electron volt (J/eV) electron_volt = 1.602176487e-19 #(40) J / eV #: speed of light c (m/s) speed_of_light = 299792458 # m/s (exact) #: electron radius r_e (m) electron_radius = 2.8179402894e-15 #(58) m # From NIST Reference on Constants, Units, and Uncertainty # http://physics.nist.gov/cuu/index.html # neutron mass = 1.008 664 915 97(43) u # atomic mass constant m_u = 1.660 538 782(83) x 10-27 kg #: neutron mass (u) neutron_mass = 1.00866491597 #(43) u #: atomic mass constant (kg / u) atomic_mass_constant = 1.660538782e-27 #(83) kg / u #: electron mass (u) electron_mass = 5.48577990946e-4 #(22) u periodictable-1.5.0/periodictable/core.py000066400000000000000000000712611310514471200204400ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ Core classes for the periodic table. * :class:`PeriodicTable` The periodic table with attributes for each element. .. Note:: PeriodicTable is not a singleton class. Use ``periodictable.element`` to access the common table. * :class:`Element` Element properties such as name, symbol, mass, density, etc. * :class:`Isotope` Isotope properties such as mass, density and neutron scattering factors. * :class:`Ion` Ion properties such as charge. Elements are accessed from a periodic table using ``table[number]``, ``table.name`` or ``table.symbol`` where *symbol* is the two letter symbol. Individual isotopes are accessed using ``element[isotope]``. Individual ions are references using ``element.ion[charge]``. Note that ``element[isotope].ion[charge].mass`` will depend on the particular charge since we subtract the charge times the rest mass of the electron from the overall mass. Helper functions: * :func:`delayed_load` Delay loading the element attributes until they are needed. * :func:`get_data_path` Return the path to the periodic table data files. * :func:`define_elements` Define external variables for each element in namespace. * :func:`isatom`, :func:`iselement`, :func:`isisotope`, :func:`ision` Tests for different types of structure components. * :func:`default_table` Returns the common periodic table. * :func:`change_table` Return the same item from a different table. .. seealso:: :ref:`Adding properties ` for details on extending the periodic table with your own attributes. :ref:`Custom tables ` for details on managing your own periodic table with custom values for the attributes. """ from __future__ import print_function __docformat__ = 'restructuredtext en' __all__ = ['delayed_load', 'define_elements', 'get_data_path', 'default_table', 'change_table', 'Ion', 'Isotope', 'Element', 'PeriodicTable', 'isatom', 'iselement', 'isisotope', 'ision'] import copy from . import constants PUBLIC_TABLE_NAME = "public" def delayed_load(all_props, loader, element=True, isotope=False, ion=False): """ Delayed loading of an element property table. When any of property is first accessed the loader will be called to load the associated data. The help string starts out as the help string for the loader function. The attribute may be associated with any of :class:`Isotope`, :class:`Ion`, or :class:`Element`. Some properties, such as :mod:`mass `, have both an isotope property for the mass of specific isotopes, as well as an element property for the mass of the collection of isotopes at natural abundance. Set the keyword flags *element*, *isotope* and/or *ion* to specify which of these classes will be assigned specific information on load. """ def clearprops(): """ Remove the properties so that the attribute can be accessed directly. """ if element: for p in all_props: delattr(Element, p) if isotope: for p in all_props: delattr(Isotope, p) if ion: for p in all_props: delattr(Ion, p) def getter(propname): """ Property getter for attribute propname. The first time the prop is accessed, the prop itself will be deleted and the data loader for the property will be called to set the real values. Subsequent references to the property will be to the actual data. """ def getfn(el): #print "get", el, propname clearprops() loader() return getattr(el, propname) return getfn def setter(propname): """ Property setter for attribute propname. This function is assumed to be called when the data loader for the attribute is called before the property is referenced (for example, if somebody imports periodictable.xsf before referencing Ni.xray). In this case, we simply need to clear the delayed load property and let the loader set the values as usual. If the user tries to override a value in the table before first referencing the table, then the above assumption is false. E.g., "Ni.K_alpha=5" followed by "print Cu.K_alpha" will yield an undefined Cu.K_alpha. This will be difficult for future users to debug. """ def setfn(el, value): #print "set", el, propname, value clearprops() setattr(el, propname, value) return setfn if element: for p in all_props: prop = property(getter(p), setter(p), doc=loader.__doc__) setattr(Element, p, prop) if isotope: for p in all_props: prop = property(getter(p), setter(p), doc=loader.__doc__) setattr(Isotope, p, prop) if ion: for p in all_props: prop = property(getter(p), setter(p), doc=loader.__doc__) setattr(Ion, p, prop) # Define the element names from the element table. class PeriodicTable(object): """ Defines the periodic table of the elements with isotopes. Individidual elements are accessed by name, symbol or atomic number. Individual isotopes are addressable by ``element[mass_number]`` or ``elements.isotope(element name)``, ``elements.isotope(element symbol)``. For example, the following all retrieve iron: .. doctest:: >>> from periodictable import * >>> print(elements[26]) Fe >>> print(elements.Fe) Fe >>> print(elements.symbol('Fe')) Fe >>> print(elements.name('iron')) Fe >>> print(elements.isotope('Fe')) Fe To get iron-56, use: .. doctest:: >>> print(elements[26][56]) 56-Fe >>> print(elements.Fe[56]) 56-Fe >>> print(elements.isotope('56-Fe')) 56-Fe Deuterium and tritium are defined as 'D' and 'T'. Some neutron properties are available in ``elements[0]``. To show all the elements in the table, use the iterator: .. doctest:: >>> from periodictable import * >>> for el in elements: # lists the element symbols ... print("%s %s"%(el.symbol, el.name)) # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE n neutron H hydrogen He helium ... Og oganesson .. Note:: Properties can be added to the elements as needed, including *mass*, *nuclear* and *X-ray* scattering cross sections. See section :ref:`Adding properties ` for details. """ def __init__(self, table): if table in PRIVATE_TABLES: raise ValueError("Periodic table '%s' is already defined"%table) PRIVATE_TABLES[table] = self self.properties = [] self._element = {} for Z, (name, symbol, ions, uncommon_ions) in element_base.items(): element = Element(name=name.lower(), symbol=symbol, Z=Z, ions=tuple(sorted(ions+uncommon_ions)), table=table) self._element[element.number] = element setattr(self, symbol, element) # There are two specially named isotopes D and T self.D = self.H.add_isotope(2) self.D.name = 'deuterium' self.D.symbol = 'D' self.T = self.H.add_isotope(3) self.T.name = 'tritium' self.T.symbol = 'T' def __getitem__(self, Z): """ Retrieve element Z. """ return self._element[Z] def __iter__(self): """ Process the elements in Z order """ for _, el in sorted(self._element.items()): yield el def symbol(self, input): """ Lookup the an element in the periodic table using its symbol. Symbols are included for 'D' and 'T', deuterium and tritium. :Parameters: *input* : string Element symbol to be looked up in periodictable. :Returns: Element :Raises: ValueError if the element symbol is not defined. For example, print the element corresponding to 'Fe': .. doctest:: >>> import periodictable >>> print(periodictable.elements.symbol('Fe')) Fe """ if hasattr(self, input): value = getattr(self, input) if isinstance(value, (Element, Isotope)): return value raise ValueError("unknown element "+input) def name(self, input): """ Lookup an element given its name. :Parameters: *input* : string Element name to be looked up in periodictable. :Returns: Element :Raises: *ValueError* if element does not exist. For example, print the element corresponding to 'iron': .. doctest:: >>> import periodictable >>> print(periodictable.elements.name('iron')) Fe """ for el in self: if input == el.name: return el if input == self.D.name: return self.D if input == self.T.name: return self.T raise ValueError("unknown element "+input) def isotope(self, input): """ Lookup the element or isotope in the periodic table. Elements are assumed to be given by the standard element symbols. Isotopes are given by number-symbol, or 'D' and 'T' for 2-H and 3-H. :Parameters: *input* : string Element name or isotope to be looked up in periodictable. :Returns: Element :Raises: *ValueError* if element or isotope is not defined. For example, print the element corresponding to '58-Ni'. .. doctest:: >>> import periodictable >>> print(periodictable.elements.isotope('58-Ni')) 58-Ni """ # Parse #-Sym or Sym # If # is not an integer, set isotope to -1 so that the isotope # lookup will fail later. parts = input.split('-') if len(parts) == 1: isotope = 0 symbol = parts[0] elif len(parts) == 2: try: isotope = int(parts[0]) except Exception: isotope = -1 symbol = parts[1] else: symbol = '' isotope = -1 # All elements are attributes of the table # Check that the attribute is an Element or an Isotope (for D or T) # If it is an element, check that the isotope exists if hasattr(self, symbol): attr = getattr(self, symbol) if isinstance(attr, Element): # If no isotope, return the element if isotope == 0: return attr # If isotope, check that it is valid if isotope in attr.isotopes: return attr[isotope] elif isinstance(attr, Isotope): # D, T must not have an associated isotope; 4-D is meaningless. if isotope == 0: return attr # If we can't parse the string as an element or isotope, raise an error raise ValueError("unknown element "+input) def list(self, *props, **kw): """ Print a list of elements with the given set of properties. :Parameters: *prop1*, *prop2*, ... : string Name of the properties to print *format*: string Template for displaying the element properties, with one % for each property. :Returns: None For example, print a table of mass and density. .. doctest:: >>> from periodictable import elements >>> elements.list('symbol', 'mass', 'density', ... format="%-2s: %6.2f u %5.2f g/cm^3") # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE H : 1.01 u 0.07 g/cm^3 He: 4.00 u 0.12 g/cm^3 Li: 6.94 u 0.53 g/cm^3 ... Bk: 247.00 u 14.00 g/cm^3 """ #TODO: override signature in sphinx with # .. method:: list(prop1, prop2, ..., format='') format = kw.pop('format', None) assert len(kw) == 0 for el in self: try: L = tuple(getattr(el, p) for p in props) except AttributeError: # Skip elements which don't define all the attributes continue # Skip elements with a value of None if any(v == None for v in L): continue if format is None: print(" ".join(str(p) for p in L)) else: #try: print(format%L) #except: # print "format", format, "args", L # raise class IonSet(object): def __init__(self, element_or_isotope): self.element_or_isotope = element_or_isotope self.ionset = {} def __getitem__(self, charge): if charge not in self.ionset: if charge not in self.element_or_isotope.ions: raise ValueError("%(charge)d is not a valid charge for %(symbol)s" % dict(charge=charge, symbol=self.element_or_isotope.symbol)) self.ionset[charge] = Ion(self.element_or_isotope, charge) return self.ionset[charge] class Ion(object): """Periodic table entry for an individual ion. An ion is associated with an element. In addition to the element properties (*symbol*, *name*, *atomic number*), it has specific ion properties (*charge*). Properties not specific to the ion (i.e., *charge*) are retrieved from the associated element. """ def __init__(self, element, charge): self.element = element self.charge = charge def __getattr__(self, attr): return getattr(self.element, attr) @property def mass(self): return getattr(self.element, 'mass') - constants.electron_mass*self.charge def __str__(self): sign = '+' if self.charge > 0 else '-' value = '%d'%abs(self.charge) if abs(self.charge) > 1 else '' charge_str = '{'+value+sign+'}' if self.charge != 0 else '' return str(self.element)+charge_str def __repr__(self): return repr(self.element)+'.ion[%d]'%self.charge def __reduce__(self): try: return _make_isotope_ion, (self.element.table, self.element.number, self.element.isotope, self.charge) except: return _make_ion, (self.element.table, self.element.number, self.charge) class Isotope(object): """Periodic table entry for an individual isotope. An isotope is associated with an element. In addition to the element properties (*symbol*, *name*, *atomic number*), it has specific isotope properties (*isotope number*, *nuclear spin*, *relative abundance*). Properties not specific to the isotope (e.g., *x-ray scattering factors*) are retrieved from the associated element. """ def __init__(self, element, isotope_number): self.element = element self.isotope = isotope_number self.ion = IonSet(self) def __getattr__(self, attr): return getattr(self.element, attr) def __str__(self): # Deuterium and Tritium are special if 'symbol' in self.__dict__: return self.symbol else: return "%d-%s"%(self.isotope, self.element.symbol) def __repr__(self): return "%s[%d]"%(self.element.symbol, self.isotope) def __reduce__(self): return _make_isotope, (self.element.table, self.element.number, self.isotope) class Element(object): """Periodic table entry for an element. An element is a name, symbol and number, plus a set of properties. Individual isotopes can be referenced as element[*isotope_number*]. Individual ionization states can be referenced by element.ion[*charge*]. """ table = PUBLIC_TABLE_NAME charge = 0 def __init__(self, name, symbol, Z, ions, table): self.name = name self.symbol = symbol self.number = Z self._isotopes = {} # The actual isotopes self.ions = ions self.ion = IonSet(self) # Remember the table name for pickle dump/load if table != self.table: self.table = table @property def isotopes(self): """List of all isotopes""" # Note: may want to return the iterator rather than the list... return list(sorted(self._isotopes.keys())) def add_isotope(self, number): """ Add an isotope for the element. :Parameters: *number* : integer Isotope number, which is the number protons plus neutrons. :Returns: None """ if number not in self._isotopes: self._isotopes[number] = Isotope(self, number) return self._isotopes[number] def __getitem__(self, number): try: return self._isotopes[number] except KeyError: raise KeyError("%s is not an isotope of %s"%(number, self.symbol)) def __iter__(self): """ Process the isotopes in order """ for _, iso in sorted(self._isotopes.items()): yield iso # Note: using repr rather than str for the element symbol so # that lists of elements print nicely. Since elements are # effectively singletons, the symbol name is the representation # of the instance. def __repr__(self): return self.symbol def __reduce__(self): return _make_element, (self.table, self.number) def isatom(val): """Return true if value is an element, isotope or ion""" return isinstance(val, (Element, Isotope, Ion)) def isisotope(val): """Return true if value is an isotope or isotope ion.""" if ision(val): val = val.element return isinstance(val, Isotope) def ision(val): """Return true if value is a specific ion of an element or isotope""" return isinstance(val, Ion) def iselement(val): """Return true if value is an element or ion in natural abundance""" if ision(val): val = val.element return isinstance(val, Element) def change_table(atom, table): """Search for the same element, isotope or ion from a different table""" if ision(atom): if isisotope(atom): return table[atom.number][atom.isotope].ion[atom.charge] else: return table[atom.number].ion[atom.charge] else: if isisotope(atom): return table[atom.number][atom.isotope] else: return table[atom.number] PRIVATE_TABLES = {} def _get_table(name): try: return PRIVATE_TABLES[name] except KeyError: raise ValueError("Periodic table '%s' is not initialized"%name) def _make_element(table, Z): return _get_table(table)[Z] def _make_isotope(table, Z, n): return _get_table(table)[Z][n] def _make_ion(table, Z, c): return _get_table(table)[Z].ion[c] def _make_isotope_ion(table, Z, n, c): return _get_table(table)[Z][n].ion[c] # pylint: disable=bad-whitespace element_base = { # number: name symbol common_ions uncommon_ions # ion info comes from Wikipedia: list of oxidation states of the elements. 0: ['Neutron', 'n', [], []], 1: ['Hydrogen', 'H', [-1, 1], []], 2: ['Helium', 'He', [], [1, 2]], # +1,+2 http://periodic.lanl.gov/2.shtml 3: ['Lithium', 'Li', [1], []], 4: ['Beryllium', 'Be', [2], [1]], 5: ['Boron', 'B', [3], [-5, -1, 1, 2]], 6: ['Carbon', 'C', [-4, -3, -2, -1, 1, 2, 3, 4], []], 7: ['Nitrogen', 'N', [-3, 3, 5], [-2, -1, 1, 2, 4]], 8: ['Oxygen', 'O', [-2], [-1, 1, 2]], 9: ['Fluorine', 'F', [-1], []], 10: ['Neon', 'Ne', [], []], 11: ['Sodium', 'Na', [1], [-1]], 12: ['Magnesium', 'Mg', [2], [1]], 13: ['Aluminum', 'Al', [3], [-2, -1, 1, 2]], 14: ['Silicon', 'Si', [-4, 4], [-3, -2, -1, 1, 2, 3]], 15: ['Phosphorus', 'P', [-3, 3, 5], [-2, -1, 1, 2, 4]], 16: ['Sulfur', 'S', [-2, 2, 4, 6], [-1, 1, 3, 5]], 17: ['Chlorine', 'Cl', [-1, 1, 3, 5, 7], [2, 4, 6]], 18: ['Argon', 'Ar', [], []], 19: ['Potassium', 'K', [1], [-1]], 20: ['Calcium', 'Ca', [2], [1]], 21: ['Scandium', 'Sc', [3], [1, 2]], 22: ['Titanium', 'Ti', [4], [-2, -1, 1, 2, 3]], 23: ['Vanadium', 'V', [5], [-3, -1, 1, 2, 3, 4]], 24: ['Chromium', 'Cr', [3, 6], [-4, -2, -1, 1, 2, 4, 5]], 25: ['Manganese', 'Mn', [2, 4, 7], [-3, -2, -1, 1, 3, 5, 6]], 26: ['Iron', 'Fe', [2, 3, 6], [-4, -2, -1, 1, 4, 5, 7]], 27: ['Cobalt', 'Co', [2, 3], [-3, -1, 1, 4, 5]], 28: ['Nickel', 'Ni', [2], [-2, -1, 1, 3, 4]], 29: ['Copper', 'Cu', [2], [-2, 1, 3, 4]], 30: ['Zinc', 'Zn', [2], [-2, 1]], 31: ['Gallium', 'Ga', [3], [-5, -4, -2, -1, 1, 2]], 32: ['Germanium', 'Ge', [-4, 2, 4], [-3, -2, -1, 1, 3]], 33: ['Arsenic', 'As', [-3, 3, 5], [-2, -1, 1, 2, 4]], 34: ['Selenium', 'Se', [-2, 2, 4, 6], [-1, 1, 3, 5]], 35: ['Bromine', 'Br', [-1, 1, 3, 5], [4, 7]], 36: ['Krypton', 'Kr', [2], []], 37: ['Rubidium', 'Rb', [1], [-1]], 38: ['Strontium', 'Sr', [2], [1]], 39: ['Yttrium', 'Y', [3], [1, 2]], 40: ['Zirconium', 'Zr', [4], [-2, 1, 2, 3]], 41: ['Niobium', 'Nb', [5], [-3, -1, 1, 2, 3, 4]], 42: ['Molybdenum', 'Mo', [4, 6], [-4, -2, -1, 1, 2, 3, 5]], 43: ['Technetium', 'Tc', [4, 7], [-3, -1, 1, 2, 3, 5, 6]], 44: ['Ruthenium', 'Ru', [3, 4], [-4, -2, 1, 2, 5, 6, 7, 8]], 45: ['Rhodium', 'Rh', [3], [-3, -1, 1, 2, 4, 5, 6]], 46: ['Palladium', 'Pd', [2, 4], [1, 3, 5, 6]], 47: ['Silver', 'Ag', [1], [-2, -1, 2, 3, 4]], 48: ['Cadmium', 'Cd', [2], [-2, 1]], 49: ['Indium', 'In', [3], [-5, -2, -1, 1, 2]], 50: ['Tin', 'Sn', [-4, 2, 4], [-3, -2, -1, 1, 3]], 51: ['Antimony', 'Sb', [-3, 3, 5], [-2, -1, 1, 2, 4]], 52: ['Tellurium', 'Te', [-2, 2, 4, 6], [-1, 1, 3, 5]], 53: ['Iodine', 'I', [-1, 1, 3, 5, 7], [4, 6]], 54: ['Xenon', 'Xe', [2, 4, 6], [8]], 55: ['Cesium', 'Cs', [1], [-1]], 56: ['Barium', 'Ba', [2], [1]], 57: ['Lanthanum', 'La', [3], [1, 2]], 58: ['Cerium', 'Ce', [3, 4], [2]], 59: ['Praseodymium', 'Pr', [3], [2, 4, 5]], 60: ['Neodymium', 'Nd', [3], [2, 4]], 61: ['Promethium', 'Pm', [3], [2]], 62: ['Samarium', 'Sm', [3], [2]], 63: ['Europium', 'Eu', [2, 3], []], 64: ['Gadolinium', 'Gd', [3], [1, 2]], 65: ['Terbium', 'Tb', [3], [1, 2, 4]], 66: ['Dysprosium', 'Dy', [3], [2, 4]], 67: ['Holmium', 'Ho', [3], [2]], 68: ['Erbium', 'Er', [3], [2]], 69: ['Thulium', 'Tm', [3], [2]], 70: ['Ytterbium', 'Yb', [3], [2]], 71: ['Lutetium', 'Lu', [3], [2]], 72: ['Hafnium', 'Hf', [4], [-2, 1, 2, 3]], 73: ['Tantalum', 'Ta', [5], [-3, -1, 1, 2, 3, 4]], 74: ['Tungsten', 'W', [4, 6], [-4, -2, -1, 1, 2, 3, 5]], 75: ['Rhenium', 'Re', [4], [-3, -1, 1, 2, 3, 5, 6, 7]], 76: ['Osmium', 'Os', [4], [-4, -2, -1, 1, 2, 3, 5, 6, 7, 8]], 77: ['Iridium', 'Ir', [3, 4], [-3, -1, 1, 2, 5, 6, 7, 8, 9]], 78: ['Platinum', 'Pt', [2, 4], [-3, -2, -1, 1, 3, 5, 6]], 79: ['Gold', 'Au', [3], [-3, -2, -1, 1, 2, 5]], 80: ['Mercury', 'Hg', [1, 2], [-2, 4]], # +4 doi:10.1002/anie.200703710 81: ['Thallium', 'Tl', [1, 3], [-5, -2, -1, 2]], 82: ['Lead', 'Pb', [2, 4], [-4, -2, -1, 1, 3]], 83: ['Bismuth', 'Bi', [3], [-3, -2, -1, 1, 2, 4, 5]], 84: ['Polonium', 'Po', [-2, 2, 4], [5, 6]], 85: ['Astatine', 'At', [-1, 1], [3, 5, 7]], 86: ['Radon', 'Rn', [2], [6]], 87: ['Francium', 'Fr', [1], []], 88: ['Radium', 'Ra', [2], []], 89: ['Actinium', 'Ac', [3], []], 90: ['Thorium', 'Th', [4], [1, 2, 3]], 91: ['Protactinium', 'Pa', [5], [3, 4]], 92: ['Uranium', 'U', [6], [1, 2, 3, 4, 5]], 93: ['Neptunium', 'Np', [5], [2, 3, 4, 6, 7]], 94: ['Plutonium', 'Pu', [4], [2, 3, 5, 6, 7]], 95: ['Americium', 'Am', [3], [2, 4, 5, 6, 7]], 96: ['Curium', 'Cm', [3], [4, 6]], 97: ['Berkelium', 'Bk', [3], [4]], 98: ['Californium', 'Cf', [3], [2, 4]], 99: ['Einsteinium', 'Es', [3], [2, 4]], 100: ['Fermium', 'Fm', [3], [2]], 101: ['Mendelevium', 'Md', [3], [2]], 102: ['Nobelium', 'No', [2], [3]], 103: ['Lawrencium', 'Lr', [3], []], 104: ['Rutherfordium', 'Rf', [4], []], 105: ['Dubnium', 'Db', [5], []], 106: ['Seaborgium', 'Sg', [6], []], 107: ['Bohrium', 'Bh', [7], []], 108: ['Hassium', 'Hs', [8], []], 109: ['Meitnerium', 'Mt', [], []], 110: ['Darmstadtium', 'Ds', [], []], 111: ['Roentgenium', 'Rg', [], []], 112: ['Copernicium', 'Cn', [2], []], 113: ['Nihonium', 'Nh', [], []], 114: ['Flerovium', 'Fl', [], []], 115: ['Moscovium', 'Mc', [], []], 116: ['Livermorium', 'Lv', [], []], 117: ['Tennessine', 'Ts', [], []], 118: ['Oganesson', 'Og', [], []], } # pylint: enable=bad-whitespace def default_table(table=None): """ Return the default table unless a specific table has been requested. This is to be used in a context like:: def summary(table=None): table = core.default_table(table) ... """ return table if table is not None else PUBLIC_TABLE def define_elements(table, namespace): """ Define external variables for each element in namespace. Elements are defined both by name and by symbol. This is called from *__init__* as:: elements = core.default_table() __all__ += core.define_elements(elements, globals()) :Parameters: *table* : PeriodicTable Set of elements *namespace* : dict Namespace in which to add the symbols. :Returns: [string, ...] A sequence listing the names defined. .. Note:: This will only work for *namespace* globals(), not locals()! """ # Build the dictionary of element symbols names = {} for el in table: names[el.symbol] = el names[el.name] = el for el in [table.D, table.T]: names[el.symbol] = el names[el.name] = el # Copy it to the namespace for k, v in names.items(): namespace[k] = v # return the keys return list(names.keys()) def get_data_path(data): """ Locate the directory for the tables for the named extension. :Parameters: *data* : string Name of the extension data directory. For example, the xsf extension has data in the 'xsf' data directory. :Returns: string Path to the data. """ import os, sys # Check for data path in the environment key = 'PERIODICTABLE_DATA' if key in os.environ: path = os.path.join(os.environ[key], data) if not os.path.isdir(path): raise RuntimeError('Path in environment %s not a directory'%key) return path # Check for data path in the package path = os.path.join(os.path.dirname(__file__), data) if os.path.isdir(path): return path # Check for data path next to exe/zip file. exepath = os.path.dirname(sys.executable) path = os.path.join(exepath, 'periodictable-data', data) if os.path.isdir(path): return path # py2app puts the data in Contents/Resources, but the executable # is in Contents/MacOS. path = os.path.join(exepath, '..', 'Resources', 'periodictable-data', data) if os.path.isdir(path): return path raise RuntimeError('Could not find the periodic table data files') # Make a common copy of the table for everyone to use --- equivalent to # a singleton without incurring any complexity. PUBLIC_TABLE = PeriodicTable(PUBLIC_TABLE_NAME) periodictable-1.5.0/periodictable/covalent_radius.py000066400000000000000000000302771310514471200226740ustar00rootroot00000000000000# -*- coding: latin-1 -*- # This program is in the public domain # Author: Paul Kienzle """ This module adds the following fields to the periodic table * covalent_radius * covalent_radius_uncertainty * covalent_radius_units = 'angstrom' Use :func:`init` to initialize a private table. Data is taken from Cordero et al., 2008 [#Cordero2008]_. Bond specific values (single, double, or triple) are available from Pyykkö et al., 2009 [#Pyykko2009]_, but they are generally smaller. The CRC Handbook uses the average of Cordero and Pyykkö. Note that the combined Cordero/Pyykkö tables are included herein as *periodictable.covalent_radius.CorderoPyykko*, but are not yet parsed. The abstract of Cordero reads as follows: A new set of covalent atomic radii has been deduced from crystallographic data for most of the elements with atomic numbers up to 96. The proposed radii show a well behaved periodic dependence that allows us to interpolate a few radii for elements for which structural data is lacking, notably the noble gases. The proposed set of radii therefore fills most of the gaps and solves some inconsistencies in currently used covalent radii. The transition metal and lanthanide contractions as well as the differences in covalent atomic radii between low spin and high spin configurations in transition metals are illustrated by the proposed radii set. .. Note:: #. Values are averages only. The particular radius can be highly dependent on oxidation state and chemical compound. #. The paper lists values for multiple spin states on select elements. We are using sp3 for carbon and low spin for manganese, iron and cobalt. #. Elements with zero or one measurements of covalent radius are assigned an uncertainty of 0.00. These are He, Ne, Pm, At, Rn, Fr, Ac, Pa. #. Elements above 96 are assigned a covalent radius and uncertainty of None. #. Radii are measured from bonds to C, N or O. The choice of which compound was used is element dependent. Details are available in the references. .. [#Cordero2008] Beatriz Cordero, Verónica Gómez, Ana E. Platero-Prats, Marc Revés, Jorge Echeverría, Eduard Cremades, Flavia Barragán and Santiago Alvarez. Covalent radii revisited. Dalton Trans., 2008, 2832-2838. `doi:10.1039/b801115j `_ .. [#Pyykko2009] P. Pyykkö and M. Atsumi. Molecular Double-Bond Covalent Radii for Elements Li-E112. Chemistry, A European Journal, 15, 2009, 12770-12779. `doi:10.1002/chem.200901472 `_ """ from .core import Element def init(table, reload=False): """ Add the covalent radius property to a private table. Use *reload = True* to replace the covalent radius property on an existing table. """ if 'covalent_radius' in table.properties and not reload: return table.properties.append('covalent_radius') table[0].covalent_radius = 0.20 Element.covalent_radius_units = 'angstrom' Element.covalent_radius = None Element.covalent_radius_uncertainty = None for line in Cordero.split('\n'): fields = line.split() if len(fields) == 3: fields += ['0', '0'] # Fill in uncertainties if fields[0] == '-': continue # Skip alternate spin states Z = int(fields[0]) el = fields[1] r = float(fields[2]) dr = float(fields[3])*0.01 n = int(fields[4]) table[Z].covalent_radius = r table[Z].covalent_radius_uncertainty = dr # Table of radii from Cordero. Note that in cases where there are # multiple spin states (C, Mn, Fe, Co) only the first spin state is used. # #Z, Symbol, radius(A), uncertainty (0.01A), number of measurements Cordero = """\ 1 H 0.31 5 129 2 He 0.28 3 Li 1.28 7 5789 4 Be 0.96 3 310 5 B 0.84 3 1770 6 Csp3 0.76 1 10000 - Csp2 0.73 2 10000 - Csp 0.69 1 171 7 N 0.71 1 2200 8 O 0.66 2 10000 9 F 0.57 3 10000 10 Ne 0.58 11 Na 1.66 9 1629 12 Mg 1.41 7 3234 13 Al 1.21 4 3206 14 Si 1.11 2 10000 15 P 1.07 3 10000 16 S 1.05 3 10000 17 Cl 1.02 4 1987 18 Ar 1.06 10 9 19 K 2.03 12 435 20 Ca 1.76 10 2647 21 Sc 1.70 7 32 22 Ti 1.60 8 231 23 V 1.53 8 389 24 Cr 1.39 5 916 25 Mnl.s. 1.39 5 321 - Mnh.s. 1.61 8 929 26 Fel.s. 1.32 3 336 - Feh.s. 1.52 6 1540 27 Col.s. 1.26 3 5733 - Coh.s. 1.50 7 780 28 Ni 1.24 4 1030 29 Cu 1.32 4 1149 30 Zn 1.22 4 443 31 Ga 1.22 3 1330 32 Ge 1.20 4 1013 33 As 1.19 4 2015 34 Se 1.20 4 1717 35 Br 1.20 3 2140 36 Kr 1.16 4 5 37 Rb 2.20 9 23 38 Sr 1.95 10 1500 39 Y 1.90 7 30 40 Zr 1.75 7 93 41 Nb 1.64 6 18 42 Mo 1.54 5 97 43 Tc 1.47 7 96 44 Ru 1.46 7 1032 45 Rh 1.42 7 458 46 Pd 1.39 6 1892 47 Ag 1.45 5 1728 48 Cd 1.44 9 19 49 In 1.42 5 546 50 Sn 1.39 4 2999 51 Sb 1.39 5 609 52 Te 1.38 4 692 53 I 1.39 3 451 54 Xe 1.40 9 2 55 Cs 2.44 11 24 56 Ba 2.15 11 3076 57 La 2.07 8 190 58 Ce 2.04 9 47 59 Pr 2.03 7 58 60 Nd 2.01 6 96 61 Pm 1.99 62 Sm 1.98 8 53 63 Eu 1.98 6 167 64 Gd 1.96 6 178 65 Tb 1.94 5 55 66 Dy 1.92 7 59 67 Ho 1.92 7 48 68 Er 1.89 6 66 69 Tm 1.90 10 15 70 Yb 1.87 8 122 71 Lu 1.87 8 61 72 Hf 1.75 10 53 73 Ta 1.70 8 88 74 W 1.62 7 219 75 Re 1.51 7 476 76 Os 1.44 4 99 77 Ir 1.41 6 131 78 Pt 1.36 5 1768 79 Au 1.36 6 114 80 Hg 1.32 5 137 81 Tl 1.45 7 291 82 Pb 1.46 5 112 83 Bi 1.48 4 51 84 Po 1.40 4 4 85 At 1.50 86 Rn 1.50 87 Fr 2.60 88 Ra 2.21 2 3 89 Ac 2.15 0 1 90 Th 2.06 6 11 91 Pa 2.00 0 1 92 U 1.96 7 57 93 Np 1.90 1 22 94 Pu 1.87 1 9 95 Am 1.80 6 11 96 Cm 1.69 3 16\ """ # Cordero/Pyykko combined table. # rC are the Cardero radii with uncertainty. # r# are the single/double/triple bonded Pyykko radii. # Entries starting with # are for specific species mentioned in Cardero. # The CRC tables are obtained by averaging Cordero rC and Pyykko r1. #Z Symbol rC(A) r1(A) r2(A) r3(A) CorderoPyykko = """\ 1 H 0.31(5) 0.32 2 He 0.28 0.46 3 Li 1.28(7) 1.33 1.24 4 Be 0.96(3) 1.02 0.90 0.85 5 B 0.84(3) 0.85 0.78 0.73 6 C 0.76(1) 0.75 0.67 0.60 #sp3: 0.76(1) #sp2: 0.73(2) #sp: 0.69(1) 7 N 0.71(1) 0.71 0.60 0.54 8 O 0.66(2) 0.63 0.57 0.53 9 F 0.57(3) 0.64 0.59 0.53 10 Ne 0.58 0.67 0.96 11 Na 1.66(9) 1.55 1.60 12 Mg 1.41(7) 1.39 1.32 1.27 13 Al 1.21(4) 1.26 1.13 1.11 14 Si 1.11(2) 1.16 1.07 1.02 15 P 1.07(3) 1.11 1.02 0.94 16 S 1.05(3) 1.03 0.94 0.95 17 Cl 1.02(4) 0.99 0.95 0.93 18 Ar 1.06(10) 0.96 1.07 0.96 19 K 2.03(12) 1.96 1.93 20 Ca 1.76(10) 1.71 1.47 1.33 21 Sc 1.70(7) 1.48 1.16 1.14 22 Ti 1.60(8) 1.36 1.17 1.08 23 V 1.53(8) 1.34 1.12 1.06 24 Cr 1.39(5) 1.22 1.11 1.03 25 Mn 1.39(5) 1.19 1.05 1.03 #low spin: 1.39(5) #high spin: 1.61(8) 26 Fe 1.32(3) 1.16 1.09 1.02 #low spin: 1.32(3) #high spin: 1.52(6) 27 Co 1.26(3) 1.11 1.03 0.96 #low spin: 1.26(3) #high spin: 1.50(7) 28 Ni 1.24(4) 1.10 1.01 1.01 29 Cu 1.32(4) 1.12 1.15 1.20 30 Zn 1.22(4) 1.18 1.20 31 Ga 1.22(3) 1.24 1.17 1.21 32 Ge 1.20(4) 1.21 1.11 1.14 33 As 1.19(4) 1.21 1.14 1.06 34 Se 1.20(4) 1.16 1.07 1.07 35 Br 1.20(3) 1.14 1.09 1.10 36 Kr 1.16(4) 1.17 1.21 1.08 37 Rb 2.20(9) 2.10 2.02 38 Sr 1.95(10) 1.85 1.57 1.39 39 Y 1.90(7) 1.63 1.30 1.24 40 Zr 1.75(7) 1.54 1.27 1.21 41 Nb 1.64(6) 1.47 1.25 1.16 42 Mo 1.54(5) 1.38 1.21 1.13 43 Tc 1.47(7) 1.28 1.20 1.10 44 Ru 1.46(7) 1.25 1.14 1.03 45 Rh 1.42(7) 1.25 1.10 1.06 46 Pd 1.39(6) 1.20 1.17 1.12 47 Ag 1.45(5) 1.28 1.39 1.37 48 Cd 1.44(9) 1.36 1.44 49 In 1.42(5) 1.42 1.36 1.46 50 Sn 1.39(4) 1.40 1.30 1.32 51 Sb 1.39(5) 1.40 1.33 1.27 52 Te 1.38(4) 1.36 1.28 1.21 53 I 1.39(3) 1.33 1.29 1.25 54 Xe 1.40(9) 1.31 1.35 1.22 55 Cs 2.44(11) 2.32 2.09 56 Ba 2.15(11) 1.96 1.61 1.49 57 La 2.07(8) 1.80 1.39 1.39 58 Ce 2.04(9) 1.63 1.37 1.31 59 Pr 2.03(7) 1.76 1.38 1.28 60 Nd 2.01(6) 1.74 1.37 61 Pm 1.99 1.73 1.35 62 Sm 1.98(8) 1.72 1.34 63 Eu 1.98(6) 1.68 1.34 64 Gd 1.96(6) 1.69 1.35 1.32 65 Tb 1.94(5) 1.68 1.35 66 Dy 1.92(7) 1.67 1.33 67 Ho 1.92(7) 1.66 1.33 68 Er 1.89(6) 1.65 1.33 69 Tm 1.90(10) 1.64 1.31 70 Yb 1.87(8) 1.70 1.29 71 Lu 1.87(8) 1.62 1.31 1.31 72 Hf 1.75(10) 1.52 1.28 1.22 73 Ta 1.70(8) 1.46 1.26 1.19 74 W 1.62(7) 1.37 1.20 1.15 75 Re 1.51(7) 1.31 1.19 1.10 76 Os 1.44(4) 1.29 1.16 1.09 77 Ir 1.41(6) 1.22 1.15 1.07 78 Pt 1.36(5) 1.23 1.12 1.10 79 Au 1.36(6) 1.24 1.21 1.23 80 Hg 1.32(5) 1.33 1.42 81 Tl 1.45(7) 1.44 1.42 1.50 82 Pb 1.46(5) 1.44 1.35 1.37 83 Bi 1.48(4) 1.51 1.41 1.35 84 Po 1.40(4) 1.45 1.35 1.29 85 At 1.50 1.47 1.38 1.38 86 Rn 1.50 1.42 1.45 1.33 87 Fr 2.60 2.23 2.18 88 Ra 2.21(2) 2.01 1.73 1.59 89 Ac 2.15 1.86 1.53 1.40 90 Th 2.06(6) 1.75 1.43 1.36 91 Pa 2.00 1.69 1.38 1.29 92 U 1.96(7) 1.70 1.34 1.18 93 Np 1.90(1) 1.71 1.36 1.16 94 Pu 1.87(1) 1.72 1.35 95 Am 1.80(6) 1.66 1.35 96 Cm 1.69(3) 1.66 1.36 97 Bk - 1.66 1.39 98 Cf - 1.68 1.40 99 Es - 1.65 1.40 100 Fm - 1.67 101 Md - 1.73 1.39 102 No - 1.76 1.59 103 Lr - 1.61 1.41 104 Rf - 1.57 1.40 1.31 105 Db - 1.49 1.36 1.26 106 Sg - 1.43 1.28 1.21 107 Bh - 1.41 1.28 1.19 108 Hs - 1.34 1.25 1.18 109 Mt - 1.29 1.25 1.13 110 Ds - 1.28 1.16 1.12 111 Rg - 1.21 1.16 1.18 112 Cn - 1.22 1.37 1.30 113 Uut - 1.36 114 Uuq - 1.43 115 Uup - 1.62 116 Uuh - 1.75 117 Uus - 1.65 118 Uuo - 1.57\ """ periodictable-1.5.0/periodictable/cromermann.py000066400000000000000000000143311310514471200216440ustar00rootroot00000000000000############################################################################## # Copyright (c) 2009 Trustees of the Columbia University # in the City of New York. All rights reserved. # # DANSE Diffraction group, Simon J. L. Billinge # # File coded by: Pavol Juhas # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # # * Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # # * Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # * Neither the name of Columbia University nor the names of its # contributors may be used to endorse or promote products derived from # this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS # "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT # LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR # A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT # OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, # SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED # TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR # PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF # LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING # NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ############################################################################## """ Cromer-Mann formula for calculating x-ray scattering factors. """ # module version __id__ = "$Id: cromermann.py 1051 2010-01-30 01:01:43Z juhas $" import os import logging import numpy from periodictable import core def getCMformula(symbol): """ Obtain Cromer-Mann formula and coefficients for a specified element. *symbol* : string symbol of an element Return instance of CromerMannFormula. """ if not _cmformulas: _update_cmformulas() return _cmformulas[symbol] def fxrayatq(symbol, Q, charge=None): """ Return x-ray scattering factors of an element at a given Q. *symbol* : string symbol of an element or ion, e.g., "Ca", "Ca2+" *Q* : float or [float] | |1/Ang| Q value *charge* : int ion charge, overrides any valence suffixes such as "-", "+", "3+". Return float or numpy array. """ stol = numpy.array(Q) / (4 * numpy.pi) rv = fxrayatstol(symbol, stol, charge) return rv def fxrayatstol(symbol, stol, charge=None): """ Calculate x-ray scattering factors at specified sin(theta)/lambda *symbol* : string symbol of an element or ion, e.g., "Ca", "Ca2+" *stol* : float or [float] | |1/Ang| sin(theta)/lambda *charge* : int ion charge, overrides any valence suffixes such as "-", "+", "3+". Return float or numpy.array. """ # resolve lookup symbol smbl, by default symbol smbl = symbol # build standard element or ion symbol if charge is not None: smbl = symbol.rstrip('012345678+-') if charge: smbl += ("%+i" % charge)[::-1] # convert Na+ or Cl- to Na1+, Cl1- elif symbol[-1:] in '+-' and not symbol[-2:-1].isdigit(): smbl = (symbol[:-1] + "1" + symbol[-1:]) # smbl is resolved here cmf = getCMformula(smbl) rv = cmf.atstol(stol) return rv class CromerMannFormula(object): """ Cromer-Mann formula for x-ray scattering factors. Coefficient storage and evaluation. Class data: *stollimit* : float | |1/Ang| maximum sin(theta)/lambda for which the formula works Attributes: *symbol* : string symbol of an element *a* : [float] a-coefficients *b* : [float] b-coefficients *c* : float c-coefficient """ # obtained from tables/f0_WaasKirf.dat and the associated reference # D. Waasmaier, A. Kirfel, Acta Cryst. (1995). A51, 416-413 # http://dx.doi.org/10.1107/S0108767394013292 stollimit = 6 def __init__(self, symbol, a, b, c): """ Create a new instance of CromerMannFormula for specified element. No return value """ self.symbol = symbol self.a = numpy.asarray(a, dtype=float) self.b = numpy.asarray(b, dtype=float) self.c = float(c) return def atstol(self, stol): """ Calculate x-ray scattering factors at specified sin(theta)/lambda *stol* : float or [float] | |1/Ang| sin(theta)/lambda Return float or numpy.array. """ stolflat = numpy.array(stol).flatten() n = len(stolflat) stol2row = numpy.reshape(stolflat ** 2, (1, n)) bcol = self.b.reshape((len(self.a), 1)) bstol2 = numpy.dot(bcol, stol2row) adiag = numpy.diag(self.a) rvrows = numpy.dot(adiag, numpy.exp(-bstol2)) rvflat = rvrows.sum(axis=0) + self.c rvflat[stolflat > self.stollimit] = numpy.nan # when stol is scalar, addition of zero converts the rv array to float rv = rvflat.reshape(numpy.shape(stol)) + 0.0 return rv # class CromerMannFormula def _update_cmformulas(): """ Update the static dictionary of CromerMannFormula instances. """ data_path = core.get_data_path('xsf') filename = os.path.join(data_path, 'f0_WaasKirf.dat') fp = open(filename) lineiter = iter(fp) for line in lineiter: w = line.split() if w[0] == "#S": smbl = w[2] continue if w[0] == "#L": assert smbl is not None line1 = next(lineiter) w1 = line1.split() assert len(w1) == 11 a = list(map(float, w1[0:5])) b = list(map(float, w1[6:11])) c = float(w1[5]) cmf = CromerMannFormula(smbl, a, b, c) _cmformulas[cmf.symbol] = cmf smbl = None return _cmformulas = {} # End of file periodictable-1.5.0/periodictable/crystal_structure.py000066400000000000000000000135101310514471200233020ustar00rootroot00000000000000# This program is in the public domain ''' Crystal structure data. Adds *crystal_structure* to the periodic table. Each crystal structure is a dictionary which contains the key 'symmetry'. Depending on the value of crystal_structure['symmetry'], one or more parameters 'a', 'c/a', 'b/a', 'd', and 'alpha' may be present according to the following table: .. table:: Crystal lattice parameters ============ =========== Symmetry Parameters ============ =========== atom diatom d BCC a fcc a hcp c/a, a Tetragonal c/a, a Cubic a Diamond a Orthorhombic c/a, a, b/a Rhombohedral a, alpha SC a Monoclinic ============ =========== Example: .. doctest:: >>> import periodictable as elements >>> print(elements.C.crystal_structure['symmetry']) Diamond >>> print(elements.C.crystal_structure['a']) 3.57 This data is from Ashcroft and Mermin. ''' crystal_structures = [\ None, #X {'symmetry': 'diatom', 'd': 0.74}, #H {'symmetry': 'atom'}, #He {'symmetry': 'BCC', 'a': 3.49}, #Li {'symmetry': 'hcp', 'c/a': 1.567, 'a': 2.29}, #Be {'symmetry': 'Tetragonal', 'c/a': 0.576, 'a': 8.73}, #B {'symmetry': 'Diamond', 'a': 3.57}, #C {'symmetry': 'diatom', 'd': 1.10}, #N {'symmetry': 'diatom', 'd': 1.21}, #O {'symmetry': 'diatom', 'd': 1.42}, #F {'symmetry': 'fcc', 'a': 4.43}, #Ne {'symmetry': 'BCC', 'a': 4.23}, #Na {'symmetry': 'hcp', 'c/a': 1.624, 'a': 3.21}, #Mg {'symmetry': 'fcc', 'a': 4.05}, #Al {'symmetry': 'Diamond', 'a': 5.43}, #Si {'symmetry': 'Cubic', 'a': 7.17}, #P {'symmetry': 'Orthorhombic', 'c/a': 2.339, 'a': 10.47, 'b/a': 1.229}, #S {'symmetry': 'Orthorhombic', 'c/a': 1.324, 'a': 6.24, 'b/a': 0.718}, #Cl {'symmetry': 'fcc', 'a': 5.26}, #Ar {'symmetry': 'BCC', 'a': 5.23}, #K {'symmetry': 'fcc', 'a': 5.58}, #Ca {'symmetry': 'hcp', 'c/a': 1.594, 'a': 3.31}, #Sc {'symmetry': 'hcp', 'c/a': 1.588, 'a': 2.95}, #Ti {'symmetry': 'BCC', 'a': 3.02}, #V {'symmetry': 'BCC', 'a': 2.88}, #Cr {'symmetry': 'Cubic', 'a': 8.89}, #Mn {'symmetry': 'BCC', 'a': 2.87}, #Fe {'symmetry': 'hcp', 'c/a': 1.622, 'a': 2.51}, #Co {'symmetry': 'fcc', 'a': 3.52}, #Ni {'symmetry': 'fcc', 'a': 3.61}, #Cu {'symmetry': 'hcp', 'c/a': 1.856, 'a': 2.66}, #Zn {'symmetry': 'Orthorhombic', 'c/a': 1.695, 'a': 4.51, 'b/a': 1.001}, #Ga {'symmetry': 'Diamond', 'a': 5.66}, #Ge {'symmetry': 'Rhombohedral', 'a': 4.13, 'alpha': 54.10}, #As {'symmetry': 'hcp', 'c/a': 1.136, 'a': 4.36}, #Se {'symmetry': 'Orthorhombic', 'c/a': 1.307, 'a': 6.67, 'b/a': 0.672}, #Br {'symmetry': 'fcc', 'a': 5.72}, #Kr {'symmetry': 'BCC', 'a': 5.59}, #Rb {'symmetry': 'fcc', 'a': 6.08}, #Sr {'symmetry': 'hcp', 'c/a': 1.571, 'a': 3.65}, #Y {'symmetry': 'hcp', 'c/a': 1.593, 'a': 3.23}, #Zr {'symmetry': 'BCC', 'a': 3.30}, #Nb {'symmetry': 'BCC', 'a': 3.15}, #Mo {'symmetry': 'hcp', 'c/a': 1.604, 'a': 2.74}, #Tc {'symmetry': 'hcp', 'c/a': 1.584, 'a': 2.70}, #Ru {'symmetry': 'fcc', 'a': 3.80}, #Rh {'symmetry': 'fcc', 'a': 3.89}, #Pd {'symmetry': 'fcc', 'a': 4.09}, #Ag {'symmetry': 'hcp', 'c/a': 1.886, 'a': 2.98}, #Cd {'symmetry': 'Tetragonal', 'c/a': 1.076, 'a': 4.59}, #In {'symmetry': 'Tetragonal', 'c/a': 0.546, 'a': 5.82}, #Sn {'symmetry': 'Rhombohedral', 'a': 4.51, 'alpha': 57.60}, #Sb {'symmetry': 'hcp', 'c/a': 1.330, 'a': 4.45}, #Te {'symmetry': 'Orthorhombic', 'c/a': 1.347, 'a': 7.27, 'b/a': 0.659}, #I {'symmetry': 'fcc', 'a': 6.20}, #Xe {'symmetry': 'BCC', 'a': 6.05}, #Cs {'symmetry': 'BCC', 'a': 5.02}, #Ba {'symmetry': 'hcp', 'c/a': 1.619, 'a': 3.75}, #La {'symmetry': 'fcc', 'a': 5.16}, #Ce {'symmetry': 'hcp', 'c/a': 1.614, 'a': 3.67}, #Pr {'symmetry': 'hcp', 'c/a': 1.614, 'a': 3.66}, #Nd None, #Pm {'symmetry': 'Rhombohedral', 'a': 9.00, 'alpha': 23.13}, #Sm {'symmetry': 'BCC', 'a': 4.61}, #Eu {'symmetry': 'hcp', 'c/a': 1.588, 'a': 3.64}, #Gd {'symmetry': 'hcp', 'c/a': 1.581, 'a': 3.60}, #Th {'symmetry': 'hcp', 'c/a': 1.573, 'a': 3.59}, #Dy {'symmetry': 'hcp', 'c/a': 1.570, 'a': 3.58}, #Ho {'symmetry': 'hcp', 'c/a': 1.570, 'a': 3.56}, #Er {'symmetry': 'hcp', 'c/a': 1.570, 'a': 3.54}, #Tm {'symmetry': 'fcc', 'a': 5.49}, #Yb {'symmetry': 'hcp', 'c/a': 1.585, 'a': 3.51}, #Lu {'symmetry': 'hcp', 'c/a': 1.582, 'a': 3.20}, #Hf {'symmetry': 'BCC', 'a': 3.31}, #Ta {'symmetry': 'BCC', 'a': 3.16}, #W {'symmetry': 'hcp', 'c/a': 1.615, 'a': 2.76}, #Re {'symmetry': 'hcp', 'c/a': 1.579, 'a': 2.74}, #Os {'symmetry': 'fcc', 'a': 3.84}, #Ir {'symmetry': 'fcc', 'a': 3.92}, #Pt {'symmetry': 'fcc', 'a': 4.08}, #Au {'symmetry': 'Rhombohedral', 'a': 2.99, 'alpha': 70.45}, #Hg {'symmetry': 'hcp', 'c/a': 1.599, 'a': 3.46}, #Tl {'symmetry': 'fcc', 'a': 4.95}, #Pb {'symmetry': 'Rhombohedral', 'a': 4.75, 'alpha': 57.14}, #Bi {'symmetry': 'SC', 'a': 3.35}, #Po None, #At None, #Rn None, #Fr None, #Ra {'symmetry': 'fcc', 'a': 5.31}, #Ac {'symmetry': 'fcc', 'a': 5.08}, #Th {'symmetry': 'Tetragonal', 'c/a': 0.825, 'a': 3.92}, #Pa {'symmetry': 'Orthorhombic', 'c/a': 2.056, 'a': 2.85, 'b/a': 1.736}, #U {'symmetry': 'Orthorhombic', 'c/a': 1.411, 'a': 4.72, 'b/a': 1.035}, #Np {'symmetry': 'Monoclinic'}, #Pu None, #Am None, #Cm None, #Bk None, #Cf None, #Es None, #Fm None, #Md None, #No None]#Lw def init(table, reload=False): """ Add crystal_structure field to the element properties. """ if 'crystal_structure' in table.properties and not reload: return table.properties.append('crystal_structure') for Z, struct in enumerate(crystal_structures): table[Z].crystal_structure = struct periodictable-1.5.0/periodictable/density.py000066400000000000000000000163071310514471200211670ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle r""" The following properties are added: * density, density_units (|g/cm^3|) Densities for solids and liquids are given as specific gravities at 20\ |deg| C unless other wise indicated by *density_caveat*. Densities for gaseous elements are given for the liquids at their boiling points. Missing data are represented by *None*. * density_caveat Comments on the density, if not taken in standard conditions. * interatomic_distance, interatomic_distance_units (|Ang|) Interatomic distance estimated from element density. * number_density, number_density_units (|1/cm^3|) Number density estimated from mass and density. Density for the isotope is computed assuming that the atomic spacing is the same as that for the element in the natural abundance. .. doctest:: >>> from periodictable import D, H >>> print("H: %.4f, D: %.4f"%(H.density, D.density)) H: 0.0708, D: 0.1415 >>> print((D.density/H.density) / (D.mass/H.mass)) 1.0 The following plot shows density for all elements: .. plot:: plots/density_plot.py From the X-ray data book: http://xdb.lbl.gov/Section5/Sec_5-2.html Data were taken mostly from [#Lide1999]_. These values are reproduced in [#ILL]_. .. [#Lide1999] Lide. D. R., Ed., CRC Handbook of Chemistry and Physics, 80th ed. (CRC Press, Boca Raton, Florida, 1999) .. [#ILL] The ILL Neutron Data Booklet, Second Edition. """ from .core import Element, Isotope from .constants import avogadro_number def density(iso_el): """ Element density for natural abundance. For isotopes, return the equivalent density assuming identical inter-atomic spacing as the naturally occuring material. :Parameters: *iso_el* : isotope or element Name of the element or isotope. :Returns: *density* : float | |g/cm^3| Reference: *ILL Neutron Data Booklet, original values from CRC Handbook of Chemistry and Physics, 80th ed. (1999).* """ if hasattr(iso_el, 'element'): return iso_el.element._density * (iso_el.mass/iso_el.element.mass) else: return iso_el._density def interatomic_distance(element): r""" Estimated interatomic distance from atomic weight and density. The distance between isotopes is assumed to match that between atoms in the natural abundance. :Parameters: *element* : Element The element whose interatomic distance is to be calculated. :Returns: *distance* : float | |Ang| Estimated interatomic distance. Interatomic distance is computed using: .. math:: d = (m/(\rho_m N_A 10^{-24}))^{1/3} with units: .. math:: (\rm (g\cdot mol^{-1}) / ( (g\cdot cm^{-3}) (atoms\cdot mol^{-1}) (10^{-8} cm\cdot \AA^{-1})^3))^{1/3} = \AA """ if hasattr(element, 'isotope'): element = element.element if element.density is None or element.mass is None: return None return (element.mass/(element.density*avogadro_number*1e-24))**(1./3.) def number_density(element): r""" Estimate the number density from atomic weight and density. The density for isotopes is assumed to match that of between atoms in natural abundance. :Parameters: *element* : element Name of the element whose number density needs to be calculated. :Returns: *Nb* : float | |1/cm^3| Number density of a element. Number density is computed using: .. math:: d = N_A \frac{\rho}{m} with units: .. math:: \rm (atoms\cdot mol^{-1}) (g\cdot cm^{-3}) / (g\cdot mol^{-1}) = atoms\cdot cm^{-3} """ if hasattr(element, 'isotope'): element = element.element if element.density is None or element.mass is None: return None return (element.density/element.mass)*avogadro_number def init(table, reload=False): if 'density' in table.properties and not reload: return table.properties.append('density') Isotope.density \ = property(density, "density using inter-atomic spacing from naturally occurring form") Element.density \ = property(density, "density using inter-atomic spacing from naturally occurring form") Element.density_units = "g/cm^3" Element.interatomic_distance \ = property(interatomic_distance, "interatomic distance estimated from density") Element.interatomic_distance_units = "angstrom" Element.number_density \ = property(number_density, "number density estimated from mass and density") Element.number_density_units = "1/cm^3" for k, v in element_densities.items(): el = getattr(table, k) if isinstance(v, tuple): el._density = v[0] el.density_caveat = v[1] elif v is None: el._density = None el.density_caveat = "unavailable" else: el._density = v el.density_caveat = "" element_densities = dict( n=None, # Unless someone wants to look up neutron star densities... H=(0.0708, "T=-252.87"), He=(0.122, "T=-268.93"), Li=0.534, Be=1.848, B=2.34, C=(2.1, "1.9-2.3 (graphite)"), N=(0.808, "T=-195.79"), O=(1.14, "T=-182.95"), F=(1.50, "T=-188.12"), Ne=(1.207, "T=-246.08"), Na=0.971, Mg=1.738, Al=2.6989, Si=(2.33, "T=25"), P=1.82, S=2.07, Cl=(1.56, "T=-33.6, 0.44 C above boiling point"), Ar=(1.40, "T=-185.85"), K=0.862, Ca=1.55, Sc=(2.989, "T=25"), Ti=4.54, V=(6.11, "T=18.7"), Cr=(7.19, "7.18-7.20"), Mn=(7.33, "7.21-7.44"), Fe=7.874, Co=8.9, Ni=(8.902, "T=25"), Cu=8.96, Zn=(7.133, "T=25"), Ga=(5.904, "T=29.6"), Ge=(5.323, "T=25"), As=5.73, Se=4.79, Br=3.12, Kr=(2.16, "T=-153.22"), Rb=1.532, Sr=2.54, Y=(4.469, "T=25"), Zr=6.506, Nb=8.57, Mo=10.22, Tc=(11.50, "calculated"), Ru=12.41, Rh=12.41, Pd=12.02, Ag=10.50, Cd=8.65, In=7.31, Sn=7.31, Sb=6.691, Te=6.24, I=4.93, Xe=(3.52, "T=-108.12"), Cs=1.873, Ba=3.5, La=(6.145, "T=25"), Ce=(6.770, "T=25"), Pr=6.773, Nd=(7.008, "T=25"), Pm=(7.264, "T=25"), Sm=(7.520, "T=25"), Eu=(5.244, "T=25"), Gd=(7.901, "T=25"), Tb=8.230, Dy=(8.551, "T=25"), Ho=(8.795, "T=25"), Er=(9.066, "T=25"), Tm=(9.321, "T=25"), Yb=6.966, Lu=(9.841, "T=25"), Hf=13.31, Ta=16.654, W=19.3, Re=21.02, Os=22.57, Ir=(22.42, "T=17"), Pt=21.45, Au=(19.3, "approximate"), Hg=13.546, Tl=11.85, Pb=11.35, Bi=9.747, Po=9.32, At=None, Rn=None, Fr=None, Ra=None, Ac=None, Th=11.72, Pa=(15.37, "calculated"), U=(18.95, "approximate"), Np=20.25, Pu=(19.84, "T=25"), Am=13.67, Cm=(13.51, "calculated"), Bk=(14, "estimated"), Cf=None, Es=None, Fm=None, Md=None, No=None, Lr=None, Rf=None, Db=None, Sg=None, Bh=None, Hs=None, Mt=None, Ds=None, Rg=None, Cn=None, Nh=None, Fl=None, Mc=None, Lv=None, Ts=None, Og=None, ) periodictable-1.5.0/periodictable/fasta.py000066400000000000000000000413501310514471200206020ustar00rootroot00000000000000""" Biomolecule support. :class:`Molecule` lets you define biomolecules with labile hydrogen atoms specified using tritium (T) in the chemical formula. The biomolecule object creates forms with natural isotope ratio, all hydrogen and all deuterium. Density can be provided as natural density or cell volume. A %D2O contrast match value is computed for matching the molecule SLD in the presence of labile hydrogens. :meth:`Molecule.D2Osld` computes the neutron SLD for the solvated molecule in a %D2O solvent. :func:`D2Omatch` computes the %D2O constrast match value given the fully hydrogenated and fully deuterated forms. :class:`Sequence` lets you read amino acid and DNA/RNA sequences from FASTA files. Tables for common molecules are provided[1]: *AMINO_ACID_CODES* : amino acids indexed by FASTA code *RNA_CODES*, DNA_CODES* : nucleic bases indexed by FASTA code *RNA_BASES*, DNA_BASES* : individual nucleic acid bases *NUCLEIC_ACID_COMPONENTS*, *LIPIDS*, *CARBOHYDRATE_RESIDUES* Neutron SLD for water at 20C is also provided as *H2O_SLD* and *D2O_SLD*. For unmodified protein need to add 2*T and O for terminations. Assumes that proteins were created in an environment with the usual H/D isotope ratio on the non-swappable hydrogens. [1] Perkins, Modern Physical Methods in Biochemistry Part B, 143-265 (1988) """ from __future__ import division import periodictable as pt class Molecule(object): """ Specify a biomolecule by name, chemical formula, cell volume and charge. Labile hydrogen positions should be coded using tritium (T) rather than H. That way the tritium can be changed to H[1] for solutions with pure water, H for solutions with a natural abundance of water or D for solutions with pure deuterium. **Attributes** *formula* is the original tritiated formula. You can retrieve the hydrogenated or deuterated forms using :func:`isotope_substitution` with *formula*, periodictable.T and periodictable.H or periodictable.D. *D2Omatch* is the % D2O in H2O required to contrast match the molecule, including the the proton swapping effect. *sld*/*Hsld*/*Dsld* are the the scattering length densities of the molecule with tritium replaced by naturally occurring H/D ratios, pure H[1] and pure H[2] respectively. *mass*/*Hmass*/*Dmass* are the masses the three conditions. *charge* is the charge on the molecule *cell_volume* is the estimated cell volume for the molecule *density* is the estimated molecule density """ def __init__(self, name, formula, cell_volume=None, density=None, charge=0): # Fill in density or cell_volume M = pt.formula(formula, natural_density=density) if cell_volume is not None: M.density = 1e24*M.molecular_mass/cell_volume if cell_volume > 0 else 0 #print name, M.molecular_mass, cell_volume, M.density else: cell_volume = 1e24*M.molecular_mass/M.density Hnatural = isotope_substitution(M, pt.T, pt.H) H = isotope_substitution(M, pt.T, pt.H[1]) D = isotope_substitution(M, pt.T, pt.D) self.name = name self.formula = M self.cell_volume = cell_volume self.sld = pt.neutron_sld(Hnatural, wavelength=5)[0] self.Hsld = pt.neutron_sld(H, wavelength=5)[0] self.Dsld = pt.neutron_sld(D, wavelength=5)[0] self.mass, self.Hmass, self.Dmass = Hnatural.mass, H.mass, D.mass self.D2Omatch = D2Omatch(self.Hsld, self.Dsld) self.charge = charge self.Hnatural = Hnatural def D2Osld(self, volume_fraction=1., D2O_fraction=0.): """ Neutron SLD of the molecule in a %D2O solvent. """ solvent_sld = D2O_fraction*D2O_SLD + (1-D2O_fraction)*H2O_SLD solute_sld = D2O_fraction*self.Dsld + (1-D2O_fraction)*self.Hsld return volume_fraction*solute_sld + (1-volume_fraction)*solvent_sld class Sequence(Molecule): """ Convert FASTA sequence into chemical formula. *name* sequence name *sequence* code string *type* is one of:: aa: amino acid sequence dna: dna sequence rna: rna sequence Note: rna sequence files treat T as U and dna sequence files treat U as T. """ @classmethod def loadall(self, filename, type=None): """ Iterate over sequences in FASTA file, loading each in turn. Yields one FASTA sequence each cycle. """ type = _guess_type_from_filename(filename, type) with open(filename, 'rt') as fh: for name, seq in read_fasta(fh): yield Sequence(name, seq, type=type) @classmethod def load(self, filename, type=None): """ Load the first FASTA sequence from a file. """ type = _guess_type_from_filename(filename, type) with open(filename, 'rt') as fh: name, seq = next(read_fasta(fh)) return Sequence(name, seq, type=type) def __init__(self, name, sequence, type='aa'): codes = CODE_TABLES[type] sequence = sequence.split('*', 1)[0] # stop at first '*' sequence = sequence.replace(' ', '') # ignore spaces parts = tuple(codes[c] for c in sequence) cell_volume = sum(p.cell_volume for p in parts) charge = sum(p.charge for p in parts) structure = [] for p in parts: structure.extend(list(p.formula.structure)) formula = pt.formula(structure).hill Molecule.__init__(self, name, formula, cell_volume=cell_volume, charge=charge) self.sequence = sequence def _guess_type_from_filename(filename, type): if type is None: if filename.endswith('.fna'): type = 'dna' elif filename.endswith('.ffn'): type = 'dna' elif filename.endswith('.faa'): type = 'aa' elif filename.endswith('.frn'): type = 'rna' else: type = 'aa' return type # Water density at 20C; neutron wavelength doesn't matter (use 5 A). H2O_SLD = pt.neutron_sld(pt.formula("H2O@0.9982"), wavelength=5)[0] D2O_SLD = pt.neutron_sld(pt.formula("D2O@0.9982"), wavelength=5)[0] def D2Omatch(Hsld, Dsld): """ Find the D2O% concentration of solvent such that neutron SLD of the material matches the neutron SLD of the solvent. *Hsld*, *Dsld* are the SLDs for the hydrogenated and deuterated forms of the material respectively, where *D* includes all the labile protons swapped for deuterons. Water SLD is calculated at 20 C. Note that the resulting percentage is only meaningful between 0% to 100%. Beyond 100% you will need an additional constrast agent in the 100% D2O solvent to increase the SLD enough to match. """ # SLD(%Dsample + (1-%)Hsample) = SLD(%D2O + (1-%)H2O) # %SLD(Dsample) + (1-%)SLD(Hsample) = %SLD(D2O) + (1-%)SLD(H2O) # %(SLD(Dsample) - SLD(Hsample) + SLD(H2O) - SLD(D2O)) = SLD(H2O) - SLD(Hsample) # % = 100*(SLD(H2O) - SLD(Hsample)) / (SLD(Dsample) - SLD(Hsample) + SLD(H2O) - SLD(D2O)) return 100*(H2O_SLD - Hsld) / (Dsld - Hsld + H2O_SLD - D2O_SLD) def read_fasta(fp): """ Iterate over the sequences in a FASTA file. Each iteration is a pair (sequence name, sequence codes). """ name, seq = None, [] for line in fp: line = line.rstrip() if line.startswith(">"): if name: yield (name, ''.join(seq)) name, seq = line, [] else: seq.append(line) if name: yield (name, ''.join(seq)) def isotope_substitution(formula, source, target, portion=1): """ Substitute one atom/isotope in a formula with another in some proportion. *formula* is the formula being updated. *source* is the isotope/element to be substituted. *target* is the replacement isotope/element. *portion* is the proportion of source which is substituted for target. """ atoms = formula.atoms if source in atoms: mass = formula.mass mass_reduction = atoms[source]*portion*(source.mass - target.mass) density = formula.density * (mass - mass_reduction)/mass atoms[target] = atoms.get(target, 0) + atoms[source]*portion if portion == 1: del atoms[source] else: atoms[source] *= 1-portion else: density = formula.density return pt.formula(atoms, density=density) def _code_average(bases, code_table): """ Compute average over possible nucleotides, assuming equal weight if precise nucleotide is not known """ n = len(bases) formula, cell_volume, charge = pt.formula(), 0, 0 for c in bases: base = code_table[c] formula += base.formula cell_volume += base.cell_volume charge += base.charge if n > 0: formula, cell_volume, charge = (1/n) * formula, cell_volume/n, charge/n return formula, cell_volume, charge def _set_amino_acid_average(target, codes, name=None): formula, cell_volume, charge = _code_average(codes, AMINO_ACID_CODES) if name is None: name = "/".join(AMINO_ACID_CODES[c].name for c in codes) molecule = Molecule(name, formula, cell_volume=cell_volume, charge=charge) AMINO_ACID_CODES[target] = molecule # FASTA code table def _(code, V, formula, name): if formula[-1] == '-': charge = -1 formula = formula[:-1] elif formula[-1] == '+': charge = +1 formula = formula[:-1] else: charge = 0 molecule = Molecule(name, formula, cell_volume=V, charge=charge) molecule.code = code # Add code attribute so we can write as well as read return code, molecule # pylint: disable=bad-whitespace AMINO_ACID_CODES = dict(( #code, volume, formula, name _("A", 91.5, "C3H4TNO", "alanine"), #B: D or N _("C", 105.6, "C3H3TNOS", "cysteine"), _("D", 124.5, "C4H3TNO3-", "aspartic acid"), _("E", 155.1, "C5H5TNO3-", "glutamic acid"), _("F", 203.4, "C9H8TNO", "phenylalanine"), _("G", 66.4, "C2H2TNO", "glycine"), _("H", 167.3, "C6H5T3N3O+", "histidine"), _("I", 168.8, "C6H10TNO", "isoleucine"), #J: L or I _("K", 171.3, "C6H9T4N2O+", "lysine"), _("L", 168.8, "C6H10TNO", "leucine"), _("M", 170.8, "C5H8TNOS", "methionine"), _("N", 135.2, "C4H3T3N2O2", "asparagine"), #O: _("O", ???.?, "C12H21N3O3", "pyrrolysine") -- update X below _("P", 129.3, "C5H7NO", "proline"), _("Q", 161.1, "C5H5T3N2O2", "glutamine"), _("R", 202.1, "C6H7T6N4O+", "arginine"), _("S", 99.1, "C3H3T2NO2", "serine"), _("T", 122.1, "C4H5T2NO2", "threonine"), #U: selenocysteine -- update X below _("V", 141.7, "C5H8TNO", "valine"), _("W", 237.6, "C11H8T2N2O", "tryptophan"), #X: any _("Y", 203.6, "C9H7T2NO2", "tyrosine"), #Z: E or Q #-: gap )) _set_amino_acid_average('B', 'DN') _set_amino_acid_average('J', 'LI') _set_amino_acid_average('Z', 'EQ') _set_amino_acid_average('X', 'ACDEFGHIKLMNPQRSTVWY', name='any') _set_amino_acid_average('-', '', name='gap') __doc__ += "\n\n*AMINO_ACID_CODES*::\n\n " + "\n ".join("%s: %s"%(k, v.name) for k, v in sorted(AMINO_ACID_CODES.items())) def _(formula, V, name): molecule = Molecule(name, formula, cell_volume=V) return name, molecule NUCLEIC_ACID_COMPONENTS = dict(( # formula, volume, name _("NaPO3", 60, "phosphate"), _("C5H6TO3", 125, "ribose"), _("C5H7O2", 115, "deoxyribose"), _("C5H2T2N5", 114, "adenine"), _("C4H2TN2O2", 99, "uracil"), _("C5H4TN2O2", 126, "thymine"), _("C5HT3N5O", 119, "guanine"), _("C4H2T2N3O", 103, "cytosine"), )) __doc__ += "\n\n*NUCLEIC_ACID_COMPONENTS*::\n\n " + "\n ".join("%s: %s"%(k, v.formula) for k, v in sorted(NUCLEIC_ACID_COMPONENTS.items())) CARBOHYDRATE_RESIDUES = dict(( # formula, volume, name _("C6H7T3O5", 171.9, "Glc"), _("C6H7T3O5", 166.8, "Gal"), _("C6H7T3O5", 170.8, "Man"), _("C6H7T4O5", 170.8, "Man (terminal)"), _("C8H10T3NO5", 222.0, "GlcNAc"), _("C8H10T3NO5", 232.9, "GalNAc"), _("C6H7T3O4", 160.8, "Fuc (terminal)"), _("C11H11T5NO8", 326.3, "NeuNac (terminal)"), # Glycosaminoglycans _("C14H15T5NO11Na", 390.7, "hyaluronate"), # GlcA.GlcNAc _("C14H17T5NO13SNa", 473.5, "keratan sulphate"), # Gal.GlcNAc.SO4 _("C14H15T4NO14SNa", 443.5, "chondroitin sulphate"), # GlcA.GalNAc.SO4 )) __doc__ += "\n\n*CARBOHYDRATE_RESIDUES*::\n\n " + "\n ".join("%s: %s"%(k, v.formula) for k, v in sorted(CARBOHYDRATE_RESIDUES.items())) LIPIDS = dict(( # formula, volume, name _("CH2", 27, "methylene"), _("CD2", 27, "methylene-D"), _("C10H18NO8P", 350, "phospholipid headgroup"), _("C6H5O6", 240, "triglyceride headgroup"), _("C36H72NO8P", 1089, "DMPC"), _("C36H20D52NO8P", 1089, "DMPC-D52"), _("C29H55T3NO8P", 932, "DLPE"), _("C27H45TO", 636, "cholesteral"), _("C45H78O2", 1168, "oleate"), _("C57H104O6", 1617, "trioleate form"), _("C39H77T2N2O2P", 1166, "palmitate ester"), )) __doc__ += "\n\n*LIPIDS*::\n\n " + "\n ".join("%s: %s"%(k, v.formula) for k, v in sorted(LIPIDS.items())) def _(code, formula, V, name): molecule = Molecule(name, formula, cell_volume=V) molecule.code = code return code, molecule RNA_BASES = dict(( # code, formula, volume, name _("A", "C10H8T3N5O6PNa", 299, "adenosine"), _("T", "C9H8T2N2O8PNa", 284, "uridine"), # Use T for U in RNA _("G", "C10H7T4N5O7PNa", 304, "guanosine"), _("C", "C9H8T3N3O7PNa", 288, "cytidine"), )) __doc__ += "\n\n*RNA_BASES*::\n\n " + "\n ".join("%s:%s"%(k, v.name) for k, v in sorted(RNA_BASES.items())) DNA_BASES = dict(( # code, formula, volume, %D2O matchpoint, name _("A", "C10H9T2N5O5PNa", 289, "adenosine"), _("T", "C10H11T1N2O7PNa", 301, "thymidine"), _("G", "C10H8T3N5O6PNa", 294, "guanosine"), _("C", "C9H9T2N3O6PNa", 278, "cytidine"), )) __doc__ += "\n\n*DNA_BASES*::\n\n " + "\n ".join("%s:%s"%(k, v.name) for k, v in sorted(DNA_BASES.items())) def _(code, bases, name): D, V, _ = _code_average(bases, RNA_BASES) rna = Molecule(name, D.hill, cell_volume=V) rna.code = code D, V, _ = _code_average(bases, DNA_BASES) dna = Molecule(name, D.hill, cell_volume=V) rna.code = code return (code,rna), (code,dna) RNA_CODES,DNA_CODES = [dict(v) for v in zip( #code, nucleotides, name _("A", "A", "adenosine"), _("C", "C", "cytidine"), _("G", "G", "guanosine"), _("T", "T", "thymidine"), _("U", "T", "uridine"), # RNA_BASES["T"] is uridine _("R", "AG", "purine"), _("Y", "CT", "pyrimidine"), _("K", "GT", "ketone"), _("M", "AC", "amino"), _("S", "CG", "strong"), _("W", "AT", "weak"), _("B", "CGT", "not A"), _("D", "AGT", "not C"), _("H", "ACT", "not G"), _("V", "ACG", "not T"), _("N", "ACGT", "any base"), _("X", "", "masked"), _("-", "", "gap"), )] # pylint: enable=bad-whitespace CODE_TABLES = { 'aa': AMINO_ACID_CODES, 'dna': DNA_CODES, 'rna': RNA_CODES, } def fasta_table(): rows = [] rows += [v for k, v in sorted(AMINO_ACID_CODES.items())] rows += [v for k, v in sorted(NUCLEIC_ACID_COMPONENTS.items())] rows += [Sequence("beta casein", beta_casein)] print("%20s %7s %7s %7s %5s %5s %5s %5s %5s %5s" % ("name", "M(H2O)", "M(D2O)", "volume", "den", "#el", "xray", "nH2O", "nD2O", "%D2O match")) for v in rows: protons = sum(num*el.number for el, num in v.formula.atoms.items()) electrons = protons - v.charge Xsld = pt.xray_sld(v.formula, wavelength=pt.Cu.K_alpha) print("%20s %7.1f %7.1f %7.1f %5.2f %5d %5.2f %5.2f %5.2f %5.1f"%( v.name, v.Hmass, v.Dmass, v.cell_volume, v.formula.density, electrons, Xsld[0], v.Hsld, v.Dsld, v.D2Omatch)) beta_casein = "RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV" def test(): from periodictable.constants import avogadro_number # Beta casein results checked against Duncan McGillivray's spreadsheet # beta casein 23561.9 23880.9 30872.9 1.27 12614 11.55 1.68 2.75 s = Sequence("beta casein", beta_casein) assert abs(s.Dmass-23880.9) < 0.1 #print "density",s.mass/avogadro_number/s.cell_volume*1e24 assert abs(s.mass/avogadro_number/s.cell_volume*1e24 - 1.267) < 0.01 assert abs(s.Dsld-2.75) < 0.01 # Check that X-ray sld is independent of isotope H = isotope_substitution(s.formula, pt.T, pt.H) D = isotope_substitution(s.formula, pt.T, pt.D) Hsld, Dsld = pt.xray_sld(H, wavelength=1.54), pt.xray_sld(D, wavelength=1.54) #print Hsld, Dsld assert abs(Hsld[0]-Dsld[0]) < 1e-10 if __name__=="__main__": fasta_table() periodictable-1.5.0/periodictable/formulas.py000066400000000000000000000766351310514471200213520ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ Chemical formula parser. """ from __future__ import division, print_function import sys from copy import copy from math import pi, sqrt # Requires that the pyparsing module is installed. from pyparsing import (Literal, Optional, White, Regex, ZeroOrMore, OneOrMore, Forward, StringEnd, Group) from .core import default_table, isatom, isisotope, change_table from .constants import avogadro_number from .util import require_keywords, cell_volume PACKING_FACTORS = dict(cubic=pi/6, bcc=pi*sqrt(3)/8, hcp=pi/sqrt(18), fcc=pi/sqrt(18), diamond=pi*sqrt(3)/16) def mix_by_weight(*args, **kw): """ Generate a mixture which apportions each formula by weight. :Parameters: *formula1* : Formula OR string Material *quantity1* : float Relative quantity of that material *formula2* : Formula OR string Material *quantity2* : float Relative quantity of that material ... *density* : float Density of the mixture, if known *natural_density* : float Density of the mixture with natural abundances, if known. *name* : string Name of the mixture *table* : PeriodicTable Private table to use when parsing string formulas. :Returns: *formula* : Formula If density is not given, then it will be computed from the density of the components, assuming the components take up no more nor less space because they are in the mixture. If component densities are not available, then the resulting density will not be computed. The density calculation assumes the cell volume remains constant for the original materials, which is not in general the case. """ table = default_table(kw.pop('table', None)) density = kw.pop('density', None) natural_density = kw.pop('natural_density', None) name = kw.pop('name', None) if kw: raise TypeError("Unexpected arguments "+", ".join(kw.keys())) if len(args)%2 != 0: raise ValueError("Need a quantity for each formula") pairs = [(formula(args[i], table=table), args[i+1]) for i in range(0, len(args), 2)] result = _mix_by_weight_pairs(pairs) if natural_density: result.natural_density = natural_density if density: result.density = density if name: result.name = name return result def _mix_by_weight_pairs(pairs): # Drop pairs with zero quantity # Note: must be first statement in order to accept iterators pairs = [(f, q) for f, q in pairs if q > 0] result = Formula() if len(pairs) > 0: # cell mass = mass # target mass = q # cell mass * n = target mass # => n = target mass / cell mass # = q / mass # scale this so that n = 1 for the smallest quantity scale = min(q/f.mass for f, q in pairs) for f, q in pairs: result += ((q/f.mass)/scale) * f if all(f.density for f, _ in pairs): volume = sum(q/f.density for f, q in pairs)/scale result.density = result.mass/volume return result def mix_by_volume(*args, **kw): """ Generate a mixture which apportions each formula by volume. :Parameters: *formula1* : Formula OR string Material *quantity1* : float Relative quantity of that material *formula2* : Formula OR string Material *quantity2* : float Relative quantity of that material ... *density* : float Density of the mixture, if known *natural_density* : float Density of the mixture with natural abundances, if known. *name* : string Name of the mixture *table* : PeriodicTable Private table to use when parsing string formulas. :Returns: *formula* : Formula If density is not given, then it will be computed from the density of the components, assuming the components take up no more nor less space because they are in the mixture. If component densities are not available, then a ValueError is raised. The density calculation assumes the cell volume remains constant for the original materials, which is not in general the case. """ table = default_table(kw.pop('table', None)) density = kw.pop('density', None) natural_density = kw.pop('natural_density', None) name = kw.pop('name', None) if kw: raise TypeError("Unexpected arguments "+", ".join(kw.keys())) if len(args)%2 != 0: raise ValueError("Need a quantity for each formula") pairs = [(formula(args[i], table=table), args[i+1]) for i in range(0, len(args), 2)] result = _mix_by_volume_pairs(pairs) if natural_density: result.natural_density = natural_density if density: result.density = density if name: result.name = name return result def _mix_by_volume_pairs(pairs): # Drop pairs with zero quantity # Note: must be first statement in order to accept iterators pairs = [(f, q) for f, q in pairs if q > 0] for f, _ in pairs: if f.density is None or f.density == 0.: raise ValueError("Need the mass density of "+str(f)) result = Formula() if len(pairs) > 0: # cell volume = mass/density # target volume = q # cell volume * n = target volume # => n = target volume / cell volume # = q / (mass/density) # = q * density / mass # scale this so that n = 1 for the smallest quantity scale = min(q*f.density/f.mass for f, q in pairs) for f, q in pairs: result += ((q*f.density/f.mass)/scale) * f volume = sum(q for _, q in pairs)/scale result.density = result.mass/volume return result def formula(compound=None, density=None, natural_density=None, name=None, table=None): r""" Construct a chemical formula representation from a string, a dictionary of atoms or another formula. :Parameters: *compound* : Formula initializer Chemical formula. *density* : float | |g/cm^3| Material density. Not needed for single element formulas. *natural_density* : float | |g/cm^3| Material density assuming naturally occurring isotopes and no change in cell volume. *name* : string Common name for the molecule. *table* : PeriodicTable Private table to use when parsing string formulas. :Exceptions: *ValueError* : invalid formula initializer After creating a formula, a rough estimate of the density can be computed using: formula.density = formula.molecular_mass/formula.volume(packing_factor=...) The volume() calculation uses the covalent radii of the components and the known packing factor or crystal structure name. If the lattice constants for the crystal are known, then they can be used instead: formula.density = formula.molecular_mass/formula.volume(a, b, c, alpha, beta, gamma) Formulas are designed for calculating quantities such as molar mass and scattering length density, not for representing bonds or atom positions. The representations are simple, but preserve some of the structure for display purposes. """ if compound is None or compound == '': structure = tuple() elif isinstance(compound, Formula): structure = compound.structure if density is None and natural_density is None: density = compound.density if not name: name = compound.name elif isatom(compound): structure = ((1, compound), ) elif isinstance(compound, dict): structure = _convert_to_hill_notation(compound) elif _is_string_like(compound): if ':' in compound: from . import fasta seq_type, seq = compound.split(':', 1) if seq_type in fasta.CODE_TABLES: return fasta.Sequence(name=None, sequence=seq, type=seq_type).Hnatural try: formula = parse_formula(compound, table=table) if name: formula.name = name if density is not None: formula.density = density elif natural_density is not None: formula.natural_density = natural_density return formula except ValueError as exception: raise ValueError(str(exception)) #print "parsed", compound, "as", self else: try: structure = _immutable(compound) except: raise ValueError("not a valid chemical formula: "+str(compound)) return Formula(structure=structure, name=name, density=density, natural_density=natural_density) class Formula(object): """ Simple chemical formula representation. """ def __init__(self, structure=tuple(), density=None, natural_density=None, name=None): self.structure = structure self.name = name # If natural_density or density are specified, use them. # If only one element in the formula, use its density. # Otherwise, leave density unspecified, and let the user # assign it separately if they need it. if natural_density is not None: self.natural_density = natural_density elif density is not None: self.density = density elif len(self.atoms) == 1: self.density = list(self.atoms.keys())[0].density else: self.density = None @property def atoms(self): """ { *atom*: *count*, ... } Composition of the molecule. Referencing this attribute computes the *count* as the total number of each element or isotope in the chemical formula, summed across all subgroups. """ return _count_atoms(self.structure) @property def hill(self): """ Formula Convert the formula to a formula in Hill notation. Carbon appears first followed by hydrogen then the remaining elements in alphabetical order. """ return formula(self.atoms) def natural_mass_ratio(self): """ Natural mass to isotope mass ratio. :Returns: *ratio* : float The ratio is computed from the sum of the masses of the individual elements using natural abundance divided by the sum of the masses of the isotopes used in the formula. If the cell volume is preserved with isotope substitution, then the ratio of the masses will be the ratio of the densities. """ total_natural_mass = total_isotope_mass = 0 for el, count in self.atoms.items(): try: natural_mass = el.element.mass except AttributeError: natural_mass = el.mass total_natural_mass += count * natural_mass total_isotope_mass += count * el.mass return total_natural_mass/total_isotope_mass @property def natural_density(self): """ |g/cm^3| Density of the formula with specific isotopes of each element replaced by the naturally occurring abundance of the element without changing the cell volume. """ return self.density*self.natural_mass_ratio() @natural_density.setter def natural_density(self, natural_density): self.density = natural_density / self.natural_mass_ratio() @property def mass(self): """ atomic mass units u (C[12] = 12 u) Molar mass of the molecule. Use molecular_mass to get the mass in grams. """ mass = 0 for el, count in self.atoms.items(): mass += el.mass*count return mass @property def molecular_mass(self): """ g Mass of the molecule in grams. """ return self.mass/avogadro_number @property def charge(self): """ Net charge of the molecule. """ return sum([m*a.charge for a, m in self.atoms.items()]) @property def mass_fraction(self): """ Fractional mass representation of each element/isotope/ion. """ total_mass = self.mass return dict((a, m*a.mass/total_mass) for a, m in self.atoms.items()) def _pf(self): """ packing factor | unitless packing factor estimated from density. """ return self.density def volume(self, packing_factor='hcp', *args, **kw): r""" Estimate unit cell volume. The crystal volume can be estimated from the element covalent radius and the atomic packing factor using:: packing_factor = N_atoms V_atom / V_crystal Packing factors for a number of crystal lattice structures are defined. .. table:: Crystal lattice names and packing factors ======== ======================= ====================== ============== Code Description Formula Packing factor ======== ======================= ====================== ============== cubic simple cubic $\pi/6$ 0.52360 bcc body-centered cubic $\pi\sqrt{3/8}$ 0.68017 hcp hexagonal close-packed $\pi/\sqrt{18}$ 0.74048 fcc face-centered cubic $\pi/\sqrt{18}$ 0.74048 diamond diamond cubic $\pi\sqrt{3/16}$ 0.34009 ======== ======================= ====================== ============== :Parameters: *packing_factor* = 'hcp' : float or string Atomic packing factor. If *packing_factor* is the name of a crystal lattice, use the *lattice* packing factor. *a*, *b*, *c* : float | |Ang| Lattice spacings. *b* and *c* default to *a*. *alpha*, *beta*, *gamma* : float | |deg| Lattice angles. These default to 90\ |deg| :Returns: *volume* : float | |cm^3| Molecular volume. :Raises: *KeyError* : unknown lattice type *TypeError* : missing or bad lattice parameters Using the cell volume, mass density can be set with:: formula.density = n*formula.molecular_mass/formula.volume() where n is the number of molecules per unit cell. """ # Let cell_volume sort out its own parameters. if args or kw: return cell_volume(*args, **kw)*1e-24 # Compute atomic volume V = 0 for el, count in self.atoms.items(): V += el.covalent_radius**3*count V *= 4.*pi/3 # Translate packing factor from string try: _ = packing_factor + "" except Exception: pass else: packing_factor = PACKING_FACTORS[packing_factor.lower()] return V/packing_factor*1e-24 @require_keywords def neutron_sld(self, wavelength=None, energy=None): """ Neutron scattering information for the molecule. :Parameters: *wavelength* : float | |Ang| Wavelength of the neutron beam. :Returns: *sld* : (float, float, float) | |1e-6/Ang^2| Neutron scattering length density is returned as the tuple (*real*, *imaginary*, *incoherent*), or as (None, None, None) if the mass density is not known. .. deprecated:: 0.95 Use periodictable.neutron_sld(formula) instead. """ from .nsf import neutron_sld if self.density is None: return None, None, None return neutron_sld(self.atoms, density=self.density, wavelength=wavelength, energy=energy) @require_keywords def xray_sld(self, energy=None, wavelength=None): """ X-ray scattering length density for the molecule. :Parameters: *energy* : float | keV Energy of atom. *wavelength* : float | |Ang| Wavelength of atom. .. Note: One of *wavelength* or *energy* is required. :Returns: *sld* : (float, float) | |1e-6/Ang^2| X-ray scattering length density is returned as the tuple (*real*, *imaginary*), or as (None, None) if the mass density is not known. .. deprecated:: 0.95 Use periodictable.xray_sld(formula) instead. """ from .xsf import xray_sld if self.density is None: return None, None return xray_sld(self.atoms, density=self.density, wavelength=wavelength, energy=energy) def change_table(self, table): """ Replace the table used for the components of the formula. """ self.structure = _change_table(self.structure, table) return self def __eq__(self, other): """ Return True if two formulas represent the same structure. Note that they may still have different names and densities. Note: use hill representation for an order independent comparison. """ if not isinstance(other, Formula): return False else: return self.structure == other.structure def __add__(self, other): """ Join two formulas. """ #print "adding", self, other if not isinstance(other, Formula): raise TypeError("expected formula+formula") ret = Formula() ret.structure = tuple(list(self.structure) + list(other.structure)) return ret def __iadd__(self, other): """ Extend a formula with another. """ self.structure = tuple(list(self.structure) + list(other.structure)) return self def __rmul__(self, other): """ Provide a multiplier for formula. """ #print "multiplying", self, other try: other += 0 except TypeError: raise TypeError("n*formula expects numeric n") ret = copy(self) if other != 1 and self.structure: if len(self.structure) == 1: q, f = self.structure[0] ret.structure = ((other*q, f), ) else: ret.structure = ((other, ret.structure), ) return ret def __str__(self): return self.name if self.name else _str_atoms(self.structure) def __repr__(self): return "formula('%s')"%(str(self)) LENGTH_UNITS = {'nm': 1e-9, 'um': 1e-6, 'mm': 1e-3, 'cm': 1e-2} MASS_UNITS = {'ng': 1e-9, 'ug': 1e-6, 'mg': 1e-3, 'g': 1e+0, 'kg': 1e+3} VOLUME_UNITS = {'nL': 1e-9, 'uL': 1e-6, 'mL': 1e-3, 'L': 1e+0} LENGTH_RE = '('+'|'.join(LENGTH_UNITS.keys())+')' MASS_VOLUME_RE = '('+'|'.join(list(MASS_UNITS.keys())+list(VOLUME_UNITS.keys()))+')' def formula_grammar(table): """ Construct a parser for molecular formulas. :Parameters: *table* = None : PeriodicTable If table is specified, then elements and their associated fields will be chosen from that periodic table rather than the default. :Returns: *parser* : pyparsing.ParserElement. The ``parser.parseString()`` method returns a list of pairs (*count, fragment*), where fragment is an *isotope*, an *element* or a list of pairs (*count, fragment*). """ # Recursive composite = Forward() mixture = Forward() # whitespace and separators space = Optional(White().suppress()) separator = space+Literal('+').suppress()+space # Lookup the element in the element table symbol = Regex("[A-Z][a-z]*") symbol = symbol.setParseAction(lambda s, l, t: table.symbol(t[0])) # Translate isotope openiso = Literal('[').suppress() closeiso = Literal(']').suppress() isotope = Optional(~White()+openiso+Regex("[1-9][0-9]*")+closeiso, default='0') isotope = isotope.setParseAction(lambda s, l, t: int(t[0]) if t[0] else 0) # Translate ion openion = Literal('{').suppress() closeion = Literal('}').suppress() ion = Optional(~White() +openion +Regex("([1-9][0-9]*)?[+-]") +closeion, default='0+') ion = ion.setParseAction(lambda s, l, t: int(t[0][-1]+(t[0][:-1] if len(t[0]) > 1 else '1'))) # Translate counts fract = Regex("(0|[1-9][0-9]*|)([.][0-9]*)") fract = fract.setParseAction(lambda s, l, t: float(t[0]) if t[0] else 1) whole = Regex("[1-9][0-9]*") whole = whole.setParseAction(lambda s, l, t: int(t[0]) if t[0] else 1) count = Optional(~White()+(fract|whole), default=1) # Convert symbol, isotope, ion, count to (count, isotope) element = symbol+isotope+ion+count def convert_element(string, location, tokens): """interpret string as element""" #print "convert_element received", tokens symbol, isotope, ion, count = tokens[0:4] if isotope != 0: symbol = symbol[isotope] if ion != 0: symbol = symbol.ion[ion] return (count, symbol) element = element.setParseAction(convert_element) # Convert "count elements" to a pair implicit_group = count+OneOrMore(element) def convert_implicit(string, location, tokens): """convert count followed by fragment""" #print "implicit", tokens count = tokens[0] fragment = tokens[1:] return fragment if count == 1 else (count, fragment) implicit_group = implicit_group.setParseAction(convert_implicit) # Convert "(composite) count" to a pair opengrp = space + Literal('(').suppress() + space closegrp = space + Literal(')').suppress() + space explicit_group = opengrp + composite + closegrp + count def convert_explicit(string, location, tokens): """convert (fragment)count""" #print "explicit", tokens count = tokens[-1] fragment = tokens[:-1] return fragment if count == 1 else (count, fragment) explicit_group = explicit_group.setParseAction(convert_explicit) # Build composite from a set of groups group = implicit_group | explicit_group implicit_separator = separator | space composite << group + ZeroOrMore(implicit_separator + group) density = Literal('@').suppress() + count + Optional(Regex("[ni]"), default='i') compound = composite + Optional(density, default=None) def convert_compound(string, location, tokens): """convert material @ density""" #print "compound", tokens if tokens[-1] is None: return Formula(structure=_immutable(tokens[:-1])) elif tokens[-1] == 'n': return Formula(structure=_immutable(tokens[:-2]), natural_density=tokens[-2]) else: return Formula(structure=_immutable(tokens[:-2]), density=tokens[-2]) compound = compound.setParseAction(convert_compound) partsep = space + Literal('//').suppress() + space percent = Literal('%').suppress() weight_percent = Regex("%(w((eigh)?t)?|m(ass)?)").suppress() + space by_weight = (count + weight_percent + mixture + ZeroOrMore(partsep+count+(weight_percent|percent)+mixture) + partsep + mixture) def convert_by_weight(string, location, tokens): """convert mixture by %wt or %mass""" #print "by weight", tokens piece = tokens[1:-1:2] + [tokens[-1]] fract = [float(v) for v in tokens[:-1:2]] fract.append(100-sum(fract)) #print piece, fract if len(piece) != len(fract): raise ValueError("Missing base component of mixture") if fract[-1] < 0: raise ValueError("Formula percentages must sum to less than 100%") return _mix_by_weight_pairs(zip(piece, fract)) mixture_by_weight = by_weight.setParseAction(convert_by_weight) volume_percent = Regex("%v(ol(ume)?)?").suppress() + space by_volume = (count + volume_percent + mixture + ZeroOrMore(partsep+count+(volume_percent|percent)+mixture) + partsep + mixture) def convert_by_volume(string, location, tokens): """convert mixture by %vol""" #print "by volume", tokens piece = tokens[1:-1:2] + [tokens[-1]] fract = [float(v) for v in tokens[:-1:2]] fract.append(100-sum(fract)) #print piece, fract if len(piece) != len(fract): raise ValueError("Missing base component of mixture "+string) if fract[-1] < 0: raise ValueError("Formula percentages must sum to less than 100%") return _mix_by_volume_pairs(zip(piece, fract)) mixture_by_volume = by_volume.setParseAction(convert_by_volume) mixture_by_layer = Forward() layer_thick = Group(count + Regex(LENGTH_RE) + space) layer_part = (layer_thick + mixture) | (opengrp + mixture_by_layer + closegrp +count) mixture_by_layer << layer_part + ZeroOrMore(partsep + layer_part) def convert_by_layer(string, location, tokens): """convert layer thickness '# nm material'""" if len(tokens) < 2: return tokens piece = [] fract = [] for p1, p2 in zip(tokens[0::2], tokens[1::2]): if isinstance(p1, Formula): f = p1.absthick * float(p2) p = p1 else: f = float(p1[0]) * LENGTH_UNITS[p1[1]] p = p2 piece.append(p) fract.append(f) total = sum(fract) vfract = [(v/total)*100 for v in fract] result = _mix_by_volume_pairs(zip(piece, vfract)) result.thickness = total return result mixture_by_layer = mixture_by_layer.setParseAction(convert_by_layer) mixture_by_absmass = Forward() absmass_mass = Group(count + Regex(MASS_VOLUME_RE) + space) absmass_part = (absmass_mass + mixture) | (opengrp + mixture_by_absmass + closegrp + count) mixture_by_absmass << absmass_part + ZeroOrMore(partsep + absmass_part) def convert_by_absmass(string, location, tokens): """convert mass '# mg material'""" if len(tokens) < 2: return tokens piece = [] fract = [] for p1, p2 in zip(tokens[0::2], tokens[1::2]): if isinstance(p1, Formula): p = p1 f = p1.total_mass * float(p2) else: p = p2 value = float(p1[0]) if p1[1] in VOLUME_UNITS: # convert to volume in liters to mass in grams before mixing if p.density is None: raise ValueError("Need the mass density of "+str(p)) f = value * VOLUME_UNITS[p1[1]] * 1000.*p.density else: f = value * MASS_UNITS[p1[1]] piece.append(p) fract.append(f) total = sum(fract) mfract = [(m/total)*100 for m in fract] result = _mix_by_weight_pairs(zip(piece, mfract)) result.total_mass = total return result mixture_by_absmass = mixture_by_absmass.setParseAction(convert_by_absmass) ungrouped_mixture = (mixture_by_weight | mixture_by_volume | mixture_by_layer | mixture_by_absmass) grouped_mixture = opengrp + ungrouped_mixture + closegrp + Optional(density, default=None) def convert_mixture(string, location, tokens): """convert (mixture) @ density""" formula = tokens[0] if tokens[-1] == 'n': formula.natural_density = tokens[-2] elif tokens[-1] == 'i': formula.density = tokens[-2] # elif tokens[-1] is None return formula grouped_mixture = grouped_mixture.setParseAction(convert_mixture) mixture << (compound | grouped_mixture) formula = (compound | ungrouped_mixture | grouped_mixture) grammar = Optional(formula, default=Formula()) + StringEnd() grammar.setName('Chemical Formula') return grammar _PARSER_CACHE = {} def parse_formula(formula_str, table=None): """ Parse a chemical formula, returning a structure with elements from the given periodic table. """ table = default_table(table) if table not in _PARSER_CACHE: _PARSER_CACHE[table] = formula_grammar(table) return _PARSER_CACHE[table].parseString(formula_str)[0] def _count_atoms(seq): """ Traverse formula structure, counting the total number of atoms. """ total = {} for count, fragment in seq: if isinstance(fragment, (list, tuple)): partial = _count_atoms(fragment) else: partial = {fragment: 1} for el, elcount in partial.items(): if el not in total: total[el] = 0 total[el] += elcount*count return total def _immutable(seq): """ Traverse formula structure, checking that the counts are numeric and units are atoms. Returns an immutable copy of the structure, with all lists replaced by tuples. """ if isatom(seq): return seq else: return tuple((count+0, _immutable(fragment)) for count, fragment in seq) def _change_table(seq, table): """Converts lists to tuples so that structure is immutable.""" if isatom(seq): return change_table(seq, table) else: return tuple((count, _change_table(fragment, table)) for count, fragment in seq) def _hill_compare(a, b): """ Compare elements in standard order. """ if a.symbol == b.symbol: a = a.isotope if isisotope(a) else 0 b = b.isotope if isisotope(b) else 0 return cmp(a, b) elif a.symbol in ("C", "H"): if b.symbol in ("C", "H"): return cmp(a.symbol, b.symbol) else: return -1 else: if b.symbol in ("C", "H"): return 1 else: return cmp(a.symbol, b.symbol) def _hill_key(a): return "".join((("0" if a.symbol in ("C", "H") else "1"), a.symbol, "%4d"%(a.isotope if isisotope(a) else 0))) def _convert_to_hill_notation(atoms): """ Return elements listed in standard order. """ #return [(atoms[el], el) for el in sorted(atoms.keys(), cmp=_hill_compare)] return [(atoms[el], el) for el in sorted(atoms.keys(), key=_hill_key)] def _str_atoms(seq): """ Convert formula structure to string. """ #print "str", seq ret = "" for count, fragment in seq: if isatom(fragment): # Normal isotope string form is #-Yy, but we want Yy[#] if isisotope(fragment) and 'symbol' not in fragment.__dict__: ret += "%s[%d]"%(fragment.symbol, fragment.isotope) else: ret += fragment.symbol if fragment.charge != 0: sign = '+' if fragment.charge > 0 else '-' value = str(abs(fragment.charge)) if abs(fragment.charge) > 1 else '' ret += '{'+value+sign+'}' if count != 1: ret += "%g"%count else: if count == 1: piece = _str_atoms(fragment) else: piece = "(%s)%g"%(_str_atoms(fragment), count) #ret = ret+" "+piece if ret else piece ret += piece return ret def _is_string_like(val): """Returns True if val acts like a string""" try: val+'' except Exception: return False return True periodictable-1.5.0/periodictable/magnetic_ff.py000066400000000000000000001460071310514471200217530ustar00rootroot00000000000000# This program is in the public domain # Author: Paul Kienzle """ Adds magnetic_ff[charge].t for t in j0, j2, j4, j6, and J. J should be the dipole approximation + (1 - 2/g) , according to the documentation for CrysFML [#Brown]_ , but that does not seem to be the case in practice. .. [#Brown] Brown. P. J. (Section 4.4.5) International Tables for Crystallography Volume C, Wilson. A. J. C.(ed). """ from __future__ import division import numpy from numpy import pi, exp def formfactor_0(j0, q): """ Returns the scattering potential for form factor *j0* at the given *q*. """ q = numpy.asarray(q) s_sq = (q/(4*pi))**2 A, a, B, b, C, c, D = j0 return A * exp(-a*s_sq) + B * exp(-b*s_sq) + C * exp(-c*s_sq) + D def formfactor_n(jn, q): """ Returns the scattering potential for form factor *jn* at the given *q*. """ q = numpy.asarray(q) s_sq = (q/(4*pi))**2 A, a, B, b, C, c, D = jn return s_sq * (A * exp(-a*s_sq) + B * exp(-b*s_sq) + C * exp(-c*s_sq) + D) class MagneticFormFactor(object): """ Magnetic form factor for the ion. The available form factors are:: M = form factor coefficients J = + C2 form factor coeffients jn = form factor coefficients for n = 0, 2, 4, 6 Not all form factors are available for all ions. Use the expression ``hasattr(ion.magnetic_ff, '')`` to test for the particular form factor . The form factor coefficients are a tuple (A, a, B, b, C, c, D). The following expression computes the M/j0 and J form factors from the corresponding coefficients:: s = q^2 / 16 pi^2 ff = A exp(-a s^2) + B exp(-b s^2) + C exp(-c s^2) + D The remaining form factors *j2*, *j4* and *j6* are scalled by an additional s^2. The form factor calculation is performed by the _Q method for in *M*, *J*, *j0*, *j2*, *j4*, *j6*. For example, here is the calculation for the *M* form factor for Fe^2+ computed at 0, 0.1 and 0.2: .. doctest:: >>> import periodictable >>> ion = periodictable.Fe.ion[2] >>> print(ion.magnetic_ff[ion.charge].M_Q([0, 0.1, 0.2])) [ 1. 0.99935255 0.99741366] """ def _getM(self): return self.j0 M = property(_getM, doc="j0") def j0_Q(self, Q): """Returns *j0* scattering potential at *Q* |1/Ang|""" return formfactor_0(self.j0, Q) def j2_Q(self, Q): """Returns *j2* scattering potential at *Q* |1/Ang|""" return formfactor_n(self.j2, Q) def j4_Q(self, Q): """Returns *j4* scattering potential at *Q* |1/Ang|""" return formfactor_n(self.j4, Q) def j6_Q(self, Q): """Returns j6 scattering potential at *Q* |1/Ang|""" return formfactor_n(self.j6, Q) def J_Q(self, Q): """Returns J scattering potential at *Q* |1/Ang|""" return formfactor_0(self.J, Q) M_Q = j0_Q def init(table, reload=False): """Add magnetic form factor properties to the periodic table""" if 'magnetic_ff' in table.properties and not reload: return table.properties.append('magnetic_ff') # Function for interpreting ionization state and form factor tuple def Magnetic_Form_Type(state, values): return state, values # Remove fortran continuation character, which is & at the end of the line data = CFML_DATA.replace('&\n', '') # Parse each line for line in data.split('\n'): # Skip blank lines and comment lines line = line.strip() if '=' not in line: continue # Remaining lines contain one of: # Magnetic_Form(n) = Magnetic_Form_Type("M", (/FF/)) # Magnetic_Form(n) = Magnetic_Form_Type("J", (/FF/)) # Magnetic_j2(n) = Magnetic_Form_Type("", (/FF/)) # Magnetic_j4(n) = Magnetic_Form_Type("", (/FF/)) # Magnetic_j6(n) = Magnetic_Form_Type("", (/FF/)) # The 'M' form is just j0. The 'J' form should be j0 + (1-g/2)j2. # Split the two parts, remove the slash and figure out if we have # j0, j2, j4, j6 or J. a, b = line.split('=') b = b.replace('/', '') # The following eval is used for parsing the CFM_DATA table defined # below, so there is no risk that it can be invoked from a web # service with a user-defined malicious string. state, values = eval(b) # eval checked for malicious usage if a.startswith('Magnetic_Form'): jn = "j0" if state[0] == 'M' else "J" state = state[1:] elif a.startswith('Magnetic_j2'): jn = "j2" elif a.startswith('Magnetic_j4'): jn = "j4" elif a.startswith('Magnetic_j6'): jn = "j6" # Parse into element symbol and ion state if state[1].isdigit(): symbol = state[0] charge = int(state[1]) else: symbol = state[0:2].capitalize() charge = int(state[2]) # Add the magnetic form factor info to the element el = table.symbol(symbol) if not hasattr(el, 'magnetic_ff'): el.magnetic_ff = {} if charge not in el.magnetic_ff: el.magnetic_ff[charge] = MagneticFormFactor() setattr(el.magnetic_ff[charge], jn, values) CFML_DATA = """ Magnetic_Form( 1) = Magnetic_Form_Type("MSC0", & (/ 0.251200, 90.029602, 0.329000, 39.402100, 0.423500, 14.322200, -0.004300/) ) Magnetic_Form( 2) = Magnetic_Form_Type("MSC1", & (/ 0.488900, 51.160301, 0.520300, 14.076400, -0.028600, 0.179200, 0.018500/) ) Magnetic_Form( 3) = Magnetic_Form_Type("MSC2", & (/ 0.504800, 31.403500, 0.518600, 10.989700, -0.024100, 1.183100, 0.000000/) ) Magnetic_Form( 4) = Magnetic_Form_Type("MTI0", & (/ 0.465700, 33.589802, 0.549000, 9.879100, -0.029100, 0.323200, 0.012300/) ) Magnetic_Form( 5) = Magnetic_Form_Type("MTI1", & (/ 0.509300, 36.703300, 0.503200, 10.371300, -0.026300, 0.310600, 0.011600/) ) Magnetic_Form( 6) = Magnetic_Form_Type("MTI2", & (/ 0.509100, 24.976299, 0.516200, 8.756900, -0.028100, 0.916000, 0.001500/) ) Magnetic_Form( 7) = Magnetic_Form_Type("MTI3", & (/ 0.357100, 22.841299, 0.668800, 8.930600, -0.035400, 0.483300, 0.009900/) ) Magnetic_Form( 8) = Magnetic_Form_Type("MV0 ", & (/ 0.408600, 28.810900, 0.607700, 8.543700, -0.029500, 0.276800, 0.012300/) ) Magnetic_Form( 9) = Magnetic_Form_Type("MV1 ", & (/ 0.444400, 32.647900, 0.568300, 9.097100, -0.228500, 0.021800, 0.215000/) ) Magnetic_Form( 10) = Magnetic_Form_Type("MV2 ", & (/ 0.408500, 23.852600, 0.609100, 8.245600, -0.167600, 0.041500, 0.149600/) ) Magnetic_Form( 11) = Magnetic_Form_Type("MV3 ", & (/ 0.359800, 19.336399, 0.663200, 7.617200, -0.306400, 0.029600, 0.283500/) ) Magnetic_Form( 12) = Magnetic_Form_Type("MV4 ", & (/ 0.310600, 16.816000, 0.719800, 7.048700, -0.052100, 0.302000, 0.022100/) ) Magnetic_Form( 13) = Magnetic_Form_Type("MCR0", & (/ 0.113500, 45.199001, 0.348100, 19.493099, 0.547700, 7.354200, -0.009200/) ) Magnetic_Form( 14) = Magnetic_Form_Type("MCR1", & (/ -0.097700, 0.047000, 0.454400, 26.005400, 0.557900, 7.489200, 0.083100/) ) Magnetic_Form( 15) = Magnetic_Form_Type("MCR2", & (/ 1.202400, -0.005500, 0.415800, 20.547501, 0.603200, 6.956000, -1.221800/) ) Magnetic_Form( 16) = Magnetic_Form_Type("MCR3", & (/ -0.309400, 0.027400, 0.368000, 17.035500, 0.655900, 6.523600, 0.285600/) ) Magnetic_Form( 17) = Magnetic_Form_Type("MCR4", & (/ -0.232000, 0.043300, 0.310100, 14.951800, 0.718200, 6.172600, 0.204200/) ) Magnetic_Form( 18) = Magnetic_Form_Type("MMN0", & (/ 0.243800, 24.962900, 0.147200, 15.672800, 0.618900, 6.540300, -0.010500/) ) Magnetic_Form( 19) = Magnetic_Form_Type("MMN1", & (/ -0.013800, 0.421300, 0.423100, 24.667999, 0.590500, 6.654500, -0.001000/) ) Magnetic_Form( 20) = Magnetic_Form_Type("MMN2", & (/ 0.422000, 17.684000, 0.594800, 6.005000, 0.004300, -0.609000, -0.021900/) ) Magnetic_Form( 21) = Magnetic_Form_Type("MMN3", & (/ 0.419800, 14.282900, 0.605400, 5.468900, 0.924100, -0.008800, -0.949800/) ) Magnetic_Form( 22) = Magnetic_Form_Type("MMN4", & (/ 0.376000, 12.566100, 0.660200, 5.132900, -0.037200, 0.563000, 0.001100/) ) Magnetic_Form( 23) = Magnetic_Form_Type("MFE0", & (/ 0.070600, 35.008499, 0.358900, 15.358300, 0.581900, 5.560600, -0.011400/) ) Magnetic_Form( 24) = Magnetic_Form_Type("MFE1", & (/ 0.125100, 34.963299, 0.362900, 15.514400, 0.522300, 5.591400, -0.010500/) ) Magnetic_Form( 25) = Magnetic_Form_Type("MFE2", & (/ 0.026300, 34.959702, 0.366800, 15.943500, 0.618800, 5.593500, -0.011900/) ) Magnetic_Form( 26) = Magnetic_Form_Type("MFE3", & (/ 0.397200, 13.244200, 0.629500, 4.903400, -0.031400, 0.349600, 0.004400/) ) Magnetic_Form( 27) = Magnetic_Form_Type("MFE4", & (/ 0.378200, 11.380000, 0.655600, 4.592000, -0.034600, 0.483300, 0.000500/) ) Magnetic_Form( 28) = Magnetic_Form_Type("MCO0", & (/ 0.413900, 16.161600, 0.601300, 4.780500, -0.151800, 0.021000, 0.134500/) ) Magnetic_Form( 29) = Magnetic_Form_Type("MCO1", & (/ 0.099000, 33.125198, 0.364500, 15.176800, 0.547000, 5.008100, -0.010900/) ) Magnetic_Form( 30) = Magnetic_Form_Type("MCO2", & (/ 0.433200, 14.355300, 0.585700, 4.607700, -0.038200, 0.133800, 0.017900/) ) Magnetic_Form( 31) = Magnetic_Form_Type("MCO3", & (/ 0.390200, 12.507800, 0.632400, 4.457400, -0.150000, 0.034300, 0.127200/) ) Magnetic_Form( 32) = Magnetic_Form_Type("MCO4", & (/ 0.351500, 10.778500, 0.677800, 4.234300, -0.038900, 0.240900, 0.009800/) ) Magnetic_Form( 33) = Magnetic_Form_Type("MNI0", & (/ -0.017200, 35.739201, 0.317400, 14.268900, 0.713600, 4.566100, -0.014300/) ) Magnetic_Form( 34) = Magnetic_Form_Type("MNI1", & (/ 0.070500, 35.856098, 0.398400, 13.804200, 0.542700, 4.396500, -0.011800/) ) Magnetic_Form( 35) = Magnetic_Form_Type("MNI2", & (/ 0.016300, 35.882599, 0.391600, 13.223300, 0.605200, 4.338800, -0.013300/) ) Magnetic_Form( 36) = Magnetic_Form_Type("MNI3", & (/ -0.013400, 35.867699, 0.267800, 12.332600, 0.761400, 4.236900, -0.016200/) ) Magnetic_Form( 37) = Magnetic_Form_Type("MNI4", & (/ -0.009000, 35.861401, 0.277600, 11.790400, 0.747400, 4.201100, -0.016300/) ) Magnetic_Form( 38) = Magnetic_Form_Type("MCU0", & (/ 0.090900, 34.983799, 0.408800, 11.443200, 0.512800, 3.824800, -0.012400/) ) Magnetic_Form( 39) = Magnetic_Form_Type("MCU1", & (/ 0.074900, 34.965599, 0.414700, 11.764200, 0.523800, 3.849700, -0.012700/) ) Magnetic_Form( 40) = Magnetic_Form_Type("MCU2", & (/ 0.023200, 34.968601, 0.402300, 11.564000, 0.588200, 3.842800, -0.013700/) ) Magnetic_Form( 41) = Magnetic_Form_Type("MCU3", & (/ 0.003100, 34.907398, 0.358200, 10.913800, 0.653100, 3.827900, -0.014700/) ) Magnetic_Form( 42) = Magnetic_Form_Type("MCU4", & (/ -0.013200, 30.681700, 0.280100, 11.162600, 0.749000, 3.817200, -0.016500/) ) Magnetic_Form( 43) = Magnetic_Form_Type("MY0 ", & (/ 0.591500, 67.608101, 1.512300, 17.900400, -1.113000, 14.135900, 0.008000/) ) Magnetic_Form( 44) = Magnetic_Form_Type("MZR0", & (/ 0.410600, 59.996101, 1.054300, 18.647600, -0.475100, 10.540000, 0.010600/) ) Magnetic_Form( 45) = Magnetic_Form_Type("MZR1", & (/ 0.453200, 59.594799, 0.783400, 21.435699, -0.245100, 9.036000, 0.009800/) ) Magnetic_Form( 46) = Magnetic_Form_Type("MNB0", & (/ 0.394600, 49.229698, 1.319700, 14.821600, -0.726900, 9.615600, 0.012900/) ) Magnetic_Form( 47) = Magnetic_Form_Type("MNB1", & (/ 0.457200, 49.918201, 1.027400, 15.725600, -0.496200, 9.157300, 0.011800/) ) Magnetic_Form( 48) = Magnetic_Form_Type("MMO0", & (/ 0.180600, 49.056801, 1.230600, 14.785900, -0.426800, 6.986600, 0.017100/) ) Magnetic_Form( 49) = Magnetic_Form_Type("MMO1", & (/ 0.350000, 48.035400, 1.030500, 15.060400, -0.392900, 7.479000, 0.013900/) ) Magnetic_Form( 50) = Magnetic_Form_Type("MTC0", & (/ 0.129800, 49.661098, 1.165600, 14.130700, -0.313400, 5.512900, 0.019500/) ) Magnetic_Form( 51) = Magnetic_Form_Type("MTC1", & (/ 0.267400, 48.956600, 0.956900, 15.141300, -0.238700, 5.457800, 0.016000/) ) Magnetic_Form( 52) = Magnetic_Form_Type("MRU0", & (/ 0.106900, 49.423801, 1.191200, 12.741700, -0.317600, 4.912500, 0.021300/) ) Magnetic_Form( 53) = Magnetic_Form_Type("MRU1", & (/ 0.441000, 33.308601, 1.477500, 9.553100, -0.936100, 6.722000, 0.017600/) ) Magnetic_Form( 54) = Magnetic_Form_Type("MRH0", & (/ 0.097600, 49.882500, 1.160100, 11.830700, -0.278900, 4.126600, 0.023400/) ) Magnetic_Form( 55) = Magnetic_Form_Type("MRH1", & (/ 0.334200, 29.756399, 1.220900, 9.438400, -0.575500, 5.332000, 0.021000/) ) Magnetic_Form( 56) = Magnetic_Form_Type("MPD0", & (/ 0.200300, 29.363300, 1.144600, 9.599300, -0.368900, 4.042300, 0.025100/) ) Magnetic_Form( 57) = Magnetic_Form_Type("MPD1", & (/ 0.503300, 24.503700, 1.998200, 6.908200, -1.524000, 5.513300, 0.021300/) ) Magnetic_Form( 58) = Magnetic_Form_Type("MCE2", & (/ 0.295300, 17.684601, 0.292300, 6.732900, 0.431300, 5.382700, -0.019400/) ) Magnetic_Form( 59) = Magnetic_Form_Type("MND2", & (/ 0.164500, 25.045300, 0.252200, 11.978200, 0.601200, 4.946100, -0.018000/) ) Magnetic_Form( 60) = Magnetic_Form_Type("MND3", & (/ 0.054000, 25.029301, 0.310100, 12.102000, 0.657500, 4.722300, -0.021600/) ) Magnetic_Form( 61) = Magnetic_Form_Type("MSM2", & (/ 0.090900, 25.203199, 0.303700, 11.856200, 0.625000, 4.236600, -0.020000/) ) Magnetic_Form( 62) = Magnetic_Form_Type("MSM3", & (/ 0.028800, 25.206800, 0.297300, 11.831100, 0.695400, 4.211700, -0.021300/) ) Magnetic_Form( 63) = Magnetic_Form_Type("MEU2", & (/ 0.075500, 25.296000, 0.300100, 11.599300, 0.643800, 4.025200, -0.019600/) ) Magnetic_Form( 64) = Magnetic_Form_Type("MEU3", & (/ 0.020400, 25.307800, 0.301000, 11.474400, 0.700500, 3.942000, -0.022000/) ) Magnetic_Form( 65) = Magnetic_Form_Type("MGD2", & (/ 0.063600, 25.382299, 0.303300, 11.212500, 0.652800, 3.787700, -0.019900/) ) Magnetic_Form( 66) = Magnetic_Form_Type("MGD3", & (/ 0.018600, 25.386700, 0.289500, 11.142100, 0.713500, 3.752000, -0.021700/) ) Magnetic_Form( 67) = Magnetic_Form_Type("MTB2", & (/ 0.054700, 25.508600, 0.317100, 10.591100, 0.649000, 3.517100, -0.021200/) ) Magnetic_Form( 68) = Magnetic_Form_Type("MTB3", & (/ 0.017700, 25.509501, 0.292100, 10.576900, 0.713300, 3.512200, -0.023100/) ) Magnetic_Form( 69) = Magnetic_Form_Type("MDY2", & (/ 0.130800, 18.315500, 0.311800, 7.664500, 0.579500, 3.146900, -0.022600/) ) Magnetic_Form( 70) = Magnetic_Form_Type("MDY3", & (/ 0.115700, 15.073200, 0.327000, 6.799100, 0.582100, 3.020200, -0.024900/) ) Magnetic_Form( 71) = Magnetic_Form_Type("MHO2", & (/ 0.099500, 18.176100, 0.330500, 7.855600, 0.592100, 2.979900, -0.023000/) ) Magnetic_Form( 72) = Magnetic_Form_Type("MHO3", & (/ 0.056600, 18.317600, 0.336500, 7.688000, 0.631700, 2.942700, -0.024800/) ) Magnetic_Form( 73) = Magnetic_Form_Type("MER2", & (/ 0.112200, 18.122299, 0.346200, 6.910600, 0.564900, 2.761400, -0.023500/) ) Magnetic_Form( 74) = Magnetic_Form_Type("MER3", & (/ 0.058600, 17.980200, 0.354000, 7.096400, 0.612600, 2.748200, -0.025100/) ) Magnetic_Form( 75) = Magnetic_Form_Type("MTM2", & (/ 0.098300, 18.323601, 0.338000, 6.917800, 0.587500, 2.662200, -0.024100/) ) Magnetic_Form( 76) = Magnetic_Form_Type("MTM3", & (/ 0.058100, 15.092200, 0.278700, 7.801500, 0.685400, 2.793100, -0.022400/) ) Magnetic_Form( 77) = Magnetic_Form_Type("MYB2", & (/ 0.085500, 18.512300, 0.294300, 7.373400, 0.641200, 2.677700, -0.021300/) ) Magnetic_Form( 78) = Magnetic_Form_Type("MYB3", & (/ 0.041600, 16.094900, 0.284900, 7.834100, 0.696100, 2.672500, -0.022900/) ) Magnetic_Form( 79) = Magnetic_Form_Type("MU3 ", & (/ 0.505800, 23.288200, 1.346400, 7.002800, -0.872400, 4.868300, 0.019200/) ) Magnetic_Form( 80) = Magnetic_Form_Type("MU4 ", & (/ 0.329100, 23.547501, 1.083600, 8.454000, -0.434000, 4.119600, 0.021400/) ) Magnetic_Form( 81) = Magnetic_Form_Type("MU5 ", & (/ 0.365000, 19.803801, 3.219900, 6.281800, -2.607700, 5.301000, 0.023300/) ) Magnetic_Form( 82) = Magnetic_Form_Type("MNP3", & (/ 0.515700, 20.865400, 2.278400, 5.893000, -1.816300, 4.845700, 0.021100/) ) Magnetic_Form( 83) = Magnetic_Form_Type("MNP4", & (/ 0.420600, 19.804600, 2.800400, 5.978300, -2.243600, 4.984800, 0.022800/) ) Magnetic_Form( 84) = Magnetic_Form_Type("MNP5", & (/ 0.369200, 18.190001, 3.151000, 5.850000, -2.544600, 4.916400, 0.024800/) ) Magnetic_Form( 85) = Magnetic_Form_Type("MNP6", & (/ 0.292900, 17.561100, 3.486600, 5.784700, -2.806600, 4.870700, 0.026700/) ) Magnetic_Form( 86) = Magnetic_Form_Type("MPU3", & (/ 0.384000, 16.679300, 3.104900, 5.421000, -2.514800, 4.551200, 0.026300/) ) Magnetic_Form( 87) = Magnetic_Form_Type("MPU4", & (/ 0.493400, 16.835501, 1.639400, 5.638400, -1.158100, 4.139900, 0.024800/) ) Magnetic_Form( 88) = Magnetic_Form_Type("MPU5", & (/ 0.388800, 16.559200, 2.036200, 5.656700, -1.451500, 4.255200, 0.026700/) ) Magnetic_Form( 89) = Magnetic_Form_Type("MPU6", & (/ 0.317200, 16.050699, 3.465400, 5.350700, -2.810200, 4.513300, 0.028100/) ) Magnetic_Form( 90) = Magnetic_Form_Type("MAM2", & (/ 0.474300, 21.776100, 1.580000, 5.690200, -1.077900, 4.145100, 0.021800/) ) Magnetic_Form( 91) = Magnetic_Form_Type("MAM3", & (/ 0.423900, 19.573900, 1.457300, 5.872200, -0.905200, 3.968200, 0.023800/) ) Magnetic_Form( 92) = Magnetic_Form_Type("MAM4", & (/ 0.373700, 17.862499, 1.352100, 6.042600, -0.751400, 3.719900, 0.025800/) ) Magnetic_Form( 93) = Magnetic_Form_Type("MAM5", & (/ 0.295600, 17.372499, 1.452500, 6.073400, -0.775500, 3.661900, 0.027700/) ) Magnetic_Form( 94) = Magnetic_Form_Type("MAM6", & (/ 0.230200, 16.953300, 1.486400, 6.115900, -0.745700, 3.542600, 0.029400/) ) Magnetic_Form( 95) = Magnetic_Form_Type("MAM7", & (/ 0.360100, 12.729900, 1.964000, 5.120300, -1.356000, 3.714200, 0.031600/) ) Magnetic_Form( 96) = Magnetic_Form_Type("MPR3", & (/ 0.050400, 24.998900, 0.257200, 12.037700, 0.714200, 5.003900, -0.021900/) ) Magnetic_Form( 97) = Magnetic_Form_Type("MO1", & (/ 0.115285, 85.197300, 0.556229, 25.252200, 0.332476, 6.362070, -0.00460676/) ) Magnetic_Form( 98) = Magnetic_Form_Type("JCE2", & (/ 0.031972, 8.926222, 0.265792, 7.678510, 0.682151, 2.329783, 0.020578/) ) Magnetic_Form( 99) = Magnetic_Form_Type("JCE3", & (/ 0.051183, 6.115375, 0.277738, 7.952485, 0.654079, 2.287000, 0.016355/) ) Magnetic_Form(100) = Magnetic_Form_Type("JPR3", & (/ 0.023288, 0.582954, 0.349391, 5.601756, 0.615363, 1.932779, 0.011454/) ) Magnetic_Form(101) = Magnetic_Form_Type("JND2", & (/ 0.089354, 2.282004, 0.206157, 1.708607, 0.669916, 2.297662, 0.048390/) ) Magnetic_Form(102) = Magnetic_Form_Type("JND3", & (/ 0.073287, 4.412361, 0.371485, 4.019648, 0.539459, 1.557985, 0.017335/) ) Magnetic_Form(103) = Magnetic_Form_Type("JGD3", & (/ 0.060537, 10.775218, 0.271475, 13.097898, 0.665241, 3.162837, 0.001566/) ) Magnetic_Form(104) = Magnetic_Form_Type("JTB2", & (/ 0.049801, 18.734161, 0.277437, 10.084129, 0.661194, 2.745624, 0.010774/) ) Magnetic_Form(105) = Magnetic_Form_Type("JTB3", & (/ 0.049792, 15.112189, 0.270644, 9.158312, 0.679388, 2.880260, -0.000131/) ) Magnetic_Form(106) = Magnetic_Form_Type("JDY2", & (/ 0.175586, 5.938148, 0.228867, 11.464046, 0.583298, 2.167554, 0.011186/) ) Magnetic_Form(107) = Magnetic_Form_Type("JDY3", & (/ 0.146536, 12.639305, 0.375822, 5.511785, 0.515731, 2.090789, 0.093576/) ) Magnetic_Form(108) = Magnetic_Form_Type("JHO2", & (/ 0.023234, 0.703240, 0.270745, 9.993475, 0.677581, 2.521403, 0.027101/) ) Magnetic_Form(109) = Magnetic_Form_Type("JHO2", & (/ 0.023234, 0.703240, 0.270745, 9.993475, 0.677581, 2.521403, 0.027101/) ) Magnetic_Form(110) = Magnetic_Form_Type("JHO3", & (/ 0.043204, 0.910121, 0.279392, 8.683387, 0.668537, 2.417518, 0.008207/) ) Magnetic_Form(111) = Magnetic_Form_Type("JER2", & (/ 0.037734, 6.081446, 0.256447, 9.598846, 0.679204, 2.139296, 0.025543/) ) Magnetic_Form(112) = Magnetic_Form_Type("JER3", & (/ 0.038871, 5.311772, 0.259781, 8.173226, 0.678414, 2.082836, 0.022169/) ) Magnetic_Form(113) = Magnetic_Form_Type("JTM2", & (/ 0.037670, 4.455198, 0.254184, 9.151058, 0.677308, 2.021746, 0.029718/) ) Magnetic_Form(114) = Magnetic_Form_Type("JTM3", & (/ 0.028279, 2.291633, 0.265583, 7.776700, 0.675720, 2.018924, 0.029883/) ) Magnetic_Form(115) = Magnetic_Form_Type("JYB3", & (/ 0.092380, 2.046342, 0.258408, 7.471918, 0.609716, 1.913869, 0.038824/) ) Magnetic_Form(116) = Magnetic_Form_Type("JO1 ", & (/ 0.115285, 85.197300, 0.556229, 25.252200, 0.332476, 6.362070,-0.00460676/) ) !---- Coefficients ----! Magnetic_j2( 1) = Magnetic_Form_Type("SC0 ",(/10.8172,54.327, 4.7353,14.847, 0.6071, 4.218, 0.0011/)) Magnetic_j2( 2) = Magnetic_Form_Type("SC1 ",(/ 8.5021,34.285, 3.2116,10.994, 0.4244, 3.605, 0.0009/)) Magnetic_j2( 3) = Magnetic_Form_Type("SC2 ",(/ 4.3683,28.654, 3.7231,10.823, 0.6074, 3.668, 0.0014/)) Magnetic_j2( 4) = Magnetic_Form_Type("TI0 ",(/ 4.3583,36.056, 3.8230,11.133, 0.6855, 3.469, 0.0020/)) Magnetic_j2( 5) = Magnetic_Form_Type("TI1 ",(/ 6.1567,27.275, 2.6833, 8.983, 0.4070, 3.052, 0.0011/)) Magnetic_j2( 6) = Magnetic_Form_Type("TI2 ",(/ 4.3107,18.348, 2.0960, 6.797, 0.2984, 2.548, 0.0007/)) Magnetic_j2( 7) = Magnetic_Form_Type("TI3 ",(/ 3.3717,14.444, 1.8258, 5.713, 0.2470, 2.265, 0.0005/)) Magnetic_j2( 8) = Magnetic_Form_Type("V0 ",(/ 3.8099,21.347, 2.3295, 7.409, 0.4333, 2.632, 0.0015/)) Magnetic_j2( 9) = Magnetic_Form_Type("V1 ",(/ 4.7474,23.323, 2.3609, 7.808, 0.4105, 2.706, 0.0014/)) Magnetic_j2( 10) = Magnetic_Form_Type("V2 ",(/ 3.4386,16.530, 1.9638, 6.141, 0.2997, 2.267, 0.0009/)) Magnetic_j2( 11) = Magnetic_Form_Type("V3 ",(/ 2.3005,14.682, 2.0364, 6.130, 0.4099, 2.382, 0.0014/)) Magnetic_j2( 12) = Magnetic_Form_Type("V4 ",(/ 1.8377,12.267, 1.8247, 5.458, 0.3979, 2.248, 0.0012/)) Magnetic_j2( 13) = Magnetic_Form_Type("CR0 ",(/ 3.4085,20.127, 2.1006, 6.802, 0.4266, 2.394, 0.0019/)) Magnetic_j2( 14) = Magnetic_Form_Type("CR1 ",(/ 3.7768,20.346, 2.1028, 6.893, 0.4010, 2.411, 0.0017/)) Magnetic_j2( 15) = Magnetic_Form_Type("CR2 ",(/ 2.6422,16.060, 1.9198, 6.253, 0.4446, 2.372, 0.0020/)) Magnetic_j2( 16) = Magnetic_Form_Type("CR3 ",(/ 1.6262,15.066, 2.0618, 6.284, 0.5281, 2.368, 0.0023/)) Magnetic_j2( 17) = Magnetic_Form_Type("CR4 ",(/ 1.0293,13.950, 1.9933, 6.059, 0.5974, 2.346, 0.0027/)) Magnetic_j2( 18) = Magnetic_Form_Type("MN0 ",(/ 2.6681,16.060, 1.7561, 5.640, 0.3675, 2.049, 0.0017/)) Magnetic_j2( 19) = Magnetic_Form_Type("MN1 ",(/ 3.2953,18.695, 1.8792, 6.240, 0.3927, 2.201, 0.0022/)) Magnetic_j2( 20) = Magnetic_Form_Type("MN2 ",(/ 2.0515,15.556, 1.8841, 6.063, 0.4787, 2.232, 0.0027/)) Magnetic_j2( 21) = Magnetic_Form_Type("MN3 ",(/ 1.2427,14.997, 1.9567, 6.118, 0.5732, 2.258, 0.0031/)) Magnetic_j2( 22) = Magnetic_Form_Type("MN4 ",(/ 0.7879,13.886, 1.8717, 5.743, 0.5981, 2.182, 0.0034/)) Magnetic_j2( 23) = Magnetic_Form_Type("FE0 ",(/ 1.9405,18.473, 1.9566, 6.323, 0.5166, 2.161, 0.0036/)) Magnetic_j2( 24) = Magnetic_Form_Type("FE1 ",(/ 2.6290,18.660, 1.8704, 6.331, 0.4690, 2.163, 0.0031/)) Magnetic_j2( 25) = Magnetic_Form_Type("FE2 ",(/ 1.6490,16.559, 1.9064, 6.133, 0.5206, 2.137, 0.0035/)) Magnetic_j2( 26) = Magnetic_Form_Type("FE3 ",(/ 1.3602,11.998, 1.5188, 5.003, 0.4705, 1.991, 0.0038/)) Magnetic_j2( 27) = Magnetic_Form_Type("FE4 ",(/ 1.5582, 8.275, 1.1863, 3.279, 0.1366, 1.107,-0.0022/)) Magnetic_j2( 28) = Magnetic_Form_Type("CO0 ",(/ 1.9678,14.170, 1.4911, 4.948, 0.3844, 1.797, 0.0027/)) Magnetic_j2( 29) = Magnetic_Form_Type("CO1 ",(/ 2.4097,16.161, 1.5780, 5.460, 0.4095, 1.914, 0.0031/)) Magnetic_j2( 30) = Magnetic_Form_Type("CO2 ",(/ 1.9049,11.644, 1.3159, 4.357, 0.3146, 1.645, 0.0017/)) Magnetic_j2( 31) = Magnetic_Form_Type("CO3 ",(/ 1.7058, 8.859, 1.1409, 3.309, 0.1474, 1.090,-0.0025/)) Magnetic_j2( 32) = Magnetic_Form_Type("CO4 ",(/ 1.3110, 8.025, 1.1551, 3.179, 0.1608, 1.130,-0.0011/)) Magnetic_j2( 33) = Magnetic_Form_Type("NI0 ",(/ 1.0302,12.252, 1.4669, 4.745, 0.4521, 1.744, 0.0036/)) Magnetic_j2( 34) = Magnetic_Form_Type("NI1 ",(/ 2.1040,14.866, 1.4302, 5.071, 0.4031, 1.778, 0.0034/)) Magnetic_j2( 35) = Magnetic_Form_Type("NI2 ",(/ 1.7080,11.016, 1.2147, 4.103, 0.3150, 1.533, 0.0018/)) Magnetic_j2( 36) = Magnetic_Form_Type("NI3 ",(/ 1.1612, 7.700, 1.0027, 3.263, 0.2719, 1.378, 0.0025/)) Magnetic_j2( 37) = Magnetic_Form_Type("NI4 ",(/ 1.1612, 7.700, 1.0027, 3.263, 0.2719, 1.378, 0.0025/)) Magnetic_j2( 38) = Magnetic_Form_Type("CU0 ",(/ 1.9182,14.490, 1.3329, 4.730, 0.3842, 1.639, 0.0035/)) Magnetic_j2( 39) = Magnetic_Form_Type("CU1 ",(/ 1.8814,13.433, 1.2809, 4.545, 0.3646, 1.602, 0.0033/)) Magnetic_j2( 40) = Magnetic_Form_Type("CU2 ",(/ 1.5189,10.478, 1.1512, 3.813, 0.2918, 1.398, 0.0017/)) Magnetic_j2( 41) = Magnetic_Form_Type("CU3 ",(/ 1.2797, 8.450, 1.0315, 3.280, 0.2401, 1.250, 0.0015/)) Magnetic_j2( 42) = Magnetic_Form_Type("CU4 ",(/ 0.9568, 7.448, 0.9099, 3.396, 0.3729, 1.494, 0.0049/)) Magnetic_j2( 43) = Magnetic_Form_Type("Y0 ",(/14.4084,44.658, 5.1045,14.904,-0.0535, 3.319, 0.0028/)) Magnetic_j2( 44) = Magnetic_Form_Type("ZR0 ",(/10.1378,35.337, 4.7734,12.545,-0.0489, 2.672, 0.0036/)) Magnetic_j2( 45) = Magnetic_Form_Type("ZR1 ",(/11.8722,34.920, 4.0502,12.127,-0.0632, 2.828, 0.0034/)) Magnetic_j2( 46) = Magnetic_Form_Type("NB0 ",(/ 7.4796,33.179, 5.0884,11.571,-0.0281, 1.564, 0.0047/)) Magnetic_j2( 47) = Magnetic_Form_Type("NB1 ",(/ 8.7735,33.285, 4.6556,11.605,-0.0268, 1.539, 0.0044/)) Magnetic_j2( 48) = Magnetic_Form_Type("MO0 ",(/ 5.1180,23.422, 4.1809, 9.208,-0.0505, 1.743, 0.0053/)) Magnetic_j2( 49) = Magnetic_Form_Type("MO1 ",(/ 7.2367,28.128, 4.0705, 9.923,-0.0317, 1.455, 0.0049/)) Magnetic_j2( 50) = Magnetic_Form_Type("TC0 ",(/ 4.2441,21.397, 3.9439, 8.375,-0.0371, 1.187, 0.0066/)) Magnetic_j2( 51) = Magnetic_Form_Type("TC1 ",(/ 6.4056,24.824, 3.5400, 8.611,-0.0366, 1.485, 0.0044/)) Magnetic_j2( 52) = Magnetic_Form_Type("RU0 ",(/ 3.7445,18.613, 3.4749, 7.420,-0.0363, 1.007, 0.0073/)) Magnetic_j2( 53) = Magnetic_Form_Type("RU1 ",(/ 5.2826,23.683, 3.5813, 8.152,-0.0257, 0.426, 0.0131/)) Magnetic_j2( 54) = Magnetic_Form_Type("RH0 ",(/ 3.3651,17.344, 3.2121, 6.804,-0.0350, 0.503, 0.0146/)) Magnetic_j2( 55) = Magnetic_Form_Type("RH1 ",(/ 4.0260,18.950, 3.1663, 7.000,-0.0296, 0.486, 0.0127/)) Magnetic_j2( 56) = Magnetic_Form_Type("PD0 ",(/ 3.3105,14.726, 2.6332, 5.862,-0.0437, 1.130, 0.0053/)) Magnetic_j2( 57) = Magnetic_Form_Type("PD1 ",(/ 4.2749,17.900, 2.7021, 6.354,-0.0258, 0.700, 0.0071/)) Magnetic_j2( 58) = Magnetic_Form_Type("CE2 ",(/ 0.9809,18.063, 1.8413, 7.769, 0.9905, 2.845, 0.0120/)) Magnetic_j2( 59) = Magnetic_Form_Type("ND2 ",(/ 1.4530,18.340, 1.6196, 7.285, 0.8752, 2.622, 0.0126/)) Magnetic_j2( 60) = Magnetic_Form_Type("ND3 ",(/ 0.6751,18.342, 1.6272, 7.260, 0.9644, 2.602, 0.0150/)) Magnetic_j2( 61) = Magnetic_Form_Type("SM2 ",(/ 1.0360,18.425, 1.4769, 7.032, 0.8810, 2.437, 0.0152/)) Magnetic_j2( 62) = Magnetic_Form_Type("SM3 ",(/ 0.4707,18.430, 1.4261, 7.034, 0.9574, 2.439, 0.0182/)) Magnetic_j2( 63) = Magnetic_Form_Type("EU2 ",(/ 0.8970,18.443, 1.3769, 7.005, 0.9060, 2.421, 0.0190/)) Magnetic_j2( 64) = Magnetic_Form_Type("EU3 ",(/ 0.3985,18.451, 1.3307, 6.956, 0.9603, 2.378, 0.0197/)) Magnetic_j2( 65) = Magnetic_Form_Type("GD2 ",(/ 0.7756,18.469, 1.3124, 6.899, 0.8956, 2.338, 0.0199/)) Magnetic_j2( 66) = Magnetic_Form_Type("GD3 ",(/ 0.3347,18.476, 1.2465, 6.877, 0.9537, 2.318, 0.0217/)) Magnetic_j2( 67) = Magnetic_Form_Type("TB2 ",(/ 0.6688,18.491, 1.2487, 6.822, 0.8888, 2.275, 0.0215/)) Magnetic_j2( 68) = Magnetic_Form_Type("TB3 ",(/ 0.2892,18.497, 1.1678, 6.797, 0.9437, 2.257, 0.0232/)) Magnetic_j2( 69) = Magnetic_Form_Type("DY2 ",(/ 0.5917,18.511, 1.1828, 6.747, 0.8801, 2.214, 0.0229/)) Magnetic_j2( 70) = Magnetic_Form_Type("DY3 ",(/ 0.2523,18.517, 1.0914, 6.736, 0.9345, 2.208, 0.0250/)) Magnetic_j2( 71) = Magnetic_Form_Type("HO2 ",(/ 0.5094,18.515, 1.1234, 6.706, 0.8727, 2.159, 0.0242/)) Magnetic_j2( 72) = Magnetic_Form_Type("HO3 ",(/ 0.2188,18.516, 1.0240, 6.707, 0.9251, 2.161, 0.0268/)) Magnetic_j2( 73) = Magnetic_Form_Type("ER2 ",(/ 0.4693,18.528, 1.0545, 6.649, 0.8679, 2.120, 0.0261/)) Magnetic_j2( 74) = Magnetic_Form_Type("ER3 ",(/ 0.1710,18.534, 0.9879, 6.625, 0.9044, 2.100, 0.0278/)) Magnetic_j2( 75) = Magnetic_Form_Type("TM2 ",(/ 0.4198,18.542, 0.9959, 6.600, 0.8593, 2.082, 0.0284/)) Magnetic_j2( 76) = Magnetic_Form_Type("TM3 ",(/ 0.1760,18.542, 0.9105, 6.579, 0.8970, 2.062, 0.0294/)) Magnetic_j2( 77) = Magnetic_Form_Type("YB2 ",(/ 0.3852,18.550, 0.9415, 6.551, 0.8492, 2.043, 0.0301/)) Magnetic_j2( 78) = Magnetic_Form_Type("YB3 ",(/ 0.1570,18.555, 0.8484, 6.540, 0.8880, 2.037, 0.0318/)) Magnetic_j2( 79) = Magnetic_Form_Type("U3 ",(/ 4.1582,16.534, 2.4675, 5.952,-0.0252, 0.765, 0.0057/)) Magnetic_j2( 80) = Magnetic_Form_Type("U4 ",(/ 3.7449,13.894, 2.6453, 4.863,-0.5218, 3.192, 0.0009/)) Magnetic_j2( 81) = Magnetic_Form_Type("U5 ",(/ 3.0724,12.546, 2.3076, 5.231,-0.0644, 1.474, 0.0035/)) Magnetic_j2( 82) = Magnetic_Form_Type("NP3 ",(/ 3.7170,15.133, 2.3216, 5.503,-0.0275, 0.800, 0.0052/)) Magnetic_j2( 83) = Magnetic_Form_Type("NP4 ",(/ 2.9203,14.646, 2.5979, 5.559,-0.0301, 0.367, 0.0141/)) Magnetic_j2( 84) = Magnetic_Form_Type("NP5 ",(/ 2.3308,13.654, 2.7219, 5.494,-0.1357, 0.049, 0.1224/)) Magnetic_j2( 85) = Magnetic_Form_Type("NP6 ",(/ 1.8245,13.180, 2.8508, 5.407,-0.1579, 0.044, 0.1438/)) Magnetic_j2( 86) = Magnetic_Form_Type("PU3 ",(/ 2.0885,12.871, 2.5961, 5.190,-0.1465, 0.039, 0.1343/)) Magnetic_j2( 87) = Magnetic_Form_Type("PU4 ",(/ 2.7244,12.926, 2.3387, 5.163,-0.1300, 0.046, 0.1177/)) Magnetic_j2( 88) = Magnetic_Form_Type("PU5 ",(/ 2.1409,12.832, 2.5664, 5.152,-0.1338, 0.046, 0.1210/)) Magnetic_j2( 89) = Magnetic_Form_Type("PU6 ",(/ 1.7262,12.324, 2.6652, 5.066,-0.1695, 0.041, 0.1550/)) Magnetic_j2( 90) = Magnetic_Form_Type("AM2 ",(/ 3.5237,15.955, 2.2855, 5.195,-0.0142, 0.585, 0.0033/)) Magnetic_j2( 91) = Magnetic_Form_Type("AM3 ",(/ 2.8622,14.733, 2.4099, 5.144,-0.1326, 0.031, 0.1233/)) Magnetic_j2( 92) = Magnetic_Form_Type("AM4 ",(/ 2.4141,12.948, 2.3687, 4.945,-0.2490, 0.022, 0.2371/)) Magnetic_j2( 93) = Magnetic_Form_Type("AM5 ",(/ 2.0109,12.053, 2.4155, 4.836,-0.2264, 0.027, 0.2128/)) Magnetic_j2( 94) = Magnetic_Form_Type("AM6 ",(/ 1.6778,11.337, 2.4531, 4.725,-0.2043, 0.034, 0.1892/)) Magnetic_j2( 95) = Magnetic_Form_Type("AM7 ",(/ 1.8845, 9.161, 2.0746, 4.042,-0.1318, 1.723, 0.0020/)) !---- Coefficients ----! Magnetic_j4( 1) = Magnetic_Form_Type("SC0 ",(/ 1.3420,10.200, 0.3837, 3.079, 0.0468, 0.118,-0.0328/)) Magnetic_j4( 2) = Magnetic_Form_Type("SC1 ",(/ 7.1167,15.487,-6.6671,18.269, 0.4900, 2.992, 0.0047/)) Magnetic_j4( 3) = Magnetic_Form_Type("SC2 ",(/-1.6684,15.648, 1.7742, 9.062, 0.4075, 2.412, 0.0042/)) Magnetic_j4( 4) = Magnetic_Form_Type("TI0 ",(/-2.1515,11.271, 2.5149, 8.859, 0.3555, 2.149, 0.0045/)) Magnetic_j4( 5) = Magnetic_Form_Type("TI1 ",(/-1.0383,16.190, 1.4699, 8.924, 0.3631, 2.283, 0.0044/)) Magnetic_j4( 6) = Magnetic_Form_Type("TI2 ",(/-1.3242,15.310, 1.2042, 7.899, 0.3976, 2.156, 0.0051/)) Magnetic_j4( 7) = Magnetic_Form_Type("TI3 ",(/-1.1117,14.635, 0.7689, 6.927, 0.4385, 2.089, 0.0060/)) Magnetic_j4( 8) = Magnetic_Form_Type("V0 ",(/-0.9633,15.273, 0.9274, 7.732, 0.3891, 2.053, 0.0063/)) Magnetic_j4( 9) = Magnetic_Form_Type("V1 ",(/-0.9606,15.545, 1.1278, 8.118, 0.3653, 2.097, 0.0056/)) Magnetic_j4( 10) = Magnetic_Form_Type("V2 ",(/-1.1729,14.973, 0.9092, 7.613, 0.4105, 2.039, 0.0067/)) Magnetic_j4( 11) = Magnetic_Form_Type("V3 ",(/-0.9417,14.205, 0.5284, 6.607, 0.4411, 1.967, 0.0076/)) Magnetic_j4( 12) = Magnetic_Form_Type("V4 ",(/-0.7654,13.097, 0.3071, 5.674, 0.4476, 1.871, 0.0081/)) Magnetic_j4( 13) = Magnetic_Form_Type("CR0 ",(/-0.6670,19.613, 0.5342, 6.478, 0.3641, 1.905, 0.0073/)) Magnetic_j4( 14) = Magnetic_Form_Type("CR1 ",(/-0.8309,18.043, 0.7252, 7.531, 0.3828, 2.003, 0.0073/)) Magnetic_j4( 15) = Magnetic_Form_Type("CR2 ",(/-0.8930,15.664, 0.5590, 7.033, 0.4093, 1.924, 0.0081/)) Magnetic_j4( 16) = Magnetic_Form_Type("CR3 ",(/-0.7327,14.073, 0.3268, 5.674, 0.4114, 1.810, 0.0085/)) Magnetic_j4( 17) = Magnetic_Form_Type("CR4 ",(/-0.6748,12.946, 0.1805, 6.753, 0.4526, 1.800, 0.0098/)) Magnetic_j4( 18) = Magnetic_Form_Type("MN0 ",(/-0.5452,15.471, 0.4406, 4.902, 0.2884, 1.543, 0.0059/)) Magnetic_j4( 19) = Magnetic_Form_Type("MN1 ",(/-0.7947,17.867, 0.6078, 7.704, 0.3798, 1.905, 0.0087/)) Magnetic_j4( 20) = Magnetic_Form_Type("MN2 ",(/-0.7416,15.255, 0.3831, 6.469, 0.3935, 1.800, 0.0093/)) Magnetic_j4( 21) = Magnetic_Form_Type("MN3 ",(/-0.6603,13.607, 0.2322, 6.218, 0.4104, 1.740, 0.0101/)) Magnetic_j4( 22) = Magnetic_Form_Type("MN4 ",(/-0.5127,13.461, 0.0313, 7.763, 0.4282, 1.701, 0.0113/)) Magnetic_j4( 23) = Magnetic_Form_Type("FE0 ",(/-0.5029,19.677, 0.2999, 3.776, 0.2576, 1.424, 0.0071/)) Magnetic_j4( 24) = Magnetic_Form_Type("FE1 ",(/-0.5109,19.250, 0.3896, 4.891, 0.2810, 1.526, 0.0069/)) Magnetic_j4( 25) = Magnetic_Form_Type("FE2 ",(/-0.5401,17.227, 0.2865, 3.742, 0.2658, 1.424, 0.0076/)) Magnetic_j4( 26) = Magnetic_Form_Type("FE3 ",(/-0.5507,11.493, 0.2153, 4.906, 0.3468, 1.523, 0.0095/)) Magnetic_j4( 27) = Magnetic_Form_Type("FE4 ",(/-0.5352, 9.507, 0.1783, 5.175, 0.3584, 1.469, 0.0097/)) Magnetic_j4( 28) = Magnetic_Form_Type("CO0 ",(/-0.4221,14.195, 0.2900, 3.979, 0.2469, 1.286, 0.0063/)) Magnetic_j4( 29) = Magnetic_Form_Type("CO1 ",(/-0.4115,14.561, 0.3580, 4.717, 0.2644, 1.418, 0.0074/)) Magnetic_j4( 30) = Magnetic_Form_Type("CO2 ",(/-0.4759,14.046, 0.2747, 3.731, 0.2458, 1.250, 0.0057/)) Magnetic_j4( 31) = Magnetic_Form_Type("CO3 ",(/-0.4466,13.391, 0.1419, 3.011, 0.2773, 1.335, 0.0093/)) Magnetic_j4( 32) = Magnetic_Form_Type("CO4 ",(/-0.4091,13.194,-0.0194, 3.417, 0.3534, 1.421, 0.0112/)) Magnetic_j4( 33) = Magnetic_Form_Type("NI0 ",(/-0.4428,14.485, 0.0870, 3.234, 0.2932, 1.331, 0.0096/)) Magnetic_j4( 34) = Magnetic_Form_Type("NI1 ",(/-0.3836,13.425, 0.3116, 4.462, 0.2471, 1.309, 0.0079/)) Magnetic_j4( 35) = Magnetic_Form_Type("NI2 ",(/-0.3803,10.403, 0.2838, 3.378, 0.2108, 1.104, 0.0050/)) Magnetic_j4( 36) = Magnetic_Form_Type("NI3 ",(/-0.3715, 8.952, 0.1211, 2.940, 0.2526, 1.105, 0.0061/)) Magnetic_j4( 37) = Magnetic_Form_Type("NI4 ",(/-0.3509, 8.157, 0.2220, 2.106, 0.1567, 0.925, 0.0065/)) Magnetic_j4( 38) = Magnetic_Form_Type("CU0 ",(/-0.3204,15.132, 0.2335, 4.021, 0.2312, 1.196, 0.0068/)) Magnetic_j4( 39) = Magnetic_Form_Type("CU1 ",(/-0.3572,15.125, 0.2336, 3.966, 0.2315, 1.197, 0.0070/)) Magnetic_j4( 40) = Magnetic_Form_Type("CU2 ",(/-0.3914,14.740, 0.1275, 3.384, 0.2548, 1.255, 0.0103/)) Magnetic_j4( 41) = Magnetic_Form_Type("CU3 ",(/-0.3671,14.082,-0.0078, 3.315, 0.3154, 1.377, 0.0132/)) Magnetic_j4( 42) = Magnetic_Form_Type("CU4 ",(/-0.2915,14.124,-0.1065, 4.201, 0.3247, 1.352, 0.0148/)) Magnetic_j4( 43) = Magnetic_Form_Type("Y0 ",(/-8.0767,32.201, 7.9197,25.156, 1.4067, 6.827,-0.0001/)) Magnetic_j4( 44) = Magnetic_Form_Type("ZR0 ",(/-5.2697,32.868, 4.1930,24.183, 1.5202, 6.048,-0.0002/)) Magnetic_j4( 45) = Magnetic_Form_Type("ZR1 ",(/-5.6384,33.607, 4.6729,22.338, 1.3258, 5.924,-0.0003/)) Magnetic_j4( 46) = Magnetic_Form_Type("NB0 ",(/-3.1377,25.595, 2.3411,16.569, 1.2304, 4.990,-0.0005/)) Magnetic_j4( 47) = Magnetic_Form_Type("NB1 ",(/-3.3598,25.820, 2.8297,16.427, 1.1203, 4.982,-0.0005/)) Magnetic_j4( 48) = Magnetic_Form_Type("MO0 ",(/-2.8860,20.572, 1.8130,14.628, 1.1899, 4.264,-0.0008/)) Magnetic_j4( 49) = Magnetic_Form_Type("MO1 ",(/-3.2618,25.486, 2.3596,16.462, 1.1164, 4.491,-0.0007/)) Magnetic_j4( 50) = Magnetic_Form_Type("TC0 ",(/-2.7975,20.159, 1.6520,16.261, 1.1726, 3.943,-0.0008/)) Magnetic_j4( 51) = Magnetic_Form_Type("TC1 ",(/-2.0470,19.683, 1.6306,11.592, 0.8698, 3.769,-0.0010/)) Magnetic_j4( 52) = Magnetic_Form_Type("RU0 ",(/-1.5042,17.949, 0.6027, 9.961, 0.9700, 3.393,-0.0010/)) Magnetic_j4( 53) = Magnetic_Form_Type("RU1 ",(/-1.6278,18.506, 1.1828,10.189, 0.8138, 3.418,-0.0009/)) Magnetic_j4( 54) = Magnetic_Form_Type("RH0 ",(/-1.3492,17.577, 0.4527,10.507, 0.9285, 3.155,-0.0009/)) Magnetic_j4( 55) = Magnetic_Form_Type("RH1 ",(/-1.4673,17.957, 0.7381, 9.944, 0.8485, 3.126,-0.0012/)) Magnetic_j4( 56) = Magnetic_Form_Type("PD0 ",(/-1.1955,17.628, 0.3183,11.309, 0.8696, 2.909,-0.0006/)) Magnetic_j4( 57) = Magnetic_Form_Type("PD1 ",(/-1.4098,17.765, 0.7927, 9.999, 0.7710, 2.930,-0.0006/)) Magnetic_j4( 58) = Magnetic_Form_Type("CE2 ",(/-0.6468,10.533, 0.4052, 5.624, 0.3412, 1.535, 0.0080/)) Magnetic_j4( 59) = Magnetic_Form_Type("ND2 ",(/-0.5416,12.204, 0.3571, 6.169, 0.3154, 1.485, 0.0098/)) Magnetic_j4( 60) = Magnetic_Form_Type("ND3 ",(/-0.4053,14.014, 0.0329, 7.005, 0.3759, 1.707, 0.0209/)) Magnetic_j4( 61) = Magnetic_Form_Type("SM2 ",(/-0.4150,14.057, 0.1368, 7.032, 0.3272, 1.582, 0.0192/)) Magnetic_j4( 62) = Magnetic_Form_Type("SM3 ",(/-0.4288,10.052, 0.1782, 5.019, 0.2833, 1.236, 0.0088/)) Magnetic_j4( 63) = Magnetic_Form_Type("EU2 ",(/-0.4145,10.193, 0.2447, 5.164, 0.2661, 1.205, 0.0065/)) Magnetic_j4( 64) = Magnetic_Form_Type("EU3 ",(/-0.4095,10.211, 0.1485, 5.175, 0.2720, 1.237, 0.0131/)) Magnetic_j4( 65) = Magnetic_Form_Type("GD2 ",(/-0.3824,10.344, 0.1955, 5.306, 0.2622, 1.203, 0.0097/)) Magnetic_j4( 66) = Magnetic_Form_Type("GD3 ",(/-0.3621,10.353, 0.1016, 5.310, 0.2649, 1.219, 0.0147/)) Magnetic_j4( 67) = Magnetic_Form_Type("TB2 ",(/-0.3443,10.469, 0.1481, 5.416, 0.2575, 1.182, 0.0104/)) Magnetic_j4( 68) = Magnetic_Form_Type("TB3 ",(/-0.3228,10.476, 0.0638, 5.419, 0.2566, 1.196, 0.0159/)) Magnetic_j4( 69) = Magnetic_Form_Type("DY2 ",(/-0.3206,12.071, 0.0904, 8.026, 0.2616, 1.230, 0.0143/)) Magnetic_j4( 70) = Magnetic_Form_Type("DY3 ",(/-0.2829, 9.525, 0.0565, 4.429, 0.2437, 1.066, 0.0092/)) Magnetic_j4( 71) = Magnetic_Form_Type("HO2 ",(/-0.2976, 9.719, 0.1224, 4.635, 0.2279, 1.005, 0.0063/)) Magnetic_j4( 72) = Magnetic_Form_Type("HO3 ",(/-0.2717, 9.731, 0.0474, 4.638, 0.2292, 1.047, 0.0124/)) Magnetic_j4( 73) = Magnetic_Form_Type("ER2 ",(/-0.2975, 9.829, 0.1189, 4.741, 0.2116, 1.004, 0.0117/)) Magnetic_j4( 74) = Magnetic_Form_Type("ER3 ",(/-0.2568, 9.834, 0.0356, 4.741, 0.2172, 1.028, 0.0148/)) Magnetic_j4( 75) = Magnetic_Form_Type("TM2 ",(/-0.2677, 9.888, 0.0925, 4.784, 0.2056, 0.990, 0.0124/)) Magnetic_j4( 76) = Magnetic_Form_Type("TM3 ",(/-0.2292, 9.895, 0.0124, 4.785, 0.2108, 1.007, 0.0151/)) Magnetic_j4( 77) = Magnetic_Form_Type("YB2 ",(/-0.2393, 9.947, 0.0663, 4.823, 0.2009, 0.965, 0.0122/)) Magnetic_j4( 78) = Magnetic_Form_Type("YB3 ",(/-0.2121, 8.197, 0.0325, 3.153, 0.1975, 0.884, 0.0093/)) Magnetic_j4( 79) = Magnetic_Form_Type("U3 ",(/-0.9859,16.601, 0.6116, 6.515, 0.6020, 2.597,-0.0010/)) Magnetic_j4( 80) = Magnetic_Form_Type("U4 ",(/-1.0540,16.605, 0.4339, 6.512, 0.6746, 2.599,-0.0011/)) Magnetic_j4( 81) = Magnetic_Form_Type("U5 ",(/-0.9588,16.485, 0.1576, 6.440, 0.7785, 2.640,-0.0010/)) Magnetic_j4( 82) = Magnetic_Form_Type("NP3 ",(/-0.9029,16.586, 0.4006, 6.470, 0.6545, 2.563,-0.0004/)) Magnetic_j4( 83) = Magnetic_Form_Type("NP4 ",(/-0.9887,12.441, 0.5918, 5.294, 0.5306, 2.263,-0.0021/)) Magnetic_j4( 84) = Magnetic_Form_Type("NP5 ",(/-0.8146,16.581,-0.0055, 6.475, 0.7956, 2.562,-0.0004/)) Magnetic_j4( 85) = Magnetic_Form_Type("NP6 ",(/-0.6738,16.553,-0.2297, 6.505, 0.8513, 2.553,-0.0003/)) Magnetic_j4( 86) = Magnetic_Form_Type("PU3 ",(/-0.7014,16.369,-0.1162, 6.697, 0.7778, 2.450, 0.0000/)) Magnetic_j4( 87) = Magnetic_Form_Type("PU4 ",(/-0.9160,12.203, 0.4891, 5.127, 0.5290, 2.149,-0.0022/)) Magnetic_j4( 88) = Magnetic_Form_Type("PU5 ",(/-0.7035,16.360,-0.0979, 6.706, 0.7726, 2.447, 0.0000/)) Magnetic_j4( 89) = Magnetic_Form_Type("PU6 ",(/-0.5560,16.322,-0.3046, 6.768, 0.8146, 2.426, 0.0001/)) Magnetic_j4( 90) = Magnetic_Form_Type("AM2 ",(/-0.7433,16.416, 0.3481, 6.788, 0.6014, 2.346, 0.0000/)) Magnetic_j4( 91) = Magnetic_Form_Type("AM3 ",(/-0.8092,12.854, 0.4161, 5.459, 0.5476, 2.172,-0.0011/)) Magnetic_j4( 92) = Magnetic_Form_Type("AM4 ",(/-0.8548,12.226, 0.3037, 5.909, 0.6173, 2.188,-0.0016/)) Magnetic_j4( 93) = Magnetic_Form_Type("AM5 ",(/-0.6538,15.462,-0.0948, 5.997, 0.7295, 2.297, 0.0000/)) Magnetic_j4( 94) = Magnetic_Form_Type("AM6 ",(/-0.5390,15.449,-0.2689, 6.017, 0.7711, 2.297, 0.0002/)) Magnetic_j4( 95) = Magnetic_Form_Type("AM7 ",(/-0.4688,12.019,-0.2692, 7.042, 0.7297, 2.164,-0.0011/)) !---- Coefficients ----! Magnetic_j6( 1) = Magnetic_Form_Type("CE2 ",(/-0.1212, 7.994,-0.0639, 4.024, 0.1519, 1.096, 0.0078/)) Magnetic_j6( 2) = Magnetic_Form_Type("ND2 ",(/-0.1600, 8.009, 0.0272, 4.028, 0.1104, 1.068, 0.0139/)) Magnetic_j6( 3) = Magnetic_Form_Type("ND3 ",(/-0.0416, 8.014,-0.1261, 4.040, 0.1400, 1.087, 0.0102/)) Magnetic_j6( 4) = Magnetic_Form_Type("SM2 ",(/-0.1428, 6.041, 0.0723, 2.033, 0.0550, 0.513, 0.0081/)) Magnetic_j6( 5) = Magnetic_Form_Type("SM3 ",(/-0.0944, 6.030,-0.0498, 2.074, 0.1372, 0.645,-0.0132/)) Magnetic_j6( 6) = Magnetic_Form_Type("EU2 ",(/-0.1252, 6.049, 0.0507, 2.085, 0.0572, 0.646, 0.0132/)) Magnetic_j6( 7) = Magnetic_Form_Type("EU3 ",(/-0.0817, 6.039,-0.0596, 2.120, 0.1243, 0.764,-0.0001/)) Magnetic_j6( 8) = Magnetic_Form_Type("GD2 ",(/-0.1351, 5.030, 0.0828, 2.025, 0.0315, 0.503, 0.0187/)) Magnetic_j6( 9) = Magnetic_Form_Type("GD3 ",(/-0.0662, 6.031,-0.0850, 2.154, 0.1323, 0.891, 0.0048/)) Magnetic_j6( 10) = Magnetic_Form_Type("TB2 ",(/-0.0758, 6.032,-0.0540, 2.158, 0.1199, 0.890, 0.0051/)) Magnetic_j6( 11) = Magnetic_Form_Type("TB3 ",(/-0.0559, 6.031,-0.1020, 2.237, 0.1264, 1.107, 0.0167/)) Magnetic_j6( 12) = Magnetic_Form_Type("DY2 ",(/-0.0568, 6.032,-0.1003, 2.240, 0.1401, 1.106, 0.0109/)) Magnetic_j6( 13) = Magnetic_Form_Type("DY3 ",(/-0.0423, 6.038,-0.1248, 2.244, 0.1359, 1.200, 0.0188/)) Magnetic_j6( 14) = Magnetic_Form_Type("HO2 ",(/-0.0725, 6.045,-0.0318, 2.243, 0.0738, 1.202, 0.0252/)) Magnetic_j6( 15) = Magnetic_Form_Type("HO3 ",(/-0.0289, 6.050,-0.1545, 2.230, 0.1550, 1.260, 0.0177/)) Magnetic_j6( 16) = Magnetic_Form_Type("ER2 ",(/-0.0648, 6.056,-0.0515, 2.230, 0.0825, 1.264, 0.0250/)) Magnetic_j6( 17) = Magnetic_Form_Type("ER3 ",(/-0.0110, 6.061,-0.1954, 2.224, 0.1818, 1.296, 0.0149/)) Magnetic_j6( 18) = Magnetic_Form_Type("TM2 ",(/-0.0842, 4.070, 0.0807, 0.849,-0.2087, 0.039, 0.2095/)) Magnetic_j6( 19) = Magnetic_Form_Type("TM3 ",(/-0.0727, 4.073, 0.0243, 0.689, 3.9459, 0.002,-3.9076/)) Magnetic_j6( 20) = Magnetic_Form_Type("YB2 ",(/-0.0739, 5.031, 0.0140, 2.030, 0.0351, 0.508, 0.0174/)) Magnetic_j6( 21) = Magnetic_Form_Type("YB3 ",(/-0.0345, 5.007,-0.0677, 2.020, 0.0985, 0.549,-0.0076/)) Magnetic_j6( 22) = Magnetic_Form_Type("U3 ",(/-0.3797, 9.953, 0.0459, 5.038, 0.2748, 1.607, 0.0016/)) Magnetic_j6( 23) = Magnetic_Form_Type("U4 ",(/-0.1793,11.896,-0.2269, 5.428, 0.3291, 1.701, 0.0030/)) Magnetic_j6( 24) = Magnetic_Form_Type("U5 ",(/-0.0399,11.891,-0.3458, 5.580, 0.3340, 1.645, 0.0029/)) Magnetic_j6( 25) = Magnetic_Form_Type("NP3 ",(/-0.2427,11.844,-0.1129, 5.377, 0.2848, 1.568, 0.0022/)) Magnetic_j6( 26) = Magnetic_Form_Type("NP4 ",(/-0.2436, 9.599,-0.1317, 4.101, 0.3029, 1.545, 0.0019/)) Magnetic_j6( 27) = Magnetic_Form_Type("NP5 ",(/-0.1157, 9.565,-0.2654, 4.260, 0.3298, 1.549, 0.0025/)) Magnetic_j6( 28) = Magnetic_Form_Type("NP6 ",(/-0.0128, 9.569,-0.3611, 4.304, 0.3419, 1.541, 0.0032/)) Magnetic_j6( 29) = Magnetic_Form_Type("PU3 ",(/-0.0364, 9.572,-0.3181, 4.342, 0.3210, 1.523, 0.0041/)) Magnetic_j6( 30) = Magnetic_Form_Type("PU4 ",(/-0.2394, 7.837,-0.0785, 4.024, 0.2643, 1.378, 0.0012/)) Magnetic_j6( 31) = Magnetic_Form_Type("PU5 ",(/-0.1090, 7.819,-0.2243, 4.100, 0.2947, 1.404, 0.0015/)) Magnetic_j6( 32) = Magnetic_Form_Type("PU6 ",(/-0.0001, 7.820,-0.3354, 4.144, 0.3097, 1.403, 0.0020/)) Magnetic_j6( 33) = Magnetic_Form_Type("AM2 ",(/-0.3176, 7.864, 0.0771, 4.161, 0.2194, 1.339, 0.0018/)) Magnetic_j6( 34) = Magnetic_Form_Type("AM3 ",(/-0.3159, 6.982, 0.0682, 3.995, 0.2141, 1.188,-0.0015/)) Magnetic_j6( 35) = Magnetic_Form_Type("AM4 ",(/-0.1787, 7.880,-0.1274, 4.090, 0.2565, 1.315, 0.0017/)) Magnetic_j6( 36) = Magnetic_Form_Type("AM5 ",(/-0.0927, 6.073,-0.2227, 3.784, 0.2916, 1.372, 0.0026/)) Magnetic_j6( 37) = Magnetic_Form_Type("AM6 ",(/ 0.0152, 6.079,-0.3549, 3.861, 0.3125, 1.403, 0.0036/)) Magnetic_j6( 38) = Magnetic_Form_Type("AM7 ",(/ 0.1292, 6.082,-0.4689, 3.879, 0.3234, 1.393, 0.0042/)) """ periodictable-1.5.0/periodictable/mass.py000066400000000000000000003267151310514471200204620ustar00rootroot00000000000000# -*- coding: iso-8859-15 -*- # This program is public domain # Author: Paul Kienzle u""" Adds average mass for the elements: * mass, mass_units (u) The molar mass averaged over natural isotope abundance. Adds mass and abundance information for isotopes: * mass, mass_units (u) The molar mass of the individual isotope. * abundance, abundance_units (%) Natural abundance for the isotope. Atomic Weights and Isotopic Composition [#Coursey]_. The atomic weights are available for elements 1 through 112, 114, & 116 and isotopic compositions or abundances are given when appropriate. The atomic weights data were published by Coplen [#Coplen]_ in Atomic Weights of the Elements 1999, (and include changes reported from the 2001 review in Chem. Int., 23, 179 (2001)) and the isotopic compositions data were published by Rosman [#Rosman]_ and Taylor [#Taylor]_ in Isotopic Compositions of the Elements 1997. The relative atomic masses of the isotopes data were published by Audi [#Audi]_ and Wapstra [#Wapstra]_ in the 1995 Update To The Atomic Mass Evaluation. This data has been compiled from the above sources for the user's convenience and does not represent a critical evaluation by the NIST Physics Laboratory. http://physics.nist.gov/PhysRefData/Compositions/ Neutron mass from NIST Reference on Constants, Units, and Uncertainty http://physics.nist.gov/cuu/index.html .. [#Coursey] Coursey. J. S., Schwab. D. J., and Dragoset. R. A., NIST, Physics Laboratory, Office of Electronic Commerce in Scientific and Engineering Data. .. [#Coplen] Coplen. T. B. : U.S. Geological Survey, Reston, Virginia, USA. .. [#Rosman] Rosman. K. J. R. : Department of Applied Physics, Curtin University of Technology, Australia. .. [#Taylor] Taylor. P. D. P. : Institute for Reference Materials and Measurements, European Commission, Belgium. .. [#Audi] Audi. G. : Centre de Spectrométrie Nucléaire et de Spectrométrie de Masse, Orsay Campus, France. .. [#Wapstra] Wapstra. A. H. : National Institute of Nuclear Physics and High-Energy Physics, Amsterdam, The Netherlands. """ from .core import Element, Isotope from .constants import neutron_mass #__all__ = ['init'] def _parse_mass(str): idx = str.find('(') if idx > 0: # value(uncertainty) return float(str[:idx]) if str.startswith('['): # [nominal] return int(str[1:-1]) if str == "": # missing return 0 return float(str) def mass(isotope): """ Atomic weight. :Parameters: *isotope* : Isotope :Returns: *mass* : float | u Atomic weight of the element. Reference: *Coursey. J. S., Schwab. D. J, and Dragoset. R. A., NIST Atomic Weights and Isotopic Composition Database.* """ return isotope._mass def abundance(isotope): """ Natural abundance. :Parameters: *isotope* : Isotope :Returns: *abundance* : float | % Reference: *Coursey. J. S., Schwab. D. J, and Dragoset. R. A., NIST Atomic Weights and Isotopic Composition Database.* """ return isotope._abundance def init(table, reload=False): """Add mass attribute to period table elements and isotopes""" if 'mass' in table.properties and not reload: return table.properties.append('mass') Element.mass = property(mass, doc=mass.__doc__) Isotope.mass = property(mass, doc=mass.__doc__) Isotope.abundance = property(abundance, doc=abundance.__doc__) Element.mass_units = "u" Element.abundance_units = "%" for line in massdata.split('\n'): isotope, m, p, avg = line.split(',') el, sym, iso = isotope.split('-') el = table[int(el)] assert el.symbol == sym, \ "Symbol %s does not match %s"%(sym, el.symbol) iso = el.add_isotope(int(iso)) el._mass = _parse_mass(avg) iso._mass = _parse_mass(m) iso._abundance = _parse_mass(p) # A single neutron is an isotope of element 0 el = table[0] el._mass = neutron_mass iso = el.add_isotope(1) iso._mass = neutron_mass iso._abundance = 100 massdata = """\ 1-H-1,1.0078250321(4),99.9885(70),1.00794(7) 1-H-2,2.0141017780(4),0.0115(70),1.00794(7) 1-H-3,3.0160492675(11),,1.00794(7) 1-H-4,4.02783(12),,1.00794(7) 1-H-5,5.03954(102),,1.00794(7) 1-H-6,6.04494(28),,1.00794(7) 2-He-3,3.0160293097(9),0.000137(3),4.002602(2) 2-He-4,4.0026032497(10),99.999863(3),4.002602(2) 2-He-5,5.012220(50),,4.002602(2) 2-He-6,6.0188881(11),,4.002602(2) 2-He-7,7.028030(30),,4.002602(2) 2-He-8,8.033922(8),,4.002602(2) 2-He-9,9.043820(70),,4.002602(2) 2-He-10,10.052400(80),,4.002602(2) 3-Li-4,4.02718(23),,6.941(2) 3-Li-5,5.012540(50),,6.941(2) 3-Li-6,6.0151223(5),7.59(4),6.941(2) 3-Li-7,7.0160040(5),92.41(4),6.941(2) 3-Li-8,8.0224867(5),,6.941(2) 3-Li-9,9.0267891(21),,6.941(2) 3-Li-10,10.035481(16),,6.941(2) 3-Li-11,11.043796(29),,6.941(2) 3-Li-12,12.05378(107)#,,6.941(2) 4-Be-5,5.04079(429)#,,9.012182(3) 4-Be-6,6.019726(6),,9.012182(3) 4-Be-7,7.0169292(5),,9.012182(3) 4-Be-8,8.00530509(4),,9.012182(3) 4-Be-9,9.0121821(4),100,9.012182(3) 4-Be-10,10.0135337(4),,9.012182(3) 4-Be-11,11.021658(7),,9.012182(3) 4-Be-12,12.026921(16),,9.012182(3) 4-Be-13,13.03613(54),,9.012182(3) 4-Be-14,14.04282(12),,9.012182(3) 5-B-7,7.029920(80),,10.811(7) 5-B-8,8.0246067(12),,10.811(7) 5-B-9,9.0133288(11),,10.811(7) 5-B-10,10.0129370(4),19.9(7),10.811(7) 5-B-11,11.0093055(5),80.1(7),10.811(7) 5-B-12,12.0143521(15),,10.811(7) 5-B-13,13.0177803(12),,10.811(7) 5-B-14,14.025404(23),,10.811(7) 5-B-15,15.031097(24),,10.811(7) 5-B-16,16.039810(60),,10.811(7) 5-B-17,17.04693(15),,10.811(7) 5-B-18,18.05617(86)#,,10.811(7) 5-B-19,19.06373(43)#,,10.811(7) 6-C-8,8.037675(25),,12.0107(8) 6-C-9,9.0310401(23),,12.0107(8) 6-C-10,10.0168531(4),,12.0107(8) 6-C-11,11.0114338(10),,12.0107(8) 6-C-12,12.0000000(0),98.93(8),12.0107(8) 6-C-13,13.0033548378(10),1.07(8),12.0107(8) 6-C-14,14.003241988(4),,12.0107(8) 6-C-15,15.0105993(9),,12.0107(8) 6-C-16,16.014701(4),,12.0107(8) 6-C-17,17.022584(19),,12.0107(8) 6-C-18,18.026760(30),,12.0107(8) 6-C-19,19.03525(12),,12.0107(8) 6-C-20,20.04032(22),,12.0107(8) 6-C-21,21.04934(54)#,,12.0107(8) 6-C-22,22.05645(97)#,,12.0107(8) 7-N-10,10.04262(43)#,,14.0067(2) 7-N-11,11.02680(19),,14.0067(2) 7-N-12,12.0186132(11),,14.0067(2) 7-N-13,13.00573858(29),,14.0067(2) 7-N-14,14.0030740052(9),99.632(7),14.0067(2) 7-N-15,15.0001088984(9),0.368(7),14.0067(2) 7-N-16,16.0061014(28),,14.0067(2) 7-N-17,17.008450(16),,14.0067(2) 7-N-18,18.014082(21),,14.0067(2) 7-N-19,19.017027(18),,14.0067(2) 7-N-20,20.023370(60),,14.0067(2) 7-N-21,21.02709(10),,14.0067(2) 7-N-22,22.03444(21),,14.0067(2) 7-N-23,23.04051(76)#,,14.0067(2) 7-N-24,24.05050(54)#,,14.0067(2) 8-O-12,12.034405(20),,15.9994(3) 8-O-13,13.024810(10),,15.9994(3) 8-O-14,14.00859529(8),,15.9994(3) 8-O-15,15.0030654(5),,15.9994(3) 8-O-16,15.9949146221(15),99.757(16),15.9994(3) 8-O-17,16.99913150(22),0.038(1),15.9994(3) 8-O-18,17.9991604(9),0.205(14),15.9994(3) 8-O-19,19.003579(3),,15.9994(3) 8-O-20,20.0040762(13),,15.9994(3) 8-O-21,21.008655(13),,15.9994(3) 8-O-22,22.009970(60),,15.9994(3) 8-O-23,23.01569(11),,15.9994(3) 8-O-24,24.02037(33),,15.9994(3) 8-O-25,25.02914(40)#,,15.9994(3) 8-O-26,26.03775(46)#,,15.9994(3) 9-F-14,14.03608(43)#,,18.9984032(5) 9-F-15,15.01801(14),,18.9984032(5) 9-F-16,16.011466(9),,18.9984032(5) 9-F-17,17.00209524(27),,18.9984032(5) 9-F-18,18.0009377(6),,18.9984032(5) 9-F-19,18.99840320(7),100,18.9984032(5) 9-F-20,19.99998132(9),,18.9984032(5) 9-F-21,20.9999489(19),,18.9984032(5) 9-F-22,22.002999(13),,18.9984032(5) 9-F-23,23.003570(90),,18.9984032(5) 9-F-24,24.008100(70),,18.9984032(5) 9-F-25,25.012090(80),,18.9984032(5) 9-F-26,26.01963(13),,18.9984032(5) 9-F-27,27.02689(45),,18.9984032(5) 9-F-28,28.03567(55)#,,18.9984032(5) 9-F-29,29.04326(62)#,,18.9984032(5) 10-Ne-16,16.025757(22),,20.1797(6) 10-Ne-17,17.017700(50),,20.1797(6) 10-Ne-18,18.0056971(16),,20.1797(6) 10-Ne-19,19.0018798(6),,20.1797(6) 10-Ne-20,19.9924401759(20),90.48(3),20.1797(6) 10-Ne-21,20.99384674(4),0.27(1),20.1797(6) 10-Ne-22,21.99138551(23),9.25(3),20.1797(6) 10-Ne-23,22.99446734(26),,20.1797(6) 10-Ne-24,23.993615(11),,20.1797(6) 10-Ne-25,24.997790(50),,20.1797(6) 10-Ne-26,26.000460(60),,20.1797(6) 10-Ne-27,27.00762(10),,20.1797(6) 10-Ne-28,28.01211(12),,20.1797(6) 10-Ne-29,29.01935(32),,20.1797(6) 10-Ne-30,30.02387(88),,20.1797(6) 10-Ne-31,31.03311(97)#,,20.1797(6) 10-Ne-32,32.03991(94)#,,20.1797(6) 11-Na-18,18.02718(43)#,,22.989770(2) 11-Na-19,19.013879(13),,22.989770(2) 11-Na-20,20.007348(7),,22.989770(2) 11-Na-21,20.9976551(8),,22.989770(2) 11-Na-22,21.9944368(5),,22.989770(2) 11-Na-23,22.98976967(23),100,22.989770(2) 11-Na-24,23.99096333(23),,22.989770(2) 11-Na-25,24.9899544(13),,22.989770(2) 11-Na-26,25.992590(15),,22.989770(2) 11-Na-27,26.994010(40),,22.989770(2) 11-Na-28,27.998890(80),,22.989770(2) 11-Na-29,29.00281(10),,22.989770(2) 11-Na-30,30.00923(10),,22.989770(2) 11-Na-31,31.01360(18),,22.989770(2) 11-Na-32,32.01965(52),,22.989770(2) 11-Na-33,33.02739(160),,22.989770(2) 11-Na-34,34.03490(113)#,,22.989770(2) 11-Na-35,35.04418(166)#,,22.989770(2) 12-Mg-20,20.018863(29),,24.3050(6) 12-Mg-21,21.011714(18),,24.3050(6) 12-Mg-22,21.9995741(15),,24.3050(6) 12-Mg-23,22.9941249(13),,24.3050(6) 12-Mg-24,23.98504190(20),78.99(4),24.3050(6) 12-Mg-25,24.98583702(20),10.00(1),24.3050(6) 12-Mg-26,25.98259304(21),11.01(3),24.3050(6) 12-Mg-27,26.98434074(21),,24.3050(6) 12-Mg-28,27.9838767(22),,24.3050(6) 12-Mg-29,28.988550(30),,24.3050(6) 12-Mg-30,29.990460(70),,24.3050(6) 12-Mg-31,30.996550(80),,24.3050(6) 12-Mg-32,31.99915(10),,24.3050(6) 12-Mg-33,33.00559(16),,24.3050(6) 12-Mg-34,34.00907(28),,24.3050(6) 12-Mg-35,35.01749(47)#,,24.3050(6) 12-Mg-36,36.02245(97)#,,24.3050(6) 12-Mg-37,37.03124(97)#,,24.3050(6) 13-Al-21,21.02804(32)#,,26.981538(2) 13-Al-22,22.01952(10)#,,26.981538(2) 13-Al-23,23.007265(27),,26.981538(2) 13-Al-24,23.999941(4),,26.981538(2) 13-Al-25,24.9904286(7),,26.981538(2) 13-Al-26,25.98689166(21),,26.981538(2) 13-Al-27,26.98153844(14),100,26.981538(2) 13-Al-28,27.98191018(15),,26.981538(2) 13-Al-29,28.9804448(13),,26.981538(2) 13-Al-30,29.982960(15),,26.981538(2) 13-Al-31,30.983946(22),,26.981538(2) 13-Al-32,31.988120(90),,26.981538(2) 13-Al-33,32.990870(70),,26.981538(2) 13-Al-34,33.99693(10),,26.981538(2) 13-Al-35,34.99994(15),,26.981538(2) 13-Al-36,36.00635(29),,26.981538(2) 13-Al-37,37.01031(58),,26.981538(2) 13-Al-38,38.01690(60)#,,26.981538(2) 13-Al-39,39.02190(64)#,,26.981538(2) 14-Si-22,22.03453(22)#,,28.0855(3) 14-Si-23,23.02552(21)#,,28.0855(3) 14-Si-24,24.011546(21),,28.0855(3) 14-Si-25,25.004107(11),,28.0855(3) 14-Si-26,25.992330(3),,28.0855(3) 14-Si-27,26.98670476(17),,28.0855(3) 14-Si-28,27.9769265327(20),92.2297(7),28.0855(3) 14-Si-29,28.97649472(3),4.6832(5),28.0855(3) 14-Si-30,29.97377022(5),3.0872(5),28.0855(3) 14-Si-31,30.97536327(7),,28.0855(3) 14-Si-32,31.9741481(23),,28.0855(3) 14-Si-33,32.978001(17),,28.0855(3) 14-Si-34,33.978576(15),,28.0855(3) 14-Si-35,34.984580(40),,28.0855(3) 14-Si-36,35.98669(11),,28.0855(3) 14-Si-37,36.99300(13),,28.0855(3) 14-Si-38,37.99598(29),,28.0855(3) 14-Si-39,39.00230(43)#,,28.0855(3) 14-Si-40,40.00580(54)#,,28.0855(3) 14-Si-41,41.01270(64)#,,28.0855(3) 14-Si-42,42.01610(75)#,,28.0855(3) 15-P-24,24.03435(54)#,,30.973761(2) 15-P-25,25.02026(21)#,,30.973761(2) 15-P-26,26.01178(21)#,,30.973761(2) 15-P-27,26.999190(40),,30.973761(2) 15-P-28,27.992312(4),,30.973761(2) 15-P-29,28.9818014(8),,30.973761(2) 15-P-30,29.9783138(4),,30.973761(2) 15-P-31,30.97376151(20),100,30.973761(2) 15-P-32,31.97390716(20),,30.973761(2) 15-P-33,32.9717253(12),,30.973761(2) 15-P-34,33.973636(5),,30.973761(2) 15-P-35,34.9733142(20),,30.973761(2) 15-P-36,35.978260(14),,30.973761(2) 15-P-37,36.979610(40),,30.973761(2) 15-P-38,37.98447(15),,30.973761(2) 15-P-39,38.98642(16),,30.973761(2) 15-P-40,39.99105(21),,30.973761(2) 15-P-41,40.99480(50),,30.973761(2) 15-P-42,42.00009(54)#,,30.973761(2) 15-P-43,43.00331(54)#,,30.973761(2) 15-P-44,44.00988(75)#,,30.973761(2) 15-P-45,45.01514(86)#,,30.973761(2) 15-P-46,46.02383(97)#,,30.973761(2) 16-S-26,26.02788(32)#,,32.065(5) 16-S-27,27.01880(22)#,,32.065(5) 16-S-28,28.00437(17),,32.065(5) 16-S-29,28.996610(50),,32.065(5) 16-S-30,29.984903(3),,32.065(5) 16-S-31,30.9795544(16),,32.065(5) 16-S-32,31.97207069(12),94.93(31),32.065(5) 16-S-33,32.97145850(12),0.76(2),32.065(5) 16-S-34,33.96786683(11),4.29(28),32.065(5) 16-S-35,34.96903214(10),,32.065(5) 16-S-36,35.96708088(25),0.02(1),32.065(5) 16-S-37,36.97112572(27),,32.065(5) 16-S-38,37.971163(8),,32.065(5) 16-S-39,38.975140(50),,32.065(5) 16-S-40,39.97547(25),,32.065(5) 16-S-41,40.98003(23),,32.065(5) 16-S-42,41.98149(35),,32.065(5) 16-S-43,42.98660(90),,32.065(5) 16-S-44,43.98832(54)#,,32.065(5) 16-S-45,44.99482(64)#,,32.065(5) 16-S-46,45.99957(75)#,,32.065(5) 16-S-47,47.00762(86)#,,32.065(5) 16-S-48,48.01299(97)#,,32.065(5) 16-S-49,49.02201(107)#,,32.065(5) 17-Cl-28,28.02851(54)#,,35.453(2) 17-Cl-29,29.01411(21)#,,35.453(2) 17-Cl-30,30.00477(21)#,,35.453(2) 17-Cl-31,30.992420(50),,35.453(2) 17-Cl-32,31.985689(7),,35.453(2) 17-Cl-33,32.9774518(6),,35.453(2) 17-Cl-34,33.97376197(13),,35.453(2) 17-Cl-35,34.96885271(4),75.78(4),35.453(2) 17-Cl-36,35.96830695(8),,35.453(2) 17-Cl-37,36.96590260(5),24.22(4),35.453(2) 17-Cl-38,37.96801055(12),,35.453(2) 17-Cl-39,38.9680077(19),,35.453(2) 17-Cl-40,39.970420(30),,35.453(2) 17-Cl-41,40.970650(70),,35.453(2) 17-Cl-42,41.97317(12),,35.453(2) 17-Cl-43,42.97420(17),,35.453(2) 17-Cl-44,43.97854(24),,35.453(2) 17-Cl-45,44.97970(70),,35.453(2) 17-Cl-46,45.98412(54)#,,35.453(2) 17-Cl-47,46.98795(64)#,,35.453(2) 17-Cl-48,47.99485(75)#,,35.453(2) 17-Cl-49,48.99989(86)#,,35.453(2) 17-Cl-50,50.00773(97)#,,35.453(2) 17-Cl-51,51.01353(107)#,,35.453(2) 18-Ar-30,30.02156(32)#,,39.948(1) 18-Ar-31,31.01213(22)#,,39.948(1) 18-Ar-32,31.997660(50),,39.948(1) 18-Ar-33,32.989930(30),,39.948(1) 18-Ar-34,33.980270(3),,39.948(1) 18-Ar-35,34.9752567(8),,39.948(1) 18-Ar-36,35.96754628(27),0.3365(30),39.948(1) 18-Ar-37,36.9667759(3),,39.948(1) 18-Ar-38,37.9627322(5),0.0632(5),39.948(1) 18-Ar-39,38.964313(5),,39.948(1) 18-Ar-40,39.962383123(3),99.6003(30),39.948(1) 18-Ar-41,40.9645008(7),,39.948(1) 18-Ar-42,41.963050(40),,39.948(1) 18-Ar-43,42.965670(80),,39.948(1) 18-Ar-44,43.965365(22),,39.948(1) 18-Ar-45,44.968090(60),,39.948(1) 18-Ar-46,45.968090(40),,39.948(1) 18-Ar-47,46.97219(11),,39.948(1) 18-Ar-48,47.97507(32)#,,39.948(1) 18-Ar-49,48.98218(54)#,,39.948(1) 18-Ar-50,49.98594(75)#,,39.948(1) 18-Ar-51,50.99324(75)#,,39.948(1) 18-Ar-52,51.99817(97)#,,39.948(1) 18-Ar-53,53.00623(107)#,,39.948(1) 19-K-32,32.02192(54)#,,39.0983(1) 19-K-33,33.00726(21)#,,39.0983(1) 19-K-34,33.99841(32)#,,39.0983(1) 19-K-35,34.988012(21),,39.0983(1) 19-K-36,35.981293(8),,39.0983(1) 19-K-37,36.97337691(29),,39.0983(1) 19-K-38,37.9690801(8),,39.0983(1) 19-K-39,38.9637069(3),93.2581(44),39.0983(1) 19-K-40,39.96399867(29),0.0117(1),39.0983(1) 19-K-41,40.96182597(28),6.7302(44),39.0983(1) 19-K-42,41.9624031(3),,39.0983(1) 19-K-43,42.960716(10),,39.0983(1) 19-K-44,43.961560(40),,39.0983(1) 19-K-45,44.960700(11),,39.0983(1) 19-K-46,45.961976(17),,39.0983(1) 19-K-47,46.961678(9),,39.0983(1) 19-K-48,47.965513(26),,39.0983(1) 19-K-49,48.967450(80),,39.0983(1) 19-K-50,49.97278(30),,39.0983(1) 19-K-51,50.97638(54)#,,39.0983(1) 19-K-52,51.98261(75)#,,39.0983(1) 19-K-53,52.98712(75)#,,39.0983(1) 19-K-54,53.99399(97)#,,39.0983(1) 19-K-55,54.99939(107)#,,39.0983(1) 20-Ca-34,34.01412(32)#,,40.078(4) 20-Ca-35,35.004770(70)#,,40.078(4) 20-Ca-36,35.993090(40),,40.078(4) 20-Ca-37,36.985872(24),,40.078(4) 20-Ca-38,37.976319(5),,40.078(4) 20-Ca-39,38.9707177(19),,40.078(4) 20-Ca-40,39.9625912(3),96.941(156),40.078(4) 20-Ca-41,40.9622783(4),,40.078(4) 20-Ca-42,41.9586183(4),0.647(23),40.078(4) 20-Ca-43,42.9587668(5),0.135(10),40.078(4) 20-Ca-44,43.9554811(9),2.086(110),40.078(4) 20-Ca-45,44.9561859(10),,40.078(4) 20-Ca-46,45.9536928(25),0.004(3),40.078(4) 20-Ca-47,46.9545465(25),,40.078(4) 20-Ca-48,47.952534(4),0.187(21),40.078(4) 20-Ca-49,48.955673(4),,40.078(4) 20-Ca-50,49.957518(10),,40.078(4) 20-Ca-51,50.96147(10),,40.078(4) 20-Ca-52,51.96510(50),,40.078(4) 20-Ca-53,52.97005(54)#,,40.078(4) 20-Ca-54,53.97468(75)#,,40.078(4) 20-Ca-55,54.98055(75)#,,40.078(4) 20-Ca-56,55.98579(97)#,,40.078(4) 20-Ca-57,56.99236(107)#,,40.078(4) 21-Sc-36,36.01492(54)#,,44.955910(8) 21-Sc-37,37.00305(32)#,,44.955910(8) 21-Sc-38,37.99470(32)#,,44.955910(8) 21-Sc-39,38.984790(26),,44.955910(8) 21-Sc-40,39.977964(4),,44.955910(8) 21-Sc-41,40.9692513(3),,44.955910(8) 21-Sc-42,41.9655168(4),,44.955910(8) 21-Sc-43,42.9611510(20),,44.955910(8) 21-Sc-44,43.9594030(19),,44.955910(8) 21-Sc-45,44.9559102(12),100,44.955910(8) 21-Sc-46,45.9551703(12),,44.955910(8) 21-Sc-47,46.9524080(22),,44.955910(8) 21-Sc-48,47.952235(6),,44.955910(8) 21-Sc-49,48.950024(4),,44.955910(8) 21-Sc-50,49.952187(17),,44.955910(8) 21-Sc-51,50.953603(22),,44.955910(8) 21-Sc-52,51.95665(25),,44.955910(8) 21-Sc-53,52.95924(32)#,,44.955910(8) 21-Sc-54,53.96300(50),,44.955910(8) 21-Sc-55,54.96743(110)#,,44.955910(8) 21-Sc-56,55.97266(75)#,,44.955910(8) 21-Sc-57,56.97704(75)#,,44.955910(8) 21-Sc-58,57.98307(86)#,,44.955910(8) 21-Sc-59,58.98804(97)#,,44.955910(8) 22-Ti-38,38.00977(27)#,,47.867(1) 22-Ti-39,39.00132(11)#,,47.867(1) 22-Ti-40,39.99050(17),,47.867(1) 22-Ti-41,40.983130(40)#,,47.867(1) 22-Ti-42,41.973032(6),,47.867(1) 22-Ti-43,42.968523(7),,47.867(1) 22-Ti-44,43.9596902(8),,47.867(1) 22-Ti-45,44.9581243(13),,47.867(1) 22-Ti-46,45.9526295(12),8.25(3),47.867(1) 22-Ti-47,46.9517638(10),7.44(2),47.867(1) 22-Ti-48,47.9479471(10),73.72(3),47.867(1) 22-Ti-49,48.9478708(10),5.41(2),47.867(1) 22-Ti-50,49.9447921(11),5.18(2),47.867(1) 22-Ti-51,50.9466160(14),,47.867(1) 22-Ti-52,51.946898(8),,47.867(1) 22-Ti-53,52.94973(11),,47.867(1) 22-Ti-54,53.95087(25),,47.867(1) 22-Ti-55,54.95512(26),,47.867(1) 22-Ti-56,55.95799(30),,47.867(1) 22-Ti-57,56.96290(100)#,,47.867(1) 22-Ti-58,57.96611(75)#,,47.867(1) 22-Ti-59,58.97196(75)#,,47.867(1) 22-Ti-60,59.97564(86)#,,47.867(1) 22-Ti-61,60.98202(97)#,,47.867(1) 23-V-40,40.01109(54)#,,50.9415(1) 23-V-41,40.99974(27)#,,50.9415(1) 23-V-42,41.99123(21)#,,50.9415(1) 23-V-43,42.98065(25)#,,50.9415(1) 23-V-44,43.974400(90)#,,50.9415(1) 23-V-45,44.965782(18),,50.9415(1) 23-V-46,45.9601995(16),,50.9415(1) 23-V-47,46.9549069(12),,50.9415(1) 23-V-48,47.9522545(28),,50.9415(1) 23-V-49,48.9485169(14),,50.9415(1) 23-V-50,49.9471628(14),0.250(4),50.9415(1) 23-V-51,50.9439637(14),99.750(4),50.9415(1) 23-V-52,51.9447797(14),,50.9415(1) 23-V-53,52.944343(4),,50.9415(1) 23-V-54,53.946444(16),,50.9415(1) 23-V-55,54.94724(11),,50.9415(1) 23-V-56,55.95036(26),,50.9415(1) 23-V-57,56.95236(27),,50.9415(1) 23-V-58,57.95665(28),,50.9415(1) 23-V-59,58.95930(35),,50.9415(1) 23-V-60,59.96450(60),,50.9415(1) 23-V-61,60.96741(75)#,,50.9415(1) 23-V-62,61.97314(75)#,,50.9415(1) 23-V-63,62.97675(97)#,,50.9415(1) 24-Cr-42,42.00643(32)#,,51.9961(6) 24-Cr-43,42.997710(90)#,,51.9961(6) 24-Cr-44,43.98547(14)#,,51.9961(6) 24-Cr-45,44.97916(11)#,,51.9961(6) 24-Cr-46,45.968362(22),,51.9961(6) 24-Cr-47,46.962907(15),,51.9961(6) 24-Cr-48,47.954036(8),,51.9961(6) 24-Cr-49,48.9513411(28),,51.9961(6) 24-Cr-50,49.9460496(14),4.345(13),51.9961(6) 24-Cr-51,50.9447718(14),,51.9961(6) 24-Cr-52,51.9405119(15),83.789(18),51.9961(6) 24-Cr-53,52.9406538(15),9.501(17),51.9961(6) 24-Cr-54,53.9388849(15),2.365(7),51.9961(6) 24-Cr-55,54.9408442(16),,51.9961(6) 24-Cr-56,55.940645(10),,51.9961(6) 24-Cr-57,56.94375(10),,51.9961(6) 24-Cr-58,57.94425(26),,51.9961(6) 24-Cr-59,58.94863(27),,51.9961(6) 24-Cr-60,59.94973(28),,51.9961(6) 24-Cr-61,60.95409(30),,51.9961(6) 24-Cr-62,61.95580(40),,51.9961(6) 24-Cr-63,62.96186(75)#,,51.9961(6) 24-Cr-64,63.96420(75)#,,51.9961(6) 24-Cr-65,64.97037(97)#,,51.9961(6) 25-Mn-44,44.00687(54)#,,54.938049(9) 25-Mn-45,44.99451(32)#,,54.938049(9) 25-Mn-46,45.98672(12)#,,54.938049(9) 25-Mn-47,46.97610(17)#,,54.938049(9) 25-Mn-48,47.968870(80)#,,54.938049(9) 25-Mn-49,48.959623(26),,54.938049(9) 25-Mn-50,49.9542440(15),,54.938049(9) 25-Mn-51,50.9482155(14),,54.938049(9) 25-Mn-52,51.9455701(25),,54.938049(9) 25-Mn-53,52.9412947(15),,54.938049(9) 25-Mn-54,53.9403632(18),,54.938049(9) 25-Mn-55,54.9380496(14),100,54.938049(9) 25-Mn-56,55.9389094(15),,54.938049(9) 25-Mn-57,56.938287(4),,54.938049(9) 25-Mn-58,57.939990(30),,54.938049(9) 25-Mn-59,58.940450(30),,54.938049(9) 25-Mn-60,59.94319(29),,54.938049(9) 25-Mn-61,60.94446(28),,54.938049(9) 25-Mn-62,61.94797(28),,54.938049(9) 25-Mn-63,62.94981(30),,54.938049(9) 25-Mn-64,63.95373(35),,54.938049(9) 25-Mn-65,64.95610(60),,54.938049(9) 25-Mn-66,65.96082(75)#,,54.938049(9) 25-Mn-67,66.96382(86)#,,54.938049(9) 26-Fe-45,45.01456(43)#,,55.845(2) 26-Fe-46,46.00081(38)#,,55.845(2) 26-Fe-47,46.99289(28)#,,55.845(2) 26-Fe-48,47.98056(11)#,,55.845(2) 26-Fe-49,48.97361(17)#,,55.845(2) 26-Fe-50,49.962990(60),,55.845(2) 26-Fe-51,50.956825(16),,55.845(2) 26-Fe-52,51.948117(11),,55.845(2) 26-Fe-53,52.9453123(23),,55.845(2) 26-Fe-54,53.9396148(14),5.845(35),55.845(2) 26-Fe-55,54.9382980(14),,55.845(2) 26-Fe-56,55.9349421(15),91.754(36),55.845(2) 26-Fe-57,56.9353987(15),2.119(10),55.845(2) 26-Fe-58,57.9332805(15),0.282(4),55.845(2) 26-Fe-59,58.9348805(15),,55.845(2) 26-Fe-60,59.934077(4),,55.845(2) 26-Fe-61,60.936749(22),,55.845(2) 26-Fe-62,61.936770(16),,55.845(2) 26-Fe-63,62.94012(20),,55.845(2) 26-Fe-64,63.94087(30),,55.845(2) 26-Fe-65,64.94494(30),,55.845(2) 26-Fe-66,65.94598(35),,55.845(2) 26-Fe-67,66.95000(50),,55.845(2) 26-Fe-68,67.95251(75)#,,55.845(2) 26-Fe-69,68.95770(86)#,,55.845(2) 27-Co-48,48.00176(43)#,,58.933200(9) 27-Co-49,48.98972(28)#,,58.933200(9) 27-Co-50,49.98154(18)#,,58.933200(9) 27-Co-51,50.97072(16)#,,58.933200(9) 27-Co-52,51.963590(70)#,,58.933200(9) 27-Co-53,52.954225(19),,58.933200(9) 27-Co-54,53.9484641(14),,58.933200(9) 27-Co-55,54.9420031(15),,58.933200(9) 27-Co-56,55.9398439(26),,58.933200(9) 27-Co-57,56.9362962(15),,58.933200(9) 27-Co-58,57.9357576(19),,58.933200(9) 27-Co-59,58.9332002(15),100,58.933200(9) 27-Co-60,59.9338222(15),,58.933200(9) 27-Co-61,60.9324794(17),,58.933200(9) 27-Co-62,61.934054(22),,58.933200(9) 27-Co-63,62.933615(22),,58.933200(9) 27-Co-64,63.935814(22),,58.933200(9) 27-Co-65,64.936485(14),,58.933200(9) 27-Co-66,65.93983(29),,58.933200(9) 27-Co-67,66.94061(30),,58.933200(9) 27-Co-68,67.94436(35),,58.933200(9) 27-Co-69,68.94520(40),,58.933200(9) 27-Co-70,69.94981(75)#,,58.933200(9) 27-Co-71,70.95173(86)#,,58.933200(9) 27-Co-72,71.95641(86)#,,58.933200(9) 28-Ni-50,49.99593(28)#,,58.6934(2) 28-Ni-51,50.98772(28)#,,58.6934(2) 28-Ni-52,51.975680(90)#,,58.6934(2) 28-Ni-53,52.96846(17)#,,58.6934(2) 28-Ni-54,53.957910(50),,58.6934(2) 28-Ni-55,54.951336(12),,58.6934(2) 28-Ni-56,55.942136(12),,58.6934(2) 28-Ni-57,56.939800(3),,58.6934(2) 28-Ni-58,57.9353479(15),68.0769(89),58.6934(2) 28-Ni-59,58.9343516(15),,58.6934(2) 28-Ni-60,59.9307906(15),26.2231(77),58.6934(2) 28-Ni-61,60.9310604(15),1.1399(6),58.6934(2) 28-Ni-62,61.9283488(15),3.6345(17),58.6934(2) 28-Ni-63,62.9296729(15),,58.6934(2) 28-Ni-64,63.9279696(16),0.9256(9),58.6934(2) 28-Ni-65,64.9300880(16),,58.6934(2) 28-Ni-66,65.929115(17),,58.6934(2) 28-Ni-67,66.931570(20),,58.6934(2) 28-Ni-68,67.931845(18),,58.6934(2) 28-Ni-69,68.93518(15),,58.6934(2) 28-Ni-70,69.93614(35),,58.6934(2) 28-Ni-71,70.94000(40),,58.6934(2) 28-Ni-72,71.94130(50),,58.6934(2) 28-Ni-73,72.94608(64)#,,58.6934(2) 28-Ni-74,73.94791(75)#,,58.6934(2) 28-Ni-75,74.95297(86)#,,58.6934(2) 28-Ni-76,75.95533(97)#,,58.6934(2) 28-Ni-77,76.96083(107)#,,58.6934(2) 28-Ni-78,77.96380(118)#,,58.6934(2) 29-Cu-52,51.99718(28)#,,63.546(3) 29-Cu-53,52.98555(28)#,,63.546(3) 29-Cu-54,53.97671(23)#,,63.546(3) 29-Cu-55,54.96605(32)#,,63.546(3) 29-Cu-56,55.95856(15)#,,63.546(3) 29-Cu-57,56.949216(17),,63.546(3) 29-Cu-58,57.9445407(27),,63.546(3) 29-Cu-59,58.9395041(18),,63.546(3) 29-Cu-60,59.9373681(27),,63.546(3) 29-Cu-61,60.9334622(19),,63.546(3) 29-Cu-62,61.932587(4),,63.546(3) 29-Cu-63,62.9296011(15),69.17(3),63.546(3) 29-Cu-64,63.9297679(15),,63.546(3) 29-Cu-65,64.9277937(19),30.83(3),63.546(3) 29-Cu-66,65.9288730(19),,63.546(3) 29-Cu-67,66.927750(9),,63.546(3) 29-Cu-68,67.929640(50),,63.546(3) 29-Cu-69,68.929425(9),,63.546(3) 29-Cu-70,69.932409(16),,63.546(3) 29-Cu-71,70.932620(40),,63.546(3) 29-Cu-72,71.93552(21)#,,63.546(3) 29-Cu-73,72.93649(32)#,,63.546(3) 29-Cu-74,73.94020(43)#,,63.546(3) 29-Cu-75,74.94170(54)#,,63.546(3) 29-Cu-76,75.94599(64)#,,63.546(3) 29-Cu-77,76.94795(75)#,,63.546(3) 29-Cu-78,77.95281(86)#,,63.546(3) 29-Cu-79,78.95528(97)#,,63.546(3) 29-Cu-80,79.96189(97)#,,63.546(3) 30-Zn-54,53.99295(43)#,,65.409(4) 30-Zn-55,54.98398(27)#,,65.409(4) 30-Zn-56,55.97238(28)#,,65.409(4) 30-Zn-57,56.96491(15)#,,65.409(4) 30-Zn-58,57.954600(50),,65.409(4) 30-Zn-59,58.949270(40),,65.409(4) 30-Zn-60,59.941832(11),,65.409(4) 30-Zn-61,60.939514(18),,65.409(4) 30-Zn-62,61.934334(11),,65.409(4) 30-Zn-63,62.9332156(23),,65.409(4) 30-Zn-64,63.9291466(18),48.63(60),65.409(4) 30-Zn-65,64.9292451(18),,65.409(4) 30-Zn-66,65.9260368(16),27.90(27),65.409(4) 30-Zn-67,66.9271309(17),4.10(13),65.409(4) 30-Zn-68,67.9248476(17),18.75(51),65.409(4) 30-Zn-69,68.9265535(18),,65.409(4) 30-Zn-70,69.925325(4),0.62(3),65.409(4) 30-Zn-71,70.927727(11),,65.409(4) 30-Zn-72,71.926861(7),,65.409(4) 30-Zn-73,72.929780(40),,65.409(4) 30-Zn-74,73.929460(50),,65.409(4) 30-Zn-75,74.932940(80),,65.409(4) 30-Zn-76,75.93339(13),,65.409(4) 30-Zn-77,76.93709(14),,65.409(4) 30-Zn-78,77.93857(17),,65.409(4) 30-Zn-79,78.94268(29)#,,65.409(4) 30-Zn-80,79.94441(18),,65.409(4) 30-Zn-81,80.95048(43)#,,65.409(4) 30-Zn-82,81.95484(43)#,,65.409(4) 31-Ga-56,55.99491(28)#,,69.723(1) 31-Ga-57,56.98293(28)#,,69.723(1) 31-Ga-58,57.97425(23)#,,69.723(1) 31-Ga-59,58.96337(18)#,,69.723(1) 31-Ga-60,59.95706(12)#,,69.723(1) 31-Ga-61,60.94917(21)#,,69.723(1) 31-Ga-62,61.944180(30),,69.723(1) 31-Ga-63,62.93914(11),,69.723(1) 31-Ga-64,63.936838(4),,69.723(1) 31-Ga-65,64.9327393(19),,69.723(1) 31-Ga-66,65.931592(4),,69.723(1) 31-Ga-67,66.9282049(19),,69.723(1) 31-Ga-68,67.9279835(22),,69.723(1) 31-Ga-69,68.925581(3),60.108(9),69.723(1) 31-Ga-70,69.926028(3),,69.723(1) 31-Ga-71,70.9247050(19),39.892(9),69.723(1) 31-Ga-72,71.9263694(22),,69.723(1) 31-Ga-73,72.925170(7),,69.723(1) 31-Ga-74,73.926940(80),,69.723(1) 31-Ga-75,74.926501(7),,69.723(1) 31-Ga-76,75.92893(10),,69.723(1) 31-Ga-77,76.929280(60),,69.723(1) 31-Ga-78,77.931660(90),,69.723(1) 31-Ga-79,78.93292(13),,69.723(1) 31-Ga-80,79.93659(13),,69.723(1) 31-Ga-81,80.93775(21),,69.723(1) 31-Ga-82,81.94316(32)#,,69.723(1) 31-Ga-83,82.94687(54)#,,69.723(1) 31-Ga-84,83.95234(64)#,,69.723(1) 32-Ge-58,57.99101(34)#,,72.64(1) 32-Ge-59,58.98175(30)#,,72.64(1) 32-Ge-60,59.97019(25)#,,72.64(1) 32-Ge-61,60.96379(32)#,,72.64(1) 32-Ge-62,61.95465(15)#,,72.64(1) 32-Ge-63,62.94964(21)#,,72.64(1) 32-Ge-64,63.94157(27),,72.64(1) 32-Ge-65,64.93944(11),,72.64(1) 32-Ge-66,65.933850(30),,72.64(1) 32-Ge-67,66.932738(5),,72.64(1) 32-Ge-68,67.928097(7),,72.64(1) 32-Ge-69,68.927972(3),,72.64(1) 32-Ge-70,69.9242504(19),20.84(87),72.64(1) 32-Ge-71,70.9249540(19),,72.64(1) 32-Ge-72,71.9220762(16),27.54(34),72.64(1) 32-Ge-73,72.9234594(16),7.73(5),72.64(1) 32-Ge-74,73.9211782(16),36.28(73),72.64(1) 32-Ge-75,74.9228595(16),,72.64(1) 32-Ge-76,75.9214027(16),7.61(38),72.64(1) 32-Ge-77,76.9235485(20),,72.64(1) 32-Ge-78,77.922853(4),,72.64(1) 32-Ge-79,78.92540(10),,72.64(1) 32-Ge-80,79.925445(25),,72.64(1) 32-Ge-81,80.92882(13),,72.64(1) 32-Ge-82,81.92955(26),,72.64(1) 32-Ge-83,82.93451(32)#,,72.64(1) 32-Ge-84,83.93731(43)#,,72.64(1) 32-Ge-85,84.94269(54)#,,72.64(1) 32-Ge-86,85.94627(64)#,,72.64(1) 33-As-60,59.99313(64)#,,74.92160(2) 33-As-61,60.98062(64)#,,74.92160(2) 33-As-62,61.97320(32)#,,74.92160(2) 33-As-63,62.96369(54)#,,74.92160(2) 33-As-64,63.95757(38)#,,74.92160(2) 33-As-65,64.94948(42)#,,74.92160(2) 33-As-66,65.94437(22)#,,74.92160(2) 33-As-67,66.93919(11),,74.92160(2) 33-As-68,67.93679(11),,74.92160(2) 33-As-69,68.932280(30),,74.92160(2) 33-As-70,69.930930(50),,74.92160(2) 33-As-71,70.927115(5),,74.92160(2) 33-As-72,71.926753(5),,74.92160(2) 33-As-73,72.923825(4),,74.92160(2) 33-As-74,73.9239291(24),,74.92160(2) 33-As-75,74.9215964(18),100,74.92160(2) 33-As-76,75.9223939(18),,74.92160(2) 33-As-77,76.9206477(23),,74.92160(2) 33-As-78,77.921829(11),,74.92160(2) 33-As-79,78.920948(6),,74.92160(2) 33-As-80,79.922578(23),,74.92160(2) 33-As-81,80.922133(6),,74.92160(2) 33-As-82,81.92450(21),,74.92160(2) 33-As-83,82.92498(24),,74.92160(2) 33-As-84,83.92906(32)#,,74.92160(2) 33-As-85,84.93181(32)#,,74.92160(2) 33-As-86,85.93623(43)#,,74.92160(2) 33-As-87,86.93958(54)#,,74.92160(2) 33-As-88,87.94456(64)#,,74.92160(2) 33-As-89,88.94923(64)#,,74.92160(2) 34-Se-65,64.96466(64)#,,78.96(3) 34-Se-66,65.95521(32)#,,78.96(3) 34-Se-67,66.95009(21)#,,78.96(3) 34-Se-68,67.94187(32)#,,78.96(3) 34-Se-69,68.939560(40),,78.96(3) 34-Se-70,69.93350(22)#,,78.96(3) 34-Se-71,70.93227(22)#,,78.96(3) 34-Se-72,71.927112(13),,78.96(3) 34-Se-73,72.926767(12),,78.96(3) 34-Se-74,73.9224766(16),0.89(4),78.96(3) 34-Se-75,74.9225236(16),,78.96(3) 34-Se-76,75.9192141(16),9.37(29),78.96(3) 34-Se-77,76.9199146(16),7.63(16),78.96(3) 34-Se-78,77.9173095(16),23.77(28),78.96(3) 34-Se-79,78.9184998(16),,78.96(3) 34-Se-80,79.9165218(20),49.61(41),78.96(3) 34-Se-81,80.9179929(21),,78.96(3) 34-Se-82,81.9167000(22),8.73(22),78.96(3) 34-Se-83,82.919119(4),,78.96(3) 34-Se-84,83.918465(16),,78.96(3) 34-Se-85,84.922240(30),,78.96(3) 34-Se-86,85.924271(17),,78.96(3) 34-Se-87,86.928520(40),,78.96(3) 34-Se-88,87.931420(50),,78.96(3) 34-Se-89,88.93602(32)#,,78.96(3) 34-Se-90,89.93942(43)#,,78.96(3) 34-Se-91,90.94537(54)#,,78.96(3) 34-Se-92,91.94933(64)#,,78.96(3) 35-Br-67,66.96479(54)#,,79.904(1) 35-Br-68,67.95825(58)#,,79.904(1) 35-Br-69,68.95018(34)#,,79.904(1) 35-Br-70,69.94462(39)#,,79.904(1) 35-Br-71,70.93925(32)#,,79.904(1) 35-Br-72,71.93650(28),,79.904(1) 35-Br-73,72.93179(14),,79.904(1) 35-Br-74,73.929891(16),,79.904(1) 35-Br-75,74.925776(15),,79.904(1) 35-Br-76,75.924542(10),,79.904(1) 35-Br-77,76.921380(3),,79.904(1) 35-Br-78,77.921146(4),,79.904(1) 35-Br-79,78.9183376(20),50.69(7),79.904(1) 35-Br-80,79.9185300(20),,79.904(1) 35-Br-81,80.916291(3),49.31(7),79.904(1) 35-Br-82,81.916805(3),,79.904(1) 35-Br-83,82.915180(5),,79.904(1) 35-Br-84,83.916504(27),,79.904(1) 35-Br-85,84.915608(21),,79.904(1) 35-Br-86,85.918797(12),,79.904(1) 35-Br-87,86.920711(19),,79.904(1) 35-Br-88,87.924070(40),,79.904(1) 35-Br-89,88.926390(60),,79.904(1) 35-Br-90,89.930630(80),,79.904(1) 35-Br-91,90.933970(80),,79.904(1) 35-Br-92,91.939260(50),,79.904(1) 35-Br-93,92.94310(32)#,,79.904(1) 35-Br-94,93.94868(43)#,,79.904(1) 36-Kr-69,68.96532(54)#,,83.798(2) 36-Kr-70,69.95601(43)#,,83.798(2) 36-Kr-71,70.95051(32)#,,83.798(2) 36-Kr-72,71.94191(29),,83.798(2) 36-Kr-73,72.93893(15),,83.798(2) 36-Kr-74,73.933260(60),,83.798(2) 36-Kr-75,74.931034(17),,83.798(2) 36-Kr-76,75.925948(11),,83.798(2) 36-Kr-77,76.924668(9),,83.798(2) 36-Kr-78,77.920386(7),0.35(1),83.798(2) 36-Kr-79,78.920083(4),,83.798(2) 36-Kr-80,79.916378(4),2.28(6),83.798(2) 36-Kr-81,80.916592(3),,83.798(2) 36-Kr-82,81.9134846(28),11.58(14),83.798(2) 36-Kr-83,82.914136(3),11.49(6),83.798(2) 36-Kr-84,83.911507(3),57.00(4),83.798(2) 36-Kr-85,84.912527(3),,83.798(2) 36-Kr-86,85.9106103(12),17.30(22),83.798(2) 36-Kr-87,86.9133543(14),,83.798(2) 36-Kr-88,87.914447(14),,83.798(2) 36-Kr-89,88.917630(60),,83.798(2) 36-Kr-90,89.919524(20),,83.798(2) 36-Kr-91,90.923440(60),,83.798(2) 36-Kr-92,91.926153(13),,83.798(2) 36-Kr-93,92.93127(11),,83.798(2) 36-Kr-94,93.93436(32)#,,83.798(2) 36-Kr-95,94.93984(43)#,,83.798(2) 36-Kr-96,95.94307(54)#,,83.798(2) 36-Kr-97,96.94856(54)#,,83.798(2) 37-Rb-71,70.96532(54)#,,85.4678(3) 37-Rb-72,71.95908(54)#,,85.4678(3) 37-Rb-73,72.95037(52)#,,85.4678(3) 37-Rb-74,73.94447(77),,85.4678(3) 37-Rb-75,74.938569(8),,85.4678(3) 37-Rb-76,75.935071(8),,85.4678(3) 37-Rb-77,76.930407(8),,85.4678(3) 37-Rb-78,77.928141(8),,85.4678(3) 37-Rb-79,78.923997(7),,85.4678(3) 37-Rb-80,79.922519(8),,85.4678(3) 37-Rb-81,80.918994(7),,85.4678(3) 37-Rb-82,81.918208(8),,85.4678(3) 37-Rb-83,82.915112(7),,85.4678(3) 37-Rb-84,83.914385(3),,85.4678(3) 37-Rb-85,84.9117893(25),72.17(2),85.4678(3) 37-Rb-86,85.9111671(25),,85.4678(3) 37-Rb-87,86.9091835(27),27.83(2),85.4678(3) 37-Rb-88,87.911319(5),,85.4678(3) 37-Rb-89,88.912280(6),,85.4678(3) 37-Rb-90,89.914809(9),,85.4678(3) 37-Rb-91,90.916534(9),,85.4678(3) 37-Rb-92,91.919725(7),,85.4678(3) 37-Rb-93,92.922033(8),,85.4678(3) 37-Rb-94,93.926407(9),,85.4678(3) 37-Rb-95,94.929319(21),,85.4678(3) 37-Rb-96,95.934284(27),,85.4678(3) 37-Rb-97,96.937340(30),,85.4678(3) 37-Rb-98,97.941700(40),,85.4678(3) 37-Rb-99,98.94542(16),,85.4678(3) 37-Rb-100,99.94987(32)#,,85.4678(3) 37-Rb-101,100.95320(18),,85.4678(3) 37-Rb-102,101.95921(54)#,,85.4678(3) 38-Sr-73,72.96597(64)#,,87.62(1) 38-Sr-74,73.95631(54)#,,87.62(1) 38-Sr-75,74.94992(32)#,,87.62(1) 38-Sr-76,75.94161(32)#,,87.62(1) 38-Sr-77,76.93776(16),,87.62(1) 38-Sr-78,77.932179(8),,87.62(1) 38-Sr-79,78.929707(9),,87.62(1) 38-Sr-80,79.924525(8),,87.62(1) 38-Sr-81,80.923213(8),,87.62(1) 38-Sr-82,81.918401(6),,87.62(1) 38-Sr-83,82.917555(9),,87.62(1) 38-Sr-84,83.913425(4),0.56(1),87.62(1) 38-Sr-85,84.912933(4),,87.62(1) 38-Sr-86,85.9092624(24),9.86(1),87.62(1) 38-Sr-87,86.9088793(24),7.00(1),87.62(1) 38-Sr-88,87.9056143(24),82.58(1),87.62(1) 38-Sr-89,88.9074529(24),,87.62(1) 38-Sr-90,89.9077376(29),,87.62(1) 38-Sr-91,90.910210(6),,87.62(1) 38-Sr-92,91.911030(7),,87.62(1) 38-Sr-93,92.914022(8),,87.62(1) 38-Sr-94,93.915360(8),,87.62(1) 38-Sr-95,94.919358(8),,87.62(1) 38-Sr-96,95.921680(26),,87.62(1) 38-Sr-97,96.926149(20),,87.62(1) 38-Sr-98,97.928471(27),,87.62(1) 38-Sr-99,98.93332(15),,87.62(1) 38-Sr-100,99.93535(14),,87.62(1) 38-Sr-101,100.94052(13),,87.62(1) 38-Sr-102,101.94302(12),,87.62(1) 38-Sr-103,102.94895(54)#,,87.62(1) 38-Sr-104,103.95233(75)#,,87.62(1) 39-Y-77,76.94962(32)#,,88.90585(2) 39-Y-78,77.94350(43)#,,88.90585(2) 39-Y-79,78.93735(48),,88.90585(2) 39-Y-80,79.93434(43)#,,88.90585(2) 39-Y-81,80.929130(70),,88.90585(2) 39-Y-82,81.92679(11),,88.90585(2) 39-Y-83,82.922350(50),,88.90585(2) 39-Y-84,83.92039(10),,88.90585(2) 39-Y-85,84.916427(27),,88.90585(2) 39-Y-86,85.914888(15),,88.90585(2) 39-Y-87,86.9108778(28),,88.90585(2) 39-Y-88,87.9095034(29),,88.90585(2) 39-Y-89,88.9058479(25),100,88.90585(2) 39-Y-90,89.9071514(25),,88.90585(2) 39-Y-91,90.907303(3),,88.90585(2) 39-Y-92,91.908947(10),,88.90585(2) 39-Y-93,92.909582(11),,88.90585(2) 39-Y-94,93.911594(8),,88.90585(2) 39-Y-95,94.912824(8),,88.90585(2) 39-Y-96,95.915898(23),,88.90585(2) 39-Y-97,96.918131(13),,88.90585(2) 39-Y-98,97.922220(26),,88.90585(2) 39-Y-99,98.924635(26),,88.90585(2) 39-Y-100,99.927760(80),,88.90585(2) 39-Y-101,100.93031(10),,88.90585(2) 39-Y-102,101.933560(90),,88.90585(2) 39-Y-103,102.93694(32)#,,88.90585(2) 39-Y-104,103.94145(43)#,,88.90585(2) 39-Y-105,104.94509(54)#,,88.90585(2) 39-Y-106,105.95022(75)#,,88.90585(2) 40-Zr-79,78.94916(43)#,,91.224(2) 40-Zr-80,79.94055(32)#,,91.224(2) 40-Zr-81,80.93682(32),,91.224(2) 40-Zr-82,81.93109(55),,91.224(2) 40-Zr-83,82.92865(10),,91.224(2) 40-Zr-84,83.92325(21)#,,91.224(2) 40-Zr-85,84.92147(11),,91.224(2) 40-Zr-86,85.916470(30),,91.224(2) 40-Zr-87,86.914817(9),,91.224(2) 40-Zr-88,87.910226(11),,91.224(2) 40-Zr-89,88.908889(4),,91.224(2) 40-Zr-90,89.9047037(23),51.45(40),91.224(2) 40-Zr-91,90.9056450(23),11.22(5),91.224(2) 40-Zr-92,91.9050401(23),17.15(8),91.224(2) 40-Zr-93,92.9064756(23),,91.224(2) 40-Zr-94,93.9063158(25),17.38(28),91.224(2) 40-Zr-95,94.9080427(25),,91.224(2) 40-Zr-96,95.908276(3),2.80(9),91.224(2) 40-Zr-97,96.910951(3),,91.224(2) 40-Zr-98,97.912746(21),,91.224(2) 40-Zr-99,98.916511(21),,91.224(2) 40-Zr-100,99.917760(40),,91.224(2) 40-Zr-101,100.921140(30),,91.224(2) 40-Zr-102,101.922980(50),,91.224(2) 40-Zr-103,102.92660(12),,91.224(2) 40-Zr-104,103.92878(43)#,,91.224(2) 40-Zr-105,104.93305(43)#,,91.224(2) 40-Zr-106,105.93591(54)#,,91.224(2) 40-Zr-107,106.94086(64)#,,91.224(2) 40-Zr-108,107.94428(75)#,,91.224(2) 41-Nb-81,80.94905(43)#,,92.90638(2) 41-Nb-82,81.94313(32)#,,92.90638(2) 41-Nb-83,82.93670(34),,92.90638(2) 41-Nb-84,83.93357(32)#,,92.90638(2) 41-Nb-85,84.92791(24),,92.90638(2) 41-Nb-86,85.925040(90),,92.90638(2) 41-Nb-87,86.920360(70),,92.90638(2) 41-Nb-88,87.91796(22)#,,92.90638(2) 41-Nb-89,88.913500(40),,92.90638(2) 41-Nb-90,89.911264(5),,92.90638(2) 41-Nb-91,90.906991(3),,92.90638(2) 41-Nb-92,91.9071932(29),,92.90638(2) 41-Nb-93,92.9063775(24),100,92.90638(2) 41-Nb-94,93.9072835(24),,92.90638(2) 41-Nb-95,94.9068352(20),,92.90638(2) 41-Nb-96,95.908100(4),,92.90638(2) 41-Nb-97,96.9080971(28),,92.90638(2) 41-Nb-98,97.910331(6),,92.90638(2) 41-Nb-99,98.911618(14),,92.90638(2) 41-Nb-100,99.914181(28),,92.90638(2) 41-Nb-101,100.915252(20),,92.90638(2) 41-Nb-102,101.918040(40),,92.90638(2) 41-Nb-103,102.919140(70),,92.90638(2) 41-Nb-104,103.92246(12),,92.90638(2) 41-Nb-105,104.92393(11),,92.90638(2) 41-Nb-106,105.92819(32)#,,92.90638(2) 41-Nb-107,106.93031(43)#,,92.90638(2) 41-Nb-108,107.93501(54)#,,92.90638(2) 41-Nb-109,108.93763(54)#,,92.90638(2) 41-Nb-110,109.94268(64)#,,92.90638(2) 42-Mo-83,82.94874(54)#,,95.94(2) 42-Mo-84,83.94009(43)#,,95.94(2) 42-Mo-85,84.93659(43)#,,95.94(2) 42-Mo-86,85.93070(47),,95.94(2) 42-Mo-87,86.92733(24),,95.94(2) 42-Mo-88,87.921953(22),,95.94(2) 42-Mo-89,88.919481(17),,95.94(2) 42-Mo-90,89.913936(7),,95.94(2) 42-Mo-91,90.911751(12),,95.94(2) 42-Mo-92,91.906810(4),14.84(35),95.94(2) 42-Mo-93,92.906812(4),,95.94(2) 42-Mo-94,93.9050876(20),9.25(12),95.94(2) 42-Mo-95,94.9058415(20),15.92(13),95.94(2) 42-Mo-96,95.9046789(20),16.68(2),95.94(2) 42-Mo-97,96.9060210(20),9.55(8),95.94(2) 42-Mo-98,97.9054078(20),24.13(31),95.94(2) 42-Mo-99,98.9077116(20),,95.94(2) 42-Mo-100,99.907477(6),9.63(23),95.94(2) 42-Mo-101,100.910347(6),,95.94(2) 42-Mo-102,101.910297(22),,95.94(2) 42-Mo-103,102.913200(70),,95.94(2) 42-Mo-104,103.913760(70),,95.94(2) 42-Mo-105,104.916970(80),,95.94(2) 42-Mo-106,105.918134(23),,95.94(2) 42-Mo-107,106.92169(17),,95.94(2) 42-Mo-108,107.92358(21)#,,95.94(2) 42-Mo-109,108.92781(32)#,,95.94(2) 42-Mo-110,109.92973(43)#,,95.94(2) 42-Mo-111,110.93451(54)#,,95.94(2) 42-Mo-112,111.93684(64)#,,95.94(2) 42-Mo-113,112.94203(64)#,,95.94(2) 43-Tc-85,84.94894(54)#,,[98] 43-Tc-86,85.94288(32)#,,[98] 43-Tc-87,86.93653(32)#,,[98] 43-Tc-88,87.93283(32)#,,[98] 43-Tc-89,88.92754(23),,[98] 43-Tc-90,89.92356(26),,[98] 43-Tc-91,90.91843(22),,[98] 43-Tc-92,91.915260(28),,[98] 43-Tc-93,92.910248(4),,[98] 43-Tc-94,93.909656(5),,[98] 43-Tc-95,94.907656(6),,[98] 43-Tc-96,95.907871(6),,[98] 43-Tc-97,96.906365(5),,[98] 43-Tc-98,97.907216(4),,[98] 43-Tc-99,98.9062546(21),,[98] 43-Tc-100,99.9076576(23),,[98] 43-Tc-101,100.907314(26),,[98] 43-Tc-102,101.909213(10),,[98] 43-Tc-103,102.909179(11),,[98] 43-Tc-104,103.911440(50),,[98] 43-Tc-105,104.911660(60),,[98] 43-Tc-106,105.914355(15),,[98] 43-Tc-107,106.91508(16),,[98] 43-Tc-108,107.91848(14),,[98] 43-Tc-109,108.91963(23)#,,[98] 43-Tc-110,109.92339(43)#,,[98] 43-Tc-111,110.92505(43)#,,[98] 43-Tc-112,111.92924(54)#,,[98] 43-Tc-113,112.93133(64)#,,[98] 43-Tc-114,113.93588(64)#,,[98] 43-Tc-115,114.93828(75)#,,[98] 44-Ru-87,86.94918(64)#,,101.07(2) 44-Ru-88,87.94042(54)#,,101.07(2) 44-Ru-89,88.93611(54)#,,101.07(2) 44-Ru-90,89.92978(43)#,,101.07(2) 44-Ru-91,90.92638(54),,101.07(2) 44-Ru-92,91.92012(32)#,,101.07(2) 44-Ru-93,92.917050(90),,101.07(2) 44-Ru-94,93.911360(14),,101.07(2) 44-Ru-95,94.910413(13),,101.07(2) 44-Ru-96,95.907598(8),5.54(14),101.07(2) 44-Ru-97,96.907555(9),,101.07(2) 44-Ru-98,97.905287(7),1.87(3),101.07(2) 44-Ru-99,98.9059393(21),12.76(14),101.07(2) 44-Ru-100,99.9042197(22),12.60(7),101.07(2) 44-Ru-101,100.9055822(22),17.06(2),101.07(2) 44-Ru-102,101.9043495(22),31.55(14),101.07(2) 44-Ru-103,102.9063237(22),,101.07(2) 44-Ru-104,103.905430(4),18.62(27),101.07(2) 44-Ru-105,104.907750(4),,101.07(2) 44-Ru-106,105.907327(8),,101.07(2) 44-Ru-107,106.90991(13),,101.07(2) 44-Ru-108,107.91019(13),,101.07(2) 44-Ru-109,108.913200(70),,101.07(2) 44-Ru-110,109.91397(25),,101.07(2) 44-Ru-111,110.91756(32)#,,101.07(2) 44-Ru-112,111.91855(58)#,,101.07(2) 44-Ru-113,112.92254(54)#,,101.07(2) 44-Ru-114,113.92400(39)#,,101.07(2) 44-Ru-115,114.92831(64)#,,101.07(2) 44-Ru-116,115.93016(75)#,,101.07(2) 44-Ru-117,116.93479(86)#,,101.07(2) 44-Ru-118,117.93703(97)#,,101.07(2) 45-Rh-89,88.94938(54)#,,102.90550(2) 45-Rh-90,89.94287(54)#,,102.90550(2) 45-Rh-91,90.93655(43)#,,102.90550(2) 45-Rh-92,91.93198(43)#,,102.90550(2) 45-Rh-93,92.92574(43)#,,102.90550(2) 45-Rh-94,93.92170(48)#,,102.90550(2) 45-Rh-95,94.91590(16),,102.90550(2) 45-Rh-96,95.914518(14),,102.90550(2) 45-Rh-97,96.911340(40),,102.90550(2) 45-Rh-98,97.910716(13),,102.90550(2) 45-Rh-99,98.908132(8),,102.90550(2) 45-Rh-100,99.908117(22),,102.90550(2) 45-Rh-101,100.906164(19),,102.90550(2) 45-Rh-102,101.906843(5),,102.90550(2) 45-Rh-103,102.905504(3),100,102.90550(2) 45-Rh-104,103.906655(3),,102.90550(2) 45-Rh-105,104.905692(5),,102.90550(2) 45-Rh-106,105.907285(8),,102.90550(2) 45-Rh-107,106.906751(13),,102.90550(2) 45-Rh-108,107.90873(11),,102.90550(2) 45-Rh-109,108.908736(13),,102.90550(2) 45-Rh-110,109.91095(24),,102.90550(2) 45-Rh-111,110.91166(22)#,,102.90550(2) 45-Rh-112,111.91461(54)#,,102.90550(2) 45-Rh-113,112.91542(43)#,,102.90550(2) 45-Rh-114,113.91885(32)#,,102.90550(2) 45-Rh-115,114.92012(54),,102.90550(2) 45-Rh-116,115.92371(54)#,,102.90550(2) 45-Rh-117,116.92535(64)#,,102.90550(2) 45-Rh-118,117.92943(75)#,,102.90550(2) 45-Rh-119,118.93136(86)#,,102.90550(2) 45-Rh-120,119.93578(86)#,,102.90550(2) 45-Rh-121,120.93808(97)#,,102.90550(2) 46-Pd-91,90.94948(64)#,,106.42(1) 46-Pd-92,91.94042(54)#,,106.42(1) 46-Pd-93,92.93591(43)#,,106.42(1) 46-Pd-94,93.92877(43)#,,106.42(1) 46-Pd-95,94.92469(43)#,,106.42(1) 46-Pd-96,95.91822(16),,106.42(1) 46-Pd-97,96.91648(32),,106.42(1) 46-Pd-98,97.912721(23),,106.42(1) 46-Pd-99,98.911768(16),,106.42(1) 46-Pd-100,99.908505(12),,106.42(1) 46-Pd-101,100.908289(19),,106.42(1) 46-Pd-102,101.905608(3),1.02(1),106.42(1) 46-Pd-103,102.906087(3),,106.42(1) 46-Pd-104,103.904035(5),11.14(8),106.42(1) 46-Pd-105,104.905084(5),22.33(8),106.42(1) 46-Pd-106,105.903483(5),27.33(3),106.42(1) 46-Pd-107,106.905128(7),,106.42(1) 46-Pd-108,107.903894(4),26.46(9),106.42(1) 46-Pd-109,108.905954(4),,106.42(1) 46-Pd-110,109.905152(12),11.72(9),106.42(1) 46-Pd-111,110.907640(40),,106.42(1) 46-Pd-112,111.907313(19),,106.42(1) 46-Pd-113,112.910150(40),,106.42(1) 46-Pd-114,113.910365(26),,106.42(1) 46-Pd-115,114.913680(70),,106.42(1) 46-Pd-116,115.914160(60),,106.42(1) 46-Pd-117,116.91784(32)#,,106.42(1) 46-Pd-118,117.91898(23),,106.42(1) 46-Pd-119,118.92268(32)#,,106.42(1) 46-Pd-120,119.92403(43)#,,106.42(1) 46-Pd-121,120.92818(54)#,,106.42(1) 46-Pd-122,121.92980(54)#,,106.42(1) 46-Pd-123,122.93426(64)#,,106.42(1) 47-Ag-94,93.94278(54)#,,107.8682(2) 47-Ag-95,94.93548(43)#,,107.8682(2) 47-Ag-96,95.93068(43)#,,107.8682(2) 47-Ag-97,96.92400(43)#,,107.8682(2) 47-Ag-98,97.92176(16),,107.8682(2) 47-Ag-99,98.91760(16),,107.8682(2) 47-Ag-100,99.916070(80),,107.8682(2) 47-Ag-101,100.91280(11),,107.8682(2) 47-Ag-102,101.912000(80),,107.8682(2) 47-Ag-103,102.908972(18),,107.8682(2) 47-Ag-104,103.908628(7),,107.8682(2) 47-Ag-105,104.906528(12),,107.8682(2) 47-Ag-106,105.906666(6),,107.8682(2) 47-Ag-107,106.905093(6),51.839(8),107.8682(2) 47-Ag-108,107.905954(6),,107.8682(2) 47-Ag-109,108.904756(3),48.161(8),107.8682(2) 47-Ag-110,109.906110(3),,107.8682(2) 47-Ag-111,110.905295(4),,107.8682(2) 47-Ag-112,111.907004(18),,107.8682(2) 47-Ag-113,112.906566(18),,107.8682(2) 47-Ag-114,113.908808(28),,107.8682(2) 47-Ag-115,114.908760(40),,107.8682(2) 47-Ag-116,115.911360(50),,107.8682(2) 47-Ag-117,116.911680(50),,107.8682(2) 47-Ag-118,117.914580(70),,107.8682(2) 47-Ag-119,118.91567(10),,107.8682(2) 47-Ag-120,119.918790(80),,107.8682(2) 47-Ag-121,120.91985(16),,107.8682(2) 47-Ag-122,121.92332(22)#,,107.8682(2) 47-Ag-123,122.92490(32)#,,107.8682(2) 47-Ag-124,123.92853(43)#,,107.8682(2) 47-Ag-125,124.93054(43)#,,107.8682(2) 47-Ag-126,125.93450(43)#,,107.8682(2) 47-Ag-127,126.93688(54)#,,107.8682(2) 48-Cd-96,95.93977(54)#,,112.411(8) 48-Cd-97,96.93494(43)#,,112.411(8) 48-Cd-98,97.92758(22)#,,112.411(8) 48-Cd-99,98.92501(22)#,,112.411(8) 48-Cd-100,99.92023(10),,112.411(8) 48-Cd-101,100.91868(16),,112.411(8) 48-Cd-102,101.914780(80),,112.411(8) 48-Cd-103,102.913419(17),,112.411(8) 48-Cd-104,103.909848(10),,112.411(8) 48-Cd-105,104.909468(12),,112.411(8) 48-Cd-106,105.906458(6),1.25(6),112.411(8) 48-Cd-107,106.906614(7),,112.411(8) 48-Cd-108,107.904183(6),0.89(3),112.411(8) 48-Cd-109,108.904986(4),,112.411(8) 48-Cd-110,109.903006(3),12.49(18),112.411(8) 48-Cd-111,110.904182(3),12.80(12),112.411(8) 48-Cd-112,111.9027572(30),24.13(21),112.411(8) 48-Cd-113,112.9044009(30),12.22(12),112.411(8) 48-Cd-114,113.9033581(30),28.73(42),112.411(8) 48-Cd-115,114.905431(3),,112.411(8) 48-Cd-116,115.904755(3),7.49(18),112.411(8) 48-Cd-117,116.907218(4),,112.411(8) 48-Cd-118,117.906914(22),,112.411(8) 48-Cd-119,118.909920(90),,112.411(8) 48-Cd-120,119.909851(20),,112.411(8) 48-Cd-121,120.912980(90),,112.411(8) 48-Cd-122,121.91350(22)#,,112.411(8) 48-Cd-123,122.917000(40),,112.411(8) 48-Cd-124,123.917650(70),,112.411(8) 48-Cd-125,124.921250(70),,112.411(8) 48-Cd-126,125.922350(60),,112.411(8) 48-Cd-127,126.926430(80),,112.411(8) 48-Cd-128,127.92776(32),,112.411(8) 48-Cd-129,128.93226(43)#,,112.411(8) 48-Cd-130,129.93398(43)#,,112.411(8) 49-In-98,97.94224(54)#,,114.818(3) 49-In-99,98.93461(54)#,,114.818(3) 49-In-100,99.93115(41),,114.818(3) 49-In-101,100.92656(32)#,,114.818(3) 49-In-102,101.92471(41),,114.818(3) 49-In-103,102.919914(27),,114.818(3) 49-In-104,103.91834(15),,114.818(3) 49-In-105,104.914673(19),,114.818(3) 49-In-106,105.913461(15),,114.818(3) 49-In-107,106.910292(14),,114.818(3) 49-In-108,107.909720(40),,114.818(3) 49-In-109,108.907154(6),,114.818(3) 49-In-110,109.907169(13),,114.818(3) 49-In-111,110.905111(6),,114.818(3) 49-In-112,111.905533(6),,114.818(3) 49-In-113,112.904061(4),4.29(5),114.818(3) 49-In-114,113.904917(3),,114.818(3) 49-In-115,114.903878(5),95.71(5),114.818(3) 49-In-116,115.905260(5),,114.818(3) 49-In-117,116.904516(6),,114.818(3) 49-In-118,117.906355(9),,114.818(3) 49-In-119,118.905846(8),,114.818(3) 49-In-120,119.907960(40),,114.818(3) 49-In-121,120.907849(29),,114.818(3) 49-In-122,121.910280(50),,114.818(3) 49-In-123,122.910439(26),,114.818(3) 49-In-124,123.913180(50),,114.818(3) 49-In-125,124.913600(30),,114.818(3) 49-In-126,125.916460(40),,114.818(3) 49-In-127,126.917340(40),,114.818(3) 49-In-128,127.920170(50),,114.818(3) 49-In-129,128.92166(14),,114.818(3) 49-In-130,129.924850(50),,114.818(3) 49-In-131,130.926770(80),,114.818(3) 49-In-132,131.932920(70),,114.818(3) 49-In-133,132.93834(43)#,,114.818(3) 49-In-134,133.94466(54)#,,114.818(3) 50-Sn-100,99.93895(46)#,,118.710(7) 50-Sn-101,100.93606(54)#,,118.710(7) 50-Sn-102,101.93049(43)#,,118.710(7) 50-Sn-103,102.92813(32)#,,118.710(7) 50-Sn-104,103.92319(16),,118.710(7) 50-Sn-105,104.92139(10),,118.710(7) 50-Sn-106,105.916880(50),,118.710(7) 50-Sn-107,106.915670(90),,118.710(7) 50-Sn-108,107.911970(50),,118.710(7) 50-Sn-109,108.911287(11),,118.710(7) 50-Sn-110,109.907853(17),,118.710(7) 50-Sn-111,110.907735(8),,118.710(7) 50-Sn-112,111.904821(5),0.97(1),118.710(7) 50-Sn-113,112.905173(4),,118.710(7) 50-Sn-114,113.902782(3),0.66(1),118.710(7) 50-Sn-115,114.903346(3),0.34(1),118.710(7) 50-Sn-116,115.901744(3),14.54(9),118.710(7) 50-Sn-117,116.902954(3),7.68(7),118.710(7) 50-Sn-118,117.901606(3),24.22(9),118.710(7) 50-Sn-119,118.903309(3),8.59(4),118.710(7) 50-Sn-120,119.9021966(27),32.58(9),118.710(7) 50-Sn-121,120.9042369(27),,118.710(7) 50-Sn-122,121.9034401(29),4.63(3),118.710(7) 50-Sn-123,122.9057219(29),,118.710(7) 50-Sn-124,123.9052746(15),5.79(5),118.710(7) 50-Sn-125,124.9077849(16),,118.710(7) 50-Sn-126,125.907654(11),,118.710(7) 50-Sn-127,126.910351(27),,118.710(7) 50-Sn-128,127.910535(29),,118.710(7) 50-Sn-129,128.91344(13),,118.710(7) 50-Sn-130,129.913850(30),,118.710(7) 50-Sn-131,130.916920(80),,118.710(7) 50-Sn-132,131.917744(28),,118.710(7) 50-Sn-133,132.923810(90),,118.710(7) 50-Sn-134,133.92846(11),,118.710(7) 50-Sn-135,134.93473(43)#,,118.710(7) 50-Sn-136,135.93934(54)#,,118.710(7) 50-Sn-137,136.94579(64)#,,118.710(7) 51-Sb-103,102.94012(54)#,,121.760(1) 51-Sb-104,103.93629(39)#,,121.760(1) 51-Sb-105,104.93153(17),,121.760(1) 51-Sb-106,105.92876(34)#,,121.760(1) 51-Sb-107,106.92415(32)#,,121.760(1) 51-Sb-108,107.92216(22)#,,121.760(1) 51-Sb-109,108.918136(20),,121.760(1) 51-Sb-110,109.91676(22)#,,121.760(1) 51-Sb-111,110.91321(22)#,,121.760(1) 51-Sb-112,111.912395(25),,121.760(1) 51-Sb-113,112.909378(24),,121.760(1) 51-Sb-114,113.90910(22),,121.760(1) 51-Sb-115,114.906599(22),,121.760(1) 51-Sb-116,115.906797(6),,121.760(1) 51-Sb-117,116.904840(10),,121.760(1) 51-Sb-118,117.905532(4),,121.760(1) 51-Sb-119,118.903946(9),,121.760(1) 51-Sb-120,119.905074(8),,121.760(1) 51-Sb-121,120.9038180(24),57.21(5),121.760(1) 51-Sb-122,121.9051754(24),,121.760(1) 51-Sb-123,122.9042157(22),42.79(5),121.760(1) 51-Sb-124,123.9059375(22),,121.760(1) 51-Sb-125,124.905248(3),,121.760(1) 51-Sb-126,125.907250(30),,121.760(1) 51-Sb-127,126.906915(6),,121.760(1) 51-Sb-128,127.909167(27),,121.760(1) 51-Sb-129,128.909150(23),,121.760(1) 51-Sb-130,129.911546(27),,121.760(1) 51-Sb-131,130.911950(80),,121.760(1) 51-Sb-132,131.914413(25),,121.760(1) 51-Sb-133,132.915240(80),,121.760(1) 51-Sb-134,133.920550(60),,121.760(1) 51-Sb-135,134.92517(11),,121.760(1) 51-Sb-136,135.93066(32)#,,121.760(1) 51-Sb-137,136.93531(43)#,,121.760(1) 51-Sb-138,137.94096(54)#,,121.760(1) 51-Sb-139,138.94571(64)#,,121.760(1) 52-Te-106,105.93770(43)#,,127.60(3) 52-Te-107,106.93504(32)#,,127.60(3) 52-Te-108,107.92949(16),,127.60(3) 52-Te-109,108.927460(80),,127.60(3) 52-Te-110,109.922410(60),,127.60(3) 52-Te-111,110.921120(80),,127.60(3) 52-Te-112,111.91706(18),,127.60(3) 52-Te-113,112.91593(22)#,,127.60(3) 52-Te-114,113.91206(22)#,,127.60(3) 52-Te-115,114.91158(11),,127.60(3) 52-Te-116,115.90842(10),,127.60(3) 52-Te-117,116.908634(20),,127.60(3) 52-Te-118,117.905825(17),,127.60(3) 52-Te-119,118.906408(9),,127.60(3) 52-Te-120,119.904020(11),0.09(1),127.60(3) 52-Te-121,120.904930(27),,127.60(3) 52-Te-122,121.9030471(20),2.55(12),127.60(3) 52-Te-123,122.9042730(19),0.89(3),127.60(3) 52-Te-124,123.9028195(16),4.74(14),127.60(3) 52-Te-125,124.9044247(20),7.07(15),127.60(3) 52-Te-126,125.9033055(20),18.84(25),127.60(3) 52-Te-127,126.905217(4),,127.60(3) 52-Te-128,127.9044614(19),31.74(8),127.60(3) 52-Te-129,128.906596(3),,127.60(3) 52-Te-130,129.9062228(21),34.08(62),127.60(3) 52-Te-131,130.9085219(22),,127.60(3) 52-Te-132,131.908524(12),,127.60(3) 52-Te-133,132.910940(80),,127.60(3) 52-Te-134,133.911540(40),,127.60(3) 52-Te-135,134.91645(10),,127.60(3) 52-Te-136,135.920100(50),,127.60(3) 52-Te-137,136.92532(13),,127.60(3) 52-Te-138,137.92922(22)#,,127.60(3) 52-Te-139,138.93473(43)#,,127.60(3) 52-Te-140,139.93870(54)#,,127.60(3) 52-Te-141,140.94439(54)#,,127.60(3) 52-Te-142,141.94850(64)#,,127.60(3) 53-I-108,107.94329(39)#,,126.90447(3) 53-I-109,108.93819(16),,126.90447(3) 53-I-110,109.93521(33)#,,126.90447(3) 53-I-111,110.93028(32)#,,126.90447(3) 53-I-112,111.92797(23)#,,126.90447(3) 53-I-113,112.923640(60),,126.90447(3) 53-I-114,113.92185(32)#,,126.90447(3) 53-I-115,114.91792(50)#,,126.90447(3) 53-I-116,115.91674(15),,126.90447(3) 53-I-117,116.913650(80),,126.90447(3) 53-I-118,117.913380(80),,126.90447(3) 53-I-119,118.910180(70),,126.90447(3) 53-I-120,119.910048(20),,126.90447(3) 53-I-121,120.907366(12),,126.90447(3) 53-I-122,121.907592(6),,126.90447(3) 53-I-123,122.905598(4),,126.90447(3) 53-I-124,123.9062114(26),,126.90447(3) 53-I-125,124.9046241(20),,126.90447(3) 53-I-126,125.905619(4),,126.90447(3) 53-I-127,126.904468(4),100,126.90447(3) 53-I-128,127.905805(4),,126.90447(3) 53-I-129,128.904987(4),,126.90447(3) 53-I-130,129.906674(4),,126.90447(3) 53-I-131,130.9061242(12),,126.90447(3) 53-I-132,131.907995(11),,126.90447(3) 53-I-133,132.907806(28),,126.90447(3) 53-I-134,133.909877(16),,126.90447(3) 53-I-135,134.910050(25),,126.90447(3) 53-I-136,135.914660(50),,126.90447(3) 53-I-137,136.917873(30),,126.90447(3) 53-I-138,137.922380(90),,126.90447(3) 53-I-139,138.926090(30),,126.90447(3) 53-I-140,139.93121(23)#,,126.90447(3) 53-I-141,140.93483(32)#,,126.90447(3) 53-I-142,141.94018(43)#,,126.90447(3) 53-I-143,142.94407(43)#,,126.90447(3) 53-I-144,143.94961(54)#,,126.90447(3) 54-Xe-110,109.94448(43)#,,131.293(6) 54-Xe-111,110.94163(33)#,,131.293(6) 54-Xe-112,111.93567(16),,131.293(6) 54-Xe-113,112.93338(10),,131.293(6) 54-Xe-114,113.92815(22)#,,131.293(6) 54-Xe-115,114.92654(26)#,,131.293(6) 54-Xe-116,115.92174(26)#,,131.293(6) 54-Xe-117,116.92056(19),,131.293(6) 54-Xe-118,117.91657(107),,131.293(6) 54-Xe-119,118.91555(13),,131.293(6) 54-Xe-120,119.912150(50),,131.293(6) 54-Xe-121,120.911386(26),,131.293(6) 54-Xe-122,121.908550(90),,131.293(6) 54-Xe-123,122.908471(17),,131.293(6) 54-Xe-124,123.9058958(21),0.09(1),131.293(6) 54-Xe-125,124.9063982(21),,131.293(6) 54-Xe-126,125.904269(7),0.09(1),131.293(6) 54-Xe-127,126.905180(4),,131.293(6) 54-Xe-128,127.9035304(15),1.92(3),131.293(6) 54-Xe-129,128.9047795(9),26.44(24),131.293(6) 54-Xe-130,129.9035079(10),4.08(2),131.293(6) 54-Xe-131,130.9050819(10),21.18(3),131.293(6) 54-Xe-132,131.9041545(12),26.89(6),131.293(6) 54-Xe-133,132.905906(4),,131.293(6) 54-Xe-134,133.9053945(9),10.44(10),131.293(6) 54-Xe-135,134.907207(11),,131.293(6) 54-Xe-136,135.907220(8),8.87(16),131.293(6) 54-Xe-137,136.911563(8),,131.293(6) 54-Xe-138,137.913990(40),,131.293(6) 54-Xe-139,138.918787(23),,131.293(6) 54-Xe-140,139.921640(70),,131.293(6) 54-Xe-141,140.92665(10),,131.293(6) 54-Xe-142,141.92970(11),,131.293(6) 54-Xe-143,142.93489(24)#,,131.293(6) 54-Xe-144,143.93823(34)#,,131.293(6) 54-Xe-145,144.94367(43)#,,131.293(6) 54-Xe-146,145.94730(43)#,,131.293(6) 54-Xe-147,146.95301(54)#,,131.293(6) 55-Cs-112,111.95033(33)#,,132.90545(2) 55-Cs-113,112.94454(16),,132.90545(2) 55-Cs-114,113.94142(33)#,,132.90545(2) 55-Cs-115,114.93594(46)#,,132.90545(2) 55-Cs-116,115.93291(38),,132.90545(2) 55-Cs-117,116.928640(60),,132.90545(2) 55-Cs-118,117.926555(14),,132.90545(2) 55-Cs-119,118.922371(15),,132.90545(2) 55-Cs-120,119.920678(11),,132.90545(2) 55-Cs-121,120.917184(15),,132.90545(2) 55-Cs-122,121.916122(18),,132.90545(2) 55-Cs-123,122.912990(13),,132.90545(2) 55-Cs-124,123.912246(13),,132.90545(2) 55-Cs-125,124.909725(8),,132.90545(2) 55-Cs-126,125.909448(13),,132.90545(2) 55-Cs-127,126.907418(9),,132.90545(2) 55-Cs-128,127.907748(6),,132.90545(2) 55-Cs-129,128.906063(5),,132.90545(2) 55-Cs-130,129.906706(9),,132.90545(2) 55-Cs-131,130.905460(6),,132.90545(2) 55-Cs-132,131.906430(4),,132.90545(2) 55-Cs-133,132.905447(3),100,132.90545(2) 55-Cs-134,133.906713(3),,132.90545(2) 55-Cs-135,134.905972(3),,132.90545(2) 55-Cs-136,135.907306(4),,132.90545(2) 55-Cs-137,136.907084(3),,132.90545(2) 55-Cs-138,137.911011(10),,132.90545(2) 55-Cs-139,138.913358(5),,132.90545(2) 55-Cs-140,139.917277(9),,132.90545(2) 55-Cs-141,140.920044(11),,132.90545(2) 55-Cs-142,141.924292(11),,132.90545(2) 55-Cs-143,142.927330(24),,132.90545(2) 55-Cs-144,143.932030(30),,132.90545(2) 55-Cs-145,144.935390(50),,132.90545(2) 55-Cs-146,145.940160(90),,132.90545(2) 55-Cs-147,146.94386(16),,132.90545(2) 55-Cs-148,147.94890(63),,132.90545(2) 55-Cs-149,148.95272(32)#,,132.90545(2) 55-Cs-150,149.95797(54)#,,132.90545(2) 55-Cs-151,150.96200(75)#,,132.90545(2) 56-Ba-114,113.95094(48)#,,137.327(7) 56-Ba-115,114.94771(64)#,,137.327(7) 56-Ba-116,115.94168(54)#,,137.327(7) 56-Ba-117,116.93886(70)#,,137.327(7) 56-Ba-118,117.93344(54)#,,137.327(7) 56-Ba-119,118.93105(109),,137.327(7) 56-Ba-120,119.92605(32),,137.327(7) 56-Ba-121,120.92449(33),,137.327(7) 56-Ba-122,121.92026(32)#,,137.327(7) 56-Ba-123,122.91885(32)#,,137.327(7) 56-Ba-124,123.915088(15),,137.327(7) 56-Ba-125,124.91462(27),,137.327(7) 56-Ba-126,125.911244(15),,137.327(7) 56-Ba-127,126.91112(11),,137.327(7) 56-Ba-128,127.908309(12),,137.327(7) 56-Ba-129,128.908674(12),,137.327(7) 56-Ba-130,129.906310(7),0.106(1),137.327(7) 56-Ba-131,130.906931(7),,137.327(7) 56-Ba-132,131.905056(3),0.101(1),137.327(7) 56-Ba-133,132.906002(3),,137.327(7) 56-Ba-134,133.904503(3),2.417(18),137.327(7) 56-Ba-135,134.905683(3),6.592(12),137.327(7) 56-Ba-136,135.904570(3),7.854(24),137.327(7) 56-Ba-137,136.905821(3),11.232(24),137.327(7) 56-Ba-138,137.905241(3),71.698(42),137.327(7) 56-Ba-139,138.908835(3),,137.327(7) 56-Ba-140,139.910599(9),,137.327(7) 56-Ba-141,140.914406(9),,137.327(7) 56-Ba-142,141.916448(7),,137.327(7) 56-Ba-143,142.920617(14),,137.327(7) 56-Ba-144,143.922940(15),,137.327(7) 56-Ba-145,144.926920(60),,137.327(7) 56-Ba-146,145.930110(80),,137.327(7) 56-Ba-147,146.93399(10),,137.327(7) 56-Ba-148,147.93768(15),,137.327(7) 56-Ba-149,148.94246(43)#,,137.327(7) 56-Ba-150,149.94562(54)#,,137.327(7) 56-Ba-151,150.95070(64)#,,137.327(7) 56-Ba-152,151.95416(75)#,,137.327(7) 56-Ba-153,152.95961(97)#,,137.327(7) 57-La-117,116.95001(96)#,,138.9055(2) 57-La-118,117.94657(86)#,,138.9055(2) 57-La-119,118.94099(75)#,,138.9055(2) 57-La-120,119.93807(64)#,,138.9055(2) 57-La-121,120.93301(54)#,,138.9055(2) 57-La-122,121.93071(54)#,,138.9055(2) 57-La-123,122.92624(43)#,,138.9055(2) 57-La-124,123.92453(32)#,,138.9055(2) 57-La-125,124.92067(32)#,,138.9055(2) 57-La-126,125.91937(32)#,,138.9055(2) 57-La-127,126.91616(24)#,,138.9055(2) 57-La-128,127.91545(43),,138.9055(2) 57-La-129,128.912670(60),,138.9055(2) 57-La-130,129.91232(22)#,,138.9055(2) 57-La-131,130.91011(11),,138.9055(2) 57-La-132,131.910110(50),,138.9055(2) 57-La-133,132.90840(21),,138.9055(2) 57-La-134,133.908490(28),,138.9055(2) 57-La-135,134.906971(11),,138.9055(2) 57-La-136,135.907650(80),,138.9055(2) 57-La-137,136.906470(50),,138.9055(2) 57-La-138,137.907107(4),0.090(1),138.9055(2) 57-La-139,138.906348(3),99.910(1),138.9055(2) 57-La-140,139.909473(3),,138.9055(2) 57-La-141,140.910957(5),,138.9055(2) 57-La-142,141.914074(6),,138.9055(2) 57-La-143,142.916059(16),,138.9055(2) 57-La-144,143.919590(60),,138.9055(2) 57-La-145,144.921640(70),,138.9055(2) 57-La-146,145.925700(80),,138.9055(2) 57-La-147,146.927820(80),,138.9055(2) 57-La-148,147.93219(14),,138.9055(2) 57-La-149,148.93437(32)#,,138.9055(2) 57-La-150,149.93857(43)#,,138.9055(2) 57-La-151,150.94156(54)#,,138.9055(2) 57-La-152,151.94611(64)#,,138.9055(2) 57-La-153,152.94945(75)#,,138.9055(2) 57-La-154,153.95440(86)#,,138.9055(2) 57-La-155,154.95813(97)#,,138.9055(2) 58-Ce-119,118.95276(97)#,,140.116(1) 58-Ce-120,119.94664(86)#,,140.116(1) 58-Ce-121,120.94367(75)#,,140.116(1) 58-Ce-122,121.93801(64)#,,140.116(1) 58-Ce-123,122.93551(54)#,,140.116(1) 58-Ce-124,123.93052(54)#,,140.116(1) 58-Ce-125,124.92854(43)#,,140.116(1) 58-Ce-126,125.92410(43)#,,140.116(1) 58-Ce-127,126.92275(32)#,,140.116(1) 58-Ce-128,127.91887(32)#,,140.116(1) 58-Ce-129,128.91809(22)#,,140.116(1) 58-Ce-130,129.91469(66)#,,140.116(1) 58-Ce-131,130.91442(44),,140.116(1) 58-Ce-132,131.91149(21)#,,140.116(1) 58-Ce-133,132.91155(21)#,,140.116(1) 58-Ce-134,133.90903(22),,140.116(1) 58-Ce-135,134.909146(12),,140.116(1) 58-Ce-136,135.907140(50),0.185(2),140.116(1) 58-Ce-137,136.907780(50),,140.116(1) 58-Ce-138,137.905986(11),0.251(2),140.116(1) 58-Ce-139,138.906647(8),,140.116(1) 58-Ce-140,139.905434(3),88.450(51),140.116(1) 58-Ce-141,140.908271(3),,140.116(1) 58-Ce-142,141.909240(4),11.114(51),140.116(1) 58-Ce-143,142.912381(4),,140.116(1) 58-Ce-144,143.913643(4),,140.116(1) 58-Ce-145,144.917230(40),,140.116(1) 58-Ce-146,145.918690(70),,140.116(1) 58-Ce-147,146.922510(60),,140.116(1) 58-Ce-148,147.92439(13),,140.116(1) 58-Ce-149,148.928290(80),,140.116(1) 58-Ce-150,149.93023(13),,140.116(1) 58-Ce-151,150.93404(32)#,,140.116(1) 58-Ce-152,151.93638(43)#,,140.116(1) 58-Ce-153,152.94058(54)#,,140.116(1) 58-Ce-154,153.94332(64)#,,140.116(1) 58-Ce-155,154.94804(75)#,,140.116(1) 58-Ce-156,155.95126(86)#,,140.116(1) 58-Ce-157,156.95634(97)#,,140.116(1) 59-Pr-121,120.95536(86)#,,140.90765(2) 59-Pr-122,121.95165(86)#,,140.90765(2) 59-Pr-123,122.94596(75)#,,140.90765(2) 59-Pr-124,123.94296(64)#,,140.90765(2) 59-Pr-125,124.93783(54)#,,140.90765(2) 59-Pr-126,125.93531(54)#,,140.90765(2) 59-Pr-127,126.93083(43)#,,140.90765(2) 59-Pr-128,127.92880(43)#,,140.90765(2) 59-Pr-129,128.92486(32)#,,140.90765(2) 59-Pr-130,129.92338(32)#,,140.90765(2) 59-Pr-131,130.92006(47),,140.90765(2) 59-Pr-132,131.91912(21)#,,140.90765(2) 59-Pr-133,132.91620(21)#,,140.90765(2) 59-Pr-134,133.91567(32)#,,140.90765(2) 59-Pr-135,134.91314(16),,140.90765(2) 59-Pr-136,135.912650(50),,140.90765(2) 59-Pr-137,136.910680(50),,140.90765(2) 59-Pr-138,137.910749(16),,140.90765(2) 59-Pr-139,138.908932(9),,140.90765(2) 59-Pr-140,139.909071(7),,140.90765(2) 59-Pr-141,140.907648(3),100,140.90765(2) 59-Pr-142,141.910040(3),,140.90765(2) 59-Pr-143,142.910812(3),,140.90765(2) 59-Pr-144,143.913301(4),,140.90765(2) 59-Pr-145,144.914507(8),,140.90765(2) 59-Pr-146,145.917590(60),,140.90765(2) 59-Pr-147,146.918980(40),,140.90765(2) 59-Pr-148,147.92218(10),,140.90765(2) 59-Pr-149,148.923791(11),,140.90765(2) 59-Pr-150,149.927000(90),,140.90765(2) 59-Pr-151,150.928230(40),,140.90765(2) 59-Pr-152,151.93160(32)#,,140.90765(2) 59-Pr-153,152.93365(32)#,,140.90765(2) 59-Pr-154,153.93739(43)#,,140.90765(2) 59-Pr-155,154.93999(54)#,,140.90765(2) 59-Pr-156,155.94412(64)#,,140.90765(2) 59-Pr-157,156.94717(75)#,,140.90765(2) 59-Pr-158,157.95178(86)#,,140.90765(2) 59-Pr-159,158.95523(97)#,,140.90765(2) 60-Nd-126,125.94307(75)#,,144.24(3) 60-Nd-127,126.94050(64)#,,144.24(3) 60-Nd-128,127.93539(64)#,,144.24(3) 60-Nd-129,128.93325(39)#,,144.24(3) 60-Nd-130,129.92878(54)#,,144.24(3) 60-Nd-131,130.92710(50),,144.24(3) 60-Nd-132,131.92312(32)#,,144.24(3) 60-Nd-133,132.92221(32)#,,144.24(3) 60-Nd-134,133.91865(36)#,,144.24(3) 60-Nd-135,134.91824(22)#,,144.24(3) 60-Nd-136,135.915020(60),,144.24(3) 60-Nd-137,136.914640(80),,144.24(3) 60-Nd-138,137.91193(22)#,,144.24(3) 60-Nd-139,138.911920(50),,144.24(3) 60-Nd-140,139.909310(21),,144.24(3) 60-Nd-141,140.909605(4),,144.24(3) 60-Nd-142,141.907719(3),27.2(5),144.24(3) 60-Nd-143,142.909810(3),12.2(2),144.24(3) 60-Nd-144,143.910083(3),23.8(3),144.24(3) 60-Nd-145,144.912569(3),8.3(1),144.24(3) 60-Nd-146,145.913112(3),17.2(3),144.24(3) 60-Nd-147,146.916096(3),,144.24(3) 60-Nd-148,147.916889(3),5.7(1),144.24(3) 60-Nd-149,148.920144(3),,144.24(3) 60-Nd-150,149.920887(4),5.6(2),144.24(3) 60-Nd-151,150.923825(4),,144.24(3) 60-Nd-152,151.924680(30),,144.24(3) 60-Nd-153,152.927695(29),,144.24(3) 60-Nd-154,153.92948(12),,144.24(3) 60-Nd-155,154.93263(16),,144.24(3) 60-Nd-156,155.93520(43)#,,144.24(3) 60-Nd-157,156.93927(54)#,,144.24(3) 60-Nd-158,157.94187(64)#,,144.24(3) 60-Nd-159,158.94639(75)#,,144.24(3) 60-Nd-160,159.94939(86)#,,144.24(3) 60-Nd-161,160.95433(97)#,,144.24(3) 61-Pm-128,127.94826(97)#,,[145] 61-Pm-129,128.94316(86)#,,[145] 61-Pm-130,129.94045(75)#,,[145] 61-Pm-131,130.93580(64)#,,[145] 61-Pm-132,131.93375(54)#,,[145] 61-Pm-133,132.92972(54)#,,[145] 61-Pm-134,133.92849(42)#,,[145] 61-Pm-135,134.92462(35)#,,[145] 61-Pm-136,135.92345(22),,[145] 61-Pm-137,136.92071(15)#,,[145] 61-Pm-138,137.91945(34)#,,[145] 61-Pm-139,138.916760(60),,[145] 61-Pm-140,139.915800(30),,[145] 61-Pm-141,140.913607(29),,[145] 61-Pm-142,141.912950(50),,[145] 61-Pm-143,142.910928(4),,[145] 61-Pm-144,143.912586(4),,[145] 61-Pm-145,144.912744(4),,[145] 61-Pm-146,145.914692(5),,[145] 61-Pm-147,146.915134(3),,[145] 61-Pm-148,147.917468(7),,[145] 61-Pm-149,148.918329(5),,[145] 61-Pm-150,149.920979(22),,[145] 61-Pm-151,150.921203(6),,[145] 61-Pm-152,151.923490(80),,[145] 61-Pm-153,152.924113(12),,[145] 61-Pm-154,153.926550(80),,[145] 61-Pm-155,154.928100(30),,[145] 61-Pm-156,155.931060(40),,[145] 61-Pm-157,156.93320(32)#,,[145] 61-Pm-158,157.93669(43)#,,[145] 61-Pm-159,158.93913(54)#,,[145] 61-Pm-160,159.94299(64)#,,[145] 61-Pm-161,160.94586(75)#,,[145] 61-Pm-162,161.95029(86)#,,[145] 61-Pm-163,162.95352(97)#,,[145] 62-Sm-130,129.94863(97)#,,150.36(3) 62-Sm-131,130.94589(97)#,,150.36(3) 62-Sm-132,131.94082(75)#,,150.36(3) 62-Sm-133,132.93873(64)#,,150.36(3) 62-Sm-134,133.93402(54)#,,150.36(3) 62-Sm-135,134.93235(54)#,,150.36(3) 62-Sm-136,135.92830(43)#,,150.36(3) 62-Sm-137,136.92705(12),,150.36(3) 62-Sm-138,137.92354(32)#,,150.36(3) 62-Sm-139,138.922302(16),,150.36(3) 62-Sm-140,139.918991(16),,150.36(3) 62-Sm-141,140.918469(13),,150.36(3) 62-Sm-142,141.915193(11),,150.36(3) 62-Sm-143,142.914624(4),,150.36(3) 62-Sm-144,143.911995(4),3.07(7),150.36(3) 62-Sm-145,144.913406(4),,150.36(3) 62-Sm-146,145.913037(4),,150.36(3) 62-Sm-147,146.914893(3),14.99(18),150.36(3) 62-Sm-148,147.914818(3),11.24(10),150.36(3) 62-Sm-149,148.917180(3),13.82(7),150.36(3) 62-Sm-150,149.917271(3),7.38(1),150.36(3) 62-Sm-151,150.919928(3),,150.36(3) 62-Sm-152,151.919728(3),26.75(16),150.36(3) 62-Sm-153,152.922094(3),,150.36(3) 62-Sm-154,153.922205(3),22.75(29),150.36(3) 62-Sm-155,154.924636(3),,150.36(3) 62-Sm-156,155.925526(10),,150.36(3) 62-Sm-157,156.928350(50),,150.36(3) 62-Sm-158,157.929990(80),,150.36(3) 62-Sm-159,158.93320(32)#,,150.36(3) 62-Sm-160,159.93514(43)#,,150.36(3) 62-Sm-161,160.93883(54)#,,150.36(3) 62-Sm-162,161.94122(64)#,,150.36(3) 62-Sm-163,162.94536(75)#,,150.36(3) 62-Sm-164,163.94828(86)#,,150.36(3) 62-Sm-165,164.95298(97)#,,150.36(3) 63-Eu-132,131.95416(97)#,,151.964(1) 63-Eu-133,132.94890(97)#,,151.964(1) 63-Eu-134,133.94632(75)#,,151.964(1) 63-Eu-135,134.94172(64)#,,151.964(1) 63-Eu-136,135.93950(54)#,,151.964(1) 63-Eu-137,136.93521(54)#,,151.964(1) 63-Eu-138,137.93345(43)#,,151.964(1) 63-Eu-139,138.92984(16)#,,151.964(1) 63-Eu-140,139.928080(60),,151.964(1) 63-Eu-141,140.924890(30),,151.964(1) 63-Eu-142,141.923400(30),,151.964(1) 63-Eu-143,142.920287(14),,151.964(1) 63-Eu-144,143.918774(19),,151.964(1) 63-Eu-145,144.916261(5),,151.964(1) 63-Eu-146,145.917200(8),,151.964(1) 63-Eu-147,146.916741(4),,151.964(1) 63-Eu-148,147.918154(19),,151.964(1) 63-Eu-149,148.917926(5),,151.964(1) 63-Eu-150,149.919698(8),,151.964(1) 63-Eu-151,150.919846(3),47.81(3),151.964(1) 63-Eu-152,151.921740(3),,151.964(1) 63-Eu-153,152.921226(3),52.19(3),151.964(1) 63-Eu-154,153.922975(3),,151.964(1) 63-Eu-155,154.922889(3),,151.964(1) 63-Eu-156,155.924751(6),,151.964(1) 63-Eu-157,156.925419(7),,151.964(1) 63-Eu-158,157.927840(80),,151.964(1) 63-Eu-159,158.929084(9),,151.964(1) 63-Eu-160,159.93197(22)#,,151.964(1) 63-Eu-161,160.93368(32)#,,151.964(1) 63-Eu-162,161.93704(43)#,,151.964(1) 63-Eu-163,162.93921(54)#,,151.964(1) 63-Eu-164,163.94299(64)#,,151.964(1) 63-Eu-165,164.94572(75)#,,151.964(1) 63-Eu-166,165.94997(86)#,,151.964(1) 63-Eu-167,166.95305(97)#,,151.964(1) 64-Gd-136,135.94707(75)#,,157.25(3) 64-Gd-137,136.94465(64)#,,157.25(3) 64-Gd-138,137.93997(54)#,,157.25(3) 64-Gd-139,138.93808(54)#,,157.25(3) 64-Gd-140,139.93395(43)#,,157.25(3) 64-Gd-141,140.93221(32)#,,157.25(3) 64-Gd-142,141.92823(32)#,,157.25(3) 64-Gd-143,142.92674(22),,157.25(3) 64-Gd-144,143.92279(22)#,,157.25(3) 64-Gd-145,144.921690(40),,157.25(3) 64-Gd-146,145.918305(6),,157.25(3) 64-Gd-147,146.919089(4),,157.25(3) 64-Gd-148,147.918110(4),,157.25(3) 64-Gd-149,148.919336(5),,157.25(3) 64-Gd-150,149.918655(7),,157.25(3) 64-Gd-151,150.920344(4),,157.25(3) 64-Gd-152,151.919788(3),0.20(1),157.25(3) 64-Gd-153,152.921746(3),,157.25(3) 64-Gd-154,153.920862(3),2.18(3),157.25(3) 64-Gd-155,154.922619(3),14.80(12),157.25(3) 64-Gd-156,155.922120(3),20.47(9),157.25(3) 64-Gd-157,156.923957(3),15.65(2),157.25(3) 64-Gd-158,157.924101(3),24.84(7),157.25(3) 64-Gd-159,158.926385(3),,157.25(3) 64-Gd-160,159.927051(3),21.86(19),157.25(3) 64-Gd-161,160.929666(3),,157.25(3) 64-Gd-162,161.930981(5),,157.25(3) 64-Gd-163,162.93399(32)#,,157.25(3) 64-Gd-164,163.93586(43)#,,157.25(3) 64-Gd-165,164.93938(54)#,,157.25(3) 64-Gd-166,165.94160(64)#,,157.25(3) 64-Gd-167,166.94557(64)#,,157.25(3) 64-Gd-168,167.94836(75)#,,157.25(3) 64-Gd-169,168.95287(86)#,,157.25(3) 65-Tb-138,137.95287(86)#,,158.92534(2) 65-Tb-139,138.94803(75)#,,158.92534(2) 65-Tb-140,139.94554(96)#,,158.92534(2) 65-Tb-141,140.94116(64)#,,158.92534(2) 65-Tb-142,141.93886(82)#,,158.92534(2) 65-Tb-143,142.93475(43)#,,158.92534(2) 65-Tb-144,143.93253(32)#,,158.92534(2) 65-Tb-145,144.92888(24)#,,158.92534(2) 65-Tb-146,145.927180(50),,158.92534(2) 65-Tb-147,146.924037(13),,158.92534(2) 65-Tb-148,147.924300(30),,158.92534(2) 65-Tb-149,148.923242(5),,158.92534(2) 65-Tb-150,149.923654(9),,158.92534(2) 65-Tb-151,150.923098(5),,158.92534(2) 65-Tb-152,151.924070(40),,158.92534(2) 65-Tb-153,152.923431(5),,158.92534(2) 65-Tb-154,153.924690(50),,158.92534(2) 65-Tb-155,154.923500(13),,158.92534(2) 65-Tb-156,155.924744(5),,158.92534(2) 65-Tb-157,156.924021(3),,158.92534(2) 65-Tb-158,157.925410(3),,158.92534(2) 65-Tb-159,158.925343(3),100,158.92534(2) 65-Tb-160,159.927164(3),,158.92534(2) 65-Tb-161,160.927566(3),,158.92534(2) 65-Tb-162,161.929480(40),,158.92534(2) 65-Tb-163,162.930644(5),,158.92534(2) 65-Tb-164,163.93335(11),,158.92534(2) 65-Tb-165,164.93488(21)#,,158.92534(2) 65-Tb-166,165.93805(32)#,,158.92534(2) 65-Tb-167,166.94005(43)#,,158.92534(2) 65-Tb-168,167.94364(54)#,,158.92534(2) 65-Tb-169,168.94622(64)#,,158.92534(2) 65-Tb-170,169.95025(75)#,,158.92534(2) 65-Tb-171,170.95330(86)#,,158.92534(2) 66-Dy-140,139.95379(97)#,,162.500(1) 66-Dy-141,140.95119(75)#,,162.500(1) 66-Dy-142,141.94627(85)#,,162.500(1) 66-Dy-143,142.94383(54)#,,162.500(1) 66-Dy-144,143.93907(43)#,,162.500(1) 66-Dy-145,144.93695(32)#,,162.500(1) 66-Dy-146,145.93272(12),,162.500(1) 66-Dy-147,146.930880(60),,162.500(1) 66-Dy-148,147.927180(30),,162.500(1) 66-Dy-149,148.927334(12),,162.500(1) 66-Dy-150,149.925580(6),,162.500(1) 66-Dy-151,150.926180(5),,162.500(1) 66-Dy-152,151.924714(6),,162.500(1) 66-Dy-153,152.925761(5),,162.500(1) 66-Dy-154,153.924422(9),,162.500(1) 66-Dy-155,154.925749(13),,162.500(1) 66-Dy-156,155.924278(7),0.06(1),162.500(1) 66-Dy-157,156.925461(7),,162.500(1) 66-Dy-158,157.924405(4),0.10(1),162.500(1) 66-Dy-159,158.925736(3),,162.500(1) 66-Dy-160,159.925194(3),2.34(8),162.500(1) 66-Dy-161,160.926930(3),18.91(24),162.500(1) 66-Dy-162,161.926795(3),25.51(26),162.500(1) 66-Dy-163,162.928728(3),24.90(16),162.500(1) 66-Dy-164,163.929171(3),28.18(37),162.500(1) 66-Dy-165,164.931700(3),,162.500(1) 66-Dy-166,165.932803(3),,162.500(1) 66-Dy-167,166.935650(60),,162.500(1) 66-Dy-168,167.93723(32)#,,162.500(1) 66-Dy-169,168.94030(32),,162.500(1) 66-Dy-170,169.94267(43)#,,162.500(1) 66-Dy-171,170.94648(54)#,,162.500(1) 66-Dy-172,171.94911(64)#,,162.500(1) 66-Dy-173,172.95344(75)#,,162.500(1) 67-Ho-142,141.95986(107)#,,164.93032(2) 67-Ho-143,142.95469(75)#,,164.93032(2) 67-Ho-144,143.95164(64)#,,164.93032(2) 67-Ho-145,144.94688(64)#,,164.93032(2) 67-Ho-146,145.94410(54)#,,164.93032(2) 67-Ho-147,146.93984(43)#,,164.93032(2) 67-Ho-148,147.93727(29)#,,164.93032(2) 67-Ho-149,148.933790(23),,164.93032(2) 67-Ho-150,149.93335(11)#,,164.93032(2) 67-Ho-151,150.931681(13),,164.93032(2) 67-Ho-152,151.931740(30),,164.93032(2) 67-Ho-153,152.930195(6),,164.93032(2) 67-Ho-154,153.930596(10),,164.93032(2) 67-Ho-155,154.929079(25),,164.93032(2) 67-Ho-156,155.92971(22)#,,164.93032(2) 67-Ho-157,156.928190(50),,164.93032(2) 67-Ho-158,157.928950(30),,164.93032(2) 67-Ho-159,158.927709(4),,164.93032(2) 67-Ho-160,159.928726(16),,164.93032(2) 67-Ho-161,160.927852(4),,164.93032(2) 67-Ho-162,161.929092(5),,164.93032(2) 67-Ho-163,162.928730(3),,164.93032(2) 67-Ho-164,163.930231(3),,164.93032(2) 67-Ho-165,164.930319(3),100,164.93032(2) 67-Ho-166,165.932281(3),,164.93032(2) 67-Ho-167,166.933126(6),,164.93032(2) 67-Ho-168,167.935500(30),,164.93032(2) 67-Ho-169,168.936868(22),,164.93032(2) 67-Ho-170,169.939610(50),,164.93032(2) 67-Ho-171,170.94146(64),,164.93032(2) 67-Ho-172,171.94482(43)#,,164.93032(2) 67-Ho-173,172.94729(43)#,,164.93032(2) 67-Ho-174,173.95115(54)#,,164.93032(2) 67-Ho-175,174.95405(64)#,,164.93032(2) 68-Er-144,143.96059(86)#,,167.259(3) 68-Er-145,144.95746(75)#,,167.259(3) 68-Er-146,145.95212(64)#,,167.259(3) 68-Er-147,146.94931(54)#,,167.259(3) 68-Er-148,147.94444(43)#,,167.259(3) 68-Er-149,148.94217(51)#,,167.259(3) 68-Er-150,149.93776(11)#,,167.259(3) 68-Er-151,150.93746(32)#,,167.259(3) 68-Er-152,151.935080(30),,167.259(3) 68-Er-153,152.935093(12),,167.259(3) 68-Er-154,153.932777(6),,167.259(3) 68-Er-155,154.933200(50),,167.259(3) 68-Er-156,155.931020(80),,167.259(3) 68-Er-157,156.931950(90),,167.259(3) 68-Er-158,157.92991(11)#,,167.259(3) 68-Er-159,158.930681(5),,167.259(3) 68-Er-160,159.929080(50),,167.259(3) 68-Er-161,160.930001(10),,167.259(3) 68-Er-162,161.928775(4),0.14(1),167.259(3) 68-Er-163,162.930029(6),,167.259(3) 68-Er-164,163.929197(4),1.61(3),167.259(3) 68-Er-165,164.930723(4),,167.259(3) 68-Er-166,165.930290(3),33.61(35),167.259(3) 68-Er-167,166.932045(3),22.93(17),167.259(3) 68-Er-168,167.932368(3),26.78(26),167.259(3) 68-Er-169,168.934588(3),,167.259(3) 68-Er-170,169.935460(3),14.93(27),167.259(3) 68-Er-171,170.938026(3),,167.259(3) 68-Er-172,171.939352(5),,167.259(3) 68-Er-173,172.94240(21)#,,167.259(3) 68-Er-174,173.94434(32)#,,167.259(3) 68-Er-175,174.94793(43)#,,167.259(3) 68-Er-176,175.95029(43)#,,167.259(3) 68-Er-177,176.95437(64)#,,167.259(3) 69-Tm-146,145.96650(75)#,,168.93421(2) 69-Tm-147,146.96108(64)#,,168.93421(2) 69-Tm-148,147.95755(75)#,,168.93421(2) 69-Tm-149,148.95265(64)#,,168.93421(2) 69-Tm-150,149.94967(54)#,,168.93421(2) 69-Tm-151,150.94543(15)#,,168.93421(2) 69-Tm-152,151.94430(32)#,,168.93421(2) 69-Tm-153,152.942028(23),,168.93421(2) 69-Tm-154,153.94142(12)#,,168.93421(2) 69-Tm-155,154.939192(14),,168.93421(2) 69-Tm-156,155.939010(60),,168.93421(2) 69-Tm-157,156.93676(11),,168.93421(2) 69-Tm-158,157.93700(13)#,,168.93421(2) 69-Tm-159,158.934810(70),,168.93421(2) 69-Tm-160,159.93509(33),,168.93421(2) 69-Tm-161,160.93340(10),,168.93421(2) 69-Tm-162,161.933970(30),,168.93421(2) 69-Tm-163,162.932648(7),,168.93421(2) 69-Tm-164,163.933451(20),,168.93421(2) 69-Tm-165,164.932432(4),,168.93421(2) 69-Tm-166,165.933553(12),,168.93421(2) 69-Tm-167,166.932849(3),,168.93421(2) 69-Tm-168,167.934170(4),,168.93421(2) 69-Tm-169,168.934211(3),100,168.93421(2) 69-Tm-170,169.935798(3),,168.93421(2) 69-Tm-171,170.936426(3),,168.93421(2) 69-Tm-172,171.938396(7),,168.93421(2) 69-Tm-173,172.939600(6),,168.93421(2) 69-Tm-174,173.942160(50),,168.93421(2) 69-Tm-175,174.943830(50),,168.93421(2) 69-Tm-176,175.94699(11),,168.93421(2) 69-Tm-177,176.94904(32)#,,168.93421(2) 69-Tm-178,177.95264(43)#,,168.93421(2) 69-Tm-179,178.95534(54)#,,168.93421(2) 70-Yb-148,147.96676(86)#,,173.04(3) 70-Yb-149,148.96348(75)#,,173.04(3) 70-Yb-150,149.95799(64)#,,173.04(3) 70-Yb-151,150.95525(34)#,,173.04(3) 70-Yb-152,151.95017(38)#,,173.04(3) 70-Yb-153,152.94921(32)#,,173.04(3) 70-Yb-154,153.94624(11)#,,173.04(3) 70-Yb-155,154.94579(32)#,,173.04(3) 70-Yb-156,155.942850(40),,173.04(3) 70-Yb-157,156.942660(60),,173.04(3) 70-Yb-158,157.939858(11),,173.04(3) 70-Yb-159,158.94015(10),,173.04(3) 70-Yb-160,159.93756(22)#,,173.04(3) 70-Yb-161,160.93785(24)#,,173.04(3) 70-Yb-162,161.93575(22)#,,173.04(3) 70-Yb-163,162.93627(11),,173.04(3) 70-Yb-164,163.93452(11)#,,173.04(3) 70-Yb-165,164.935398(22),,173.04(3) 70-Yb-166,165.933880(9),,173.04(3) 70-Yb-167,166.934947(5),,173.04(3) 70-Yb-168,167.933894(5),0.13(1),173.04(3) 70-Yb-169,168.935187(5),,173.04(3) 70-Yb-170,169.934759(3),3.04(15),173.04(3) 70-Yb-171,170.936322(3),14.28(57),173.04(3) 70-Yb-172,171.9363777(30),21.83(67),173.04(3) 70-Yb-173,172.9382068(30),16.13(27),173.04(3) 70-Yb-174,173.9388581(30),31.83(92),173.04(3) 70-Yb-175,174.9412725(30),,173.04(3) 70-Yb-176,175.942568(3),12.76(41),173.04(3) 70-Yb-177,176.945257(3),,173.04(3) 70-Yb-178,177.946643(11),,173.04(3) 70-Yb-179,178.95017(32)#,,173.04(3) 70-Yb-180,179.95233(43)#,,173.04(3) 70-Yb-181,180.95615(43)#,,173.04(3) 71-Lu-150,149.97267(75)#,,174.967(1) 71-Lu-151,150.96715(65)#,,174.967(1) 71-Lu-152,151.96361(75)#,,174.967(1) 71-Lu-153,152.95869(64)#,,174.967(1) 71-Lu-154,153.95710(54)#,,174.967(1) 71-Lu-155,154.95423(14)#,,174.967(1) 71-Lu-156,155.95291(32)#,,174.967(1) 71-Lu-157,156.950102(23),,174.967(1) 71-Lu-158,157.94917(13)#,,174.967(1) 71-Lu-159,158.946620(50),,174.967(1) 71-Lu-160,159.94602(25)#,,174.967(1) 71-Lu-161,160.94354(26)#,,174.967(1) 71-Lu-162,161.94322(24)#,,174.967(1) 71-Lu-163,162.94120(24),,174.967(1) 71-Lu-164,163.94122(13)#,,174.967(1) 71-Lu-165,164.939610(90),,174.967(1) 71-Lu-166,165.93976(17),,174.967(1) 71-Lu-167,166.93831(11),,174.967(1) 71-Lu-168,167.938700(90),,174.967(1) 71-Lu-169,168.937649(6),,174.967(1) 71-Lu-170,169.938472(20),,174.967(1) 71-Lu-171,170.937910(3),,174.967(1) 71-Lu-172,171.939082(4),,174.967(1) 71-Lu-173,172.938927(3),,174.967(1) 71-Lu-174,173.9403335(30),,174.967(1) 71-Lu-175,174.9407679(28),97.41(2),174.967(1) 71-Lu-176,175.9426824(28),2.59(2),174.967(1) 71-Lu-177,176.9437550(28),,174.967(1) 71-Lu-178,177.945951(3),,174.967(1) 71-Lu-179,178.947324(6),,174.967(1) 71-Lu-180,179.949880(80),,174.967(1) 71-Lu-181,180.95197(32)#,,174.967(1) 71-Lu-182,181.95521(32)#,,174.967(1) 71-Lu-183,182.95757(32)#,,174.967(1) 71-Lu-184,183.96117(43)#,,174.967(1) 72-Hf-154,153.96425(75)#,,178.49(2) 72-Hf-155,154.96276(64)#,,178.49(2) 72-Hf-156,155.95925(38)#,,178.49(2) 72-Hf-157,156.95813(32)#,,178.49(2) 72-Hf-158,157.95465(11)#,,178.49(2) 72-Hf-159,158.95400(32)#,,178.49(2) 72-Hf-160,159.950710(40),,178.49(2) 72-Hf-161,160.950330(80),,178.49(2) 72-Hf-162,161.947203(12),,178.49(2) 72-Hf-163,162.94706(34)#,,178.49(2) 72-Hf-164,163.94442(21)#,,178.49(2) 72-Hf-165,164.94454(40)#,,178.49(2) 72-Hf-166,165.94225(32)#,,178.49(2) 72-Hf-167,166.94260(22)#,,178.49(2) 72-Hf-168,167.94063(11)#,,178.49(2) 72-Hf-169,168.941160(90),,178.49(2) 72-Hf-170,169.93965(21)#,,178.49(2) 72-Hf-171,170.94049(21)#,,178.49(2) 72-Hf-172,171.939460(50),,178.49(2) 72-Hf-173,172.94065(11)#,,178.49(2) 72-Hf-174,173.940040(3),0.16(1),178.49(2) 72-Hf-175,174.941503(3),,178.49(2) 72-Hf-176,175.9414018(29),5.26(7),178.49(2) 72-Hf-177,176.9432200(27),18.60(9),178.49(2) 72-Hf-178,177.9436977(27),27.28(7),178.49(2) 72-Hf-179,178.9458151(27),13.62(2),178.49(2) 72-Hf-180,179.9465488(27),35.08(16),178.49(2) 72-Hf-181,180.9490991(28),,178.49(2) 72-Hf-182,181.950553(7),,178.49(2) 72-Hf-183,182.953530(30),,178.49(2) 72-Hf-184,183.955450(40),,178.49(2) 72-Hf-185,184.95878(32)#,,178.49(2) 72-Hf-186,185.96092(32)#,,178.49(2) 73-Ta-156,155.97169(64)#,,180.9479(1) 73-Ta-157,156.96815(64)#,,180.9479(1) 73-Ta-158,157.96637(54)#,,180.9479(1) 73-Ta-159,158.96291(13)#,,180.9479(1) 73-Ta-160,159.96136(33)#,,180.9479(1) 73-Ta-161,160.958370(60),,180.9479(1) 73-Ta-162,161.95715(14)#,,180.9479(1) 73-Ta-163,162.954320(80),,180.9479(1) 73-Ta-164,163.95357(43)#,,180.9479(1) 73-Ta-165,164.95082(24)#,,180.9479(1) 73-Ta-166,165.95047(32)#,,180.9479(1) 73-Ta-167,166.94797(46)#,,180.9479(1) 73-Ta-168,167.94779(39)#,,180.9479(1) 73-Ta-169,168.94592(22)#,,180.9479(1) 73-Ta-170,169.94609(21)#,,180.9479(1) 73-Ta-171,170.94446(22)#,,180.9479(1) 73-Ta-172,171.94474(20),,180.9479(1) 73-Ta-173,172.94354(24)#,,180.9479(1) 73-Ta-174,173.944170(90),,180.9479(1) 73-Ta-175,174.94365(11)#,,180.9479(1) 73-Ta-176,175.94474(11),,180.9479(1) 73-Ta-177,176.944472(4),,180.9479(1) 73-Ta-178,177.94575(11),,180.9479(1) 73-Ta-179,178.945934(6),,180.9479(1) 73-Ta-180,179.947466(3),0.012(2),180.9479(1) 73-Ta-181,180.947996(3),99.988(2),180.9479(1) 73-Ta-182,181.950152(3),,180.9479(1) 73-Ta-183,182.951373(3),,180.9479(1) 73-Ta-184,183.954009(28),,180.9479(1) 73-Ta-185,184.955559(15),,180.9479(1) 73-Ta-186,185.958550(60),,180.9479(1) 73-Ta-187,186.96041(32)#,,180.9479(1) 73-Ta-188,187.96371(32)#,,180.9479(1) 74-W-158,157.97394(75)#,,183.84(1) 74-W-159,158.97228(64)#,,183.84(1) 74-W-160,159.96837(38)#,,183.84(1) 74-W-161,160.96709(33)#,,183.84(1) 74-W-162,161.96334(11)#,,183.84(1) 74-W-163,162.96253(33)#,,183.84(1) 74-W-164,163.958980(40),,183.84(1) 74-W-165,164.958340(90),,183.84(1) 74-W-166,165.955020(13),,183.84(1) 74-W-167,166.95467(33)#,,183.84(1) 74-W-168,167.95186(21)#,,183.84(1) 74-W-169,168.95176(34)#,,183.84(1) 74-W-170,169.94929(51)#,,183.84(1) 74-W-171,170.94946(30)#,,183.84(1) 74-W-172,171.94742(29)#,,183.84(1) 74-W-173,172.94783(40)#,,183.84(1) 74-W-174,173.94616(32)#,,183.84(1) 74-W-175,174.94677(21)#,,183.84(1) 74-W-176,175.94559(21)#,,183.84(1) 74-W-177,176.94662(32)#,,183.84(1) 74-W-178,177.94585(11),,183.84(1) 74-W-179,178.947072(17),,183.84(1) 74-W-180,179.946706(5),0.12(1),183.84(1) 74-W-181,180.948198(6),,183.84(1) 74-W-182,181.948206(3),26.50(16),183.84(1) 74-W-183,182.9502245(29),14.31(4),183.84(1) 74-W-184,183.9509326(29),30.64(2),183.84(1) 74-W-185,184.9534206(30),,183.84(1) 74-W-186,185.954362(3),28.43(19),183.84(1) 74-W-187,186.957158(3),,183.84(1) 74-W-188,187.958487(4),,183.84(1) 74-W-189,188.96191(21),,183.84(1) 74-W-190,189.96318(24),,183.84(1) 75-Re-160,159.98149(64)#,,186.207(1) 75-Re-161,160.97766(64)#,,186.207(1) 75-Re-162,161.97571(55)#,,186.207(1) 75-Re-163,162.97197(12)#,,186.207(1) 75-Re-164,163.97032(33)#,,186.207(1) 75-Re-165,164.967050(80),,186.207(1) 75-Re-166,165.96580(15)#,,186.207(1) 75-Re-167,166.96256(14)#,,186.207(1) 75-Re-168,167.96161(43)#,,186.207(1) 75-Re-169,168.95883(22)#,,186.207(1) 75-Re-170,169.95816(43)#,,186.207(1) 75-Re-171,170.95555(37)#,,186.207(1) 75-Re-172,171.95529(33)#,,186.207(1) 75-Re-173,172.95306(48)#,,186.207(1) 75-Re-174,173.95311(44)#,,186.207(1) 75-Re-175,174.95139(48)#,,186.207(1) 75-Re-176,175.95157(21)#,,186.207(1) 75-Re-177,176.95027(21)#,,186.207(1) 75-Re-178,177.95085(22),,186.207(1) 75-Re-179,178.949980(60),,186.207(1) 75-Re-180,179.950790(40),,186.207(1) 75-Re-181,180.950065(15),,186.207(1) 75-Re-182,181.95121(11),,186.207(1) 75-Re-183,182.950821(9),,186.207(1) 75-Re-184,183.952524(6),,186.207(1) 75-Re-185,184.9529557(30),37.40(2),186.207(1) 75-Re-186,185.954987(3),,186.207(1) 75-Re-187,186.9557508(30),62.60(2),186.207(1) 75-Re-188,187.9581123(30),,186.207(1) 75-Re-189,188.959228(9),,186.207(1) 75-Re-190,189.96182(23),,186.207(1) 75-Re-191,190.963124(11),,186.207(1) 75-Re-192,191.96596(21)#,,186.207(1) 76-Os-162,161.98382(75)#,,190.23(3) 76-Os-163,162.98205(64)#,,190.23(3) 76-Os-164,163.97793(38)#,,190.23(3) 76-Os-165,164.97648(33)#,,190.23(3) 76-Os-166,165.97253(11)#,,190.23(3) 76-Os-167,166.97155(33)#,,190.23(3) 76-Os-168,167.967830(40),,190.23(3) 76-Os-169,168.967080(90),,190.23(3) 76-Os-170,169.963570(14),,190.23(3) 76-Os-171,170.96304(33)#,,190.23(3) 76-Os-172,171.96008(21)#,,190.23(3) 76-Os-173,172.95979(33)#,,190.23(3) 76-Os-174,173.95712(50)#,,190.23(3) 76-Os-175,174.95708(32)#,,190.23(3) 76-Os-176,175.95495(22)#,,190.23(3) 76-Os-177,176.95505(30)#,,190.23(3) 76-Os-178,177.95335(22),,190.23(3) 76-Os-179,178.95395(25)#,,190.23(3) 76-Os-180,179.95235(20)#,,190.23(3) 76-Os-181,180.95327(22),,190.23(3) 76-Os-182,181.952186(27),,190.23(3) 76-Os-183,182.95311(11)#,,190.23(3) 76-Os-184,183.952491(3),0.02(1),190.23(3) 76-Os-185,184.954043(3),,190.23(3) 76-Os-186,185.953838(3),1.59(3),190.23(3) 76-Os-187,186.9557479(30),1.96(2),190.23(3) 76-Os-188,187.9558360(30),13.24(8),190.23(3) 76-Os-189,188.9581449(30),16.15(5),190.23(3) 76-Os-190,189.958445(3),26.26(2),190.23(3) 76-Os-191,190.960928(3),,190.23(3) 76-Os-192,191.961479(4),40.78(19),190.23(3) 76-Os-193,192.964148(4),,190.23(3) 76-Os-194,193.965179(4),,190.23(3) 76-Os-195,194.96812(54),,190.23(3) 76-Os-196,195.969620(40),,190.23(3) 77-Ir-165,164.98758(43)#,,192.217(3) 77-Ir-166,165.98551(55)#,,192.217(3) 77-Ir-167,166.98154(11)#,,192.217(3) 77-Ir-168,167.97997(35)#,,192.217(3) 77-Ir-169,168.97639(10),,192.217(3) 77-Ir-170,169.97503(16)#,,192.217(3) 77-Ir-171,170.97178(14)#,,192.217(3) 77-Ir-172,171.97064(43)#,,192.217(3) 77-Ir-173,172.96771(25)#,,192.217(3) 77-Ir-174,173.96680(43)#,,192.217(3) 77-Ir-175,174.96428(37)#,,192.217(3) 77-Ir-176,175.96351(33)#,,192.217(3) 77-Ir-177,176.96117(48)#,,192.217(3) 77-Ir-178,177.96108(39)#,,192.217(3) 77-Ir-179,178.95915(43)#,,192.217(3) 77-Ir-180,179.95925(21)#,,192.217(3) 77-Ir-181,180.95764(23),,192.217(3) 77-Ir-182,181.95813(15),,192.217(3) 77-Ir-183,182.95681(15)#,,192.217(3) 77-Ir-184,183.95739(29),,192.217(3) 77-Ir-185,184.95659(21)#,,192.217(3) 77-Ir-186,185.957951(22),,192.217(3) 77-Ir-187,186.957361(7),,192.217(3) 77-Ir-188,187.958852(8),,192.217(3) 77-Ir-189,188.958716(14),,192.217(3) 77-Ir-190,189.96059(21),,192.217(3) 77-Ir-191,190.960591(3),37.3(2),192.217(3) 77-Ir-192,191.962602(3),,192.217(3) 77-Ir-193,192.962924(3),62.7(2),192.217(3) 77-Ir-194,193.965076(3),,192.217(3) 77-Ir-195,194.965977(3),,192.217(3) 77-Ir-196,195.968380(40),,192.217(3) 77-Ir-197,196.969636(22),,192.217(3) 77-Ir-198,197.97228(21)#,,192.217(3) 77-Ir-199,198.973790(40),,192.217(3) 78-Pt-168,167.98804(38)#,,195.078(2) 78-Pt-169,168.98642(34)#,,195.078(2) 78-Pt-170,169.98233(11)#,,195.078(2) 78-Pt-171,170.98125(34)#,,195.078(2) 78-Pt-172,171.977380(40),,195.078(2) 78-Pt-173,172.97650(11),,195.078(2) 78-Pt-174,173.972811(14),,195.078(2) 78-Pt-175,174.97228(33)#,,195.078(2) 78-Pt-176,175.96900(21)#,,195.078(2) 78-Pt-177,176.96845(33)#,,195.078(2) 78-Pt-178,177.96571(50)#,,195.078(2) 78-Pt-179,178.96548(32)#,,195.078(2) 78-Pt-180,179.96322(22)#,,195.078(2) 78-Pt-181,180.96318(30)#,,195.078(2) 78-Pt-182,181.96127(22),,195.078(2) 78-Pt-183,182.96173(25)#,,195.078(2) 78-Pt-184,183.95990(20)#,,195.078(2) 78-Pt-185,184.96075(22),,195.078(2) 78-Pt-186,185.959430(30),,195.078(2) 78-Pt-187,186.96056(20)#,,195.078(2) 78-Pt-188,187.959396(6),,195.078(2) 78-Pt-189,188.960832(12),,195.078(2) 78-Pt-190,189.959930(7),0.014(1),195.078(2) 78-Pt-191,190.961685(5),,195.078(2) 78-Pt-192,191.961035(4),0.782(7),195.078(2) 78-Pt-193,192.962985(3),,195.078(2) 78-Pt-194,193.962664(3),32.967(99),195.078(2) 78-Pt-195,194.964774(3),33.832(10),195.078(2) 78-Pt-196,195.964935(3),25.242(41),195.078(2) 78-Pt-197,196.967323(3),,195.078(2) 78-Pt-198,197.967876(4),7.163(55),195.078(2) 78-Pt-199,198.970576(5),,195.078(2) 78-Pt-200,199.971424(22),,195.078(2) 78-Pt-201,200.974500(50),,195.078(2) 78-Pt-202,201.97574(32)#,,195.078(2) 79-Au-171,170.99177(27)#,,196.96655(2) 79-Au-172,171.99011(36)#,,196.96655(2) 79-Au-173,172.98640(11),,196.96655(2) 79-Au-174,173.98492(16)#,,196.96655(2) 79-Au-175,174.98155(26)#,,196.96655(2) 79-Au-176,175.98027(43)#,,196.96655(2) 79-Au-177,176.97722(25)#,,196.96655(2) 79-Au-178,177.97598(43)#,,196.96655(2) 79-Au-179,178.97341(37)#,,196.96655(2) 79-Au-180,179.97240(32)#,,196.96655(2) 79-Au-181,180.96995(48)#,,196.96655(2) 79-Au-182,181.96962(39)#,,196.96655(2) 79-Au-183,182.96762(43)#,,196.96655(2) 79-Au-184,183.96747(21)#,,196.96655(2) 79-Au-185,184.96581(23),,196.96655(2) 79-Au-186,185.96600(15),,196.96655(2) 79-Au-187,186.96456(16)#,,196.96655(2) 79-Au-188,187.96509(11)#,,196.96655(2) 79-Au-189,188.96389(22)#,,196.96655(2) 79-Au-190,189.964699(17),,196.96655(2) 79-Au-191,190.963650(50),,196.96655(2) 79-Au-192,191.964810(17),,196.96655(2) 79-Au-193,192.964132(10),,196.96655(2) 79-Au-194,193.965339(12),,196.96655(2) 79-Au-195,194.965018(3),,196.96655(2) 79-Au-196,195.966551(4),,196.96655(2) 79-Au-197,196.966552(3),100,196.96655(2) 79-Au-198,197.968225(3),,196.96655(2) 79-Au-199,198.968748(3),,196.96655(2) 79-Au-200,199.970720(60),,196.96655(2) 79-Au-201,200.971641(5),,196.96655(2) 79-Au-202,201.97379(18),,196.96655(2) 79-Au-203,202.975137(5),,196.96655(2) 79-Au-204,203.97771(22)#,,196.96655(2) 79-Au-205,204.97961(32)#,,196.96655(2) 80-Hg-175,174.99141(34)#,,200.59(2) 80-Hg-176,175.987410(40),,200.59(2) 80-Hg-177,176.98634(12),,200.59(2) 80-Hg-178,177.982476(16),,200.59(2) 80-Hg-179,178.98178(33)#,,200.59(2) 80-Hg-180,179.97832(21)#,,200.59(2) 80-Hg-181,180.97781(33)#,,200.59(2) 80-Hg-182,181.97475(50)#,,200.59(2) 80-Hg-183,182.97456(32)#,,200.59(2) 80-Hg-184,183.97190(22)#,,200.59(2) 80-Hg-185,184.97198(30)#,,200.59(2) 80-Hg-186,185.96946(22),,200.59(2) 80-Hg-187,186.96979(26)#,,200.59(2) 80-Hg-188,187.96756(19)#,,200.59(2) 80-Hg-189,188.96813(30)#,,200.59(2) 80-Hg-190,189.96628(16)#,,200.59(2) 80-Hg-191,190.967060(90),,200.59(2) 80-Hg-192,191.96557(30)#,,200.59(2) 80-Hg-193,192.966644(21),,200.59(2) 80-Hg-194,193.965382(25),,200.59(2) 80-Hg-195,194.966640(50),,200.59(2) 80-Hg-196,195.965815(4),0.15(1),200.59(2) 80-Hg-197,196.967195(5),,200.59(2) 80-Hg-198,197.966752(3),9.97(20),200.59(2) 80-Hg-199,198.968262(3),16.87(22),200.59(2) 80-Hg-200,199.968309(3),23.10(19),200.59(2) 80-Hg-201,200.970285(3),13.18(9),200.59(2) 80-Hg-202,201.970626(3),29.86(26),200.59(2) 80-Hg-203,202.972857(3),,200.59(2) 80-Hg-204,203.973476(3),6.87(15),200.59(2) 80-Hg-205,204.976056(5),,200.59(2) 80-Hg-206,205.977499(22),,200.59(2) 80-Hg-207,206.98258(16),,200.59(2) 80-Hg-208,207.98594(32)#,,200.59(2) 81-Tl-177,176.99688(24)#,,204.3833(2) 81-Tl-178,177.99523(23)#,,204.3833(2) 81-Tl-179,178.99147(15)#,,204.3833(2) 81-Tl-180,179.99019(48)#,,204.3833(2) 81-Tl-181,180.98690(41)#,,204.3833(2) 81-Tl-182,181.98561(43)#,,204.3833(2) 81-Tl-183,182.98270(42)#,,204.3833(2) 81-Tl-184,183.98176(32)#,,204.3833(2) 81-Tl-185,184.97910(43)#,,204.3833(2) 81-Tl-186,185.97855(39)#,,204.3833(2) 81-Tl-187,186.97617(43)#,,204.3833(2) 81-Tl-188,187.97592(24)#,,204.3833(2) 81-Tl-189,188.97369(37)#,,204.3833(2) 81-Tl-190,189.97379(46)#,,204.3833(2) 81-Tl-191,190.97189(23)#,,204.3833(2) 81-Tl-192,191.97214(22)#,,204.3833(2) 81-Tl-193,192.97055(27)#,,204.3833(2) 81-Tl-194,193.97105(22)#,,204.3833(2) 81-Tl-195,194.96965(14)#,,204.3833(2) 81-Tl-196,195.97052(15)#,,204.3833(2) 81-Tl-197,196.969540(30),,204.3833(2) 81-Tl-198,197.970470(90),,204.3833(2) 81-Tl-199,198.96981(11),,204.3833(2) 81-Tl-200,199.970945(7),,204.3833(2) 81-Tl-201,200.970804(16),,204.3833(2) 81-Tl-202,201.972091(16),,204.3833(2) 81-Tl-203,202.972329(3),29.524(14),204.3833(2) 81-Tl-204,203.973849(3),,204.3833(2) 81-Tl-205,204.974412(3),70.476(14),204.3833(2) 81-Tl-206,205.976095(3),,204.3833(2) 81-Tl-207,206.977408(6),,204.3833(2) 81-Tl-208,207.982005(3),,204.3833(2) 81-Tl-209,208.985349(10),,204.3833(2) 81-Tl-210,209.990066(12),,204.3833(2) 82-Pb-181,180.99671(17)#,,207.2(1) 82-Pb-182,181.992676(18),,207.2(1) 82-Pb-183,182.99193(33)#,,207.2(1) 82-Pb-184,183.98820(21)#,,207.2(1) 82-Pb-185,184.98758(33)#,,207.2(1) 82-Pb-186,185.98430(50)#,,207.2(1) 82-Pb-187,186.98403(32)#,,207.2(1) 82-Pb-188,187.98106(22)#,,207.2(1) 82-Pb-189,188.98088(29)#,,207.2(1) 82-Pb-190,189.97818(22),,207.2(1) 82-Pb-191,190.97820(23)#,,207.2(1) 82-Pb-192,191.97576(19)#,,207.2(1) 82-Pb-193,192.97608(20)#,,207.2(1) 82-Pb-194,193.97397(16)#,,207.2(1) 82-Pb-195,194.97447(44)#,,207.2(1) 82-Pb-196,195.97271(15)#,,207.2(1) 82-Pb-197,196.97338(11)#,,207.2(1) 82-Pb-198,197.97198(10)#,,207.2(1) 82-Pb-199,198.972910(70),,207.2(1) 82-Pb-200,199.971816(14),,207.2(1) 82-Pb-201,200.972850(30),,207.2(1) 82-Pb-202,201.972144(11),,207.2(1) 82-Pb-203,202.973375(7),,207.2(1) 82-Pb-204,203.973029(3),1.4(1),207.2(1) 82-Pb-205,204.974467(3),,207.2(1) 82-Pb-206,205.974449(3),24.1(1),207.2(1) 82-Pb-207,206.975881(3),22.1(1),207.2(1) 82-Pb-208,207.976636(3),52.4(1),207.2(1) 82-Pb-209,208.981075(3),,207.2(1) 82-Pb-210,209.984173(3),,207.2(1) 82-Pb-211,210.988731(3),,207.2(1) 82-Pb-212,211.9918875(29),,207.2(1) 82-Pb-213,212.99650(11)#,,207.2(1) 82-Pb-214,213.9997981(27),,207.2(1) 83-Bi-185,184.99771(24)#,,208.98038(2) 83-Bi-186,185.99648(48)#,,208.98038(2) 83-Bi-187,186.99346(41)#,,208.98038(2) 83-Bi-188,187.99217(32)#,,208.98038(2) 83-Bi-189,188.98951(43)#,,208.98038(2) 83-Bi-190,189.98852(39)#,,208.98038(2) 83-Bi-191,190.98605(43)#,,208.98038(2) 83-Bi-192,191.98537(24)#,,208.98038(2) 83-Bi-193,192.98306(37)#,,208.98038(2) 83-Bi-194,193.98275(46)#,,208.98038(2) 83-Bi-195,194.98075(23)#,,208.98038(2) 83-Bi-196,195.98061(22)#,,208.98038(2) 83-Bi-197,196.97893(26),,208.98038(2) 83-Bi-198,197.97902(19),,208.98038(2) 83-Bi-199,198.97758(13),,208.98038(2) 83-Bi-200,199.97814(10),,208.98038(2) 83-Bi-201,200.976970(30),,208.98038(2) 83-Bi-202,201.977670(60),,208.98038(2) 83-Bi-203,202.976868(23),,208.98038(2) 83-Bi-204,203.977805(28),,208.98038(2) 83-Bi-205,204.977375(8),,208.98038(2) 83-Bi-206,205.978483(9),,208.98038(2) 83-Bi-207,206.978455(4),,208.98038(2) 83-Bi-208,207.979727(4),,208.98038(2) 83-Bi-209,208.980383(3),100,208.98038(2) 83-Bi-210,209.984105(3),,208.98038(2) 83-Bi-211,210.987258(6),,208.98038(2) 83-Bi-212,211.991272(3),,208.98038(2) 83-Bi-213,212.994375(8),,208.98038(2) 83-Bi-214,213.998699(12),,208.98038(2) 83-Bi-215,215.00183(10),,208.98038(2) 83-Bi-216,216.00620(11)#,,208.98038(2) 84-Po-190,189.99511(51)#,,[209] 84-Po-191,190.99465(32)#,,[209] 84-Po-192,191.99152(22)#,,[209] 84-Po-193,192.99110(30)#,,[209] 84-Po-194,193.98828(22),,[209] 84-Po-195,194.98805(24)#,,[209] 84-Po-196,195.98551(19)#,,[209] 84-Po-197,196.98557(21)#,,[209] 84-Po-198,197.98334(16)#,,[209] 84-Po-199,198.98360(44)#,,[209] 84-Po-200,199.98174(15)#,,[209] 84-Po-201,200.98221(11)#,,[209] 84-Po-202,201.98070(10)#,,[209] 84-Po-203,202.981410(70),,[209] 84-Po-204,203.980307(14),,[209] 84-Po-205,204.981170(30),,[209] 84-Po-206,205.980465(11),,[209] 84-Po-207,206.981578(8),,[209] 84-Po-208,207.981231(3),,[209] 84-Po-209,208.982416(3),,[209] 84-Po-210,209.982857(3),,[209] 84-Po-211,210.986637(3),,[209] 84-Po-212,211.988852(3),,[209] 84-Po-213,212.992843(4),,[209] 84-Po-214,213.995186(3),,[209] 84-Po-215,214.999415(3),,[209] 84-Po-216,216.0019052(29),,[209] 84-Po-217,217.00625(11)#,,[209] 84-Po-218,218.0089658(27),,[209] 85-At-193,193.00019(43)#,,[210] 85-At-194,193.99897(43)#,,[210] 85-At-195,194.99655(43)#,,[210] 85-At-196,195.99570(25)#,,[210] 85-At-197,196.99329(38)#,,[210] 85-At-198,197.99275(46)#,,[210] 85-At-199,198.99063(24)#,,[210] 85-At-200,199.99029(22)#,,[210] 85-At-201,200.98849(26),,[210] 85-At-202,201.98845(19),,[210] 85-At-203,202.98685(13),,[210] 85-At-204,203.98726(10),,[210] 85-At-205,204.986040(30),,[210] 85-At-206,205.986600(60),,[210] 85-At-207,206.985776(23),,[210] 85-At-208,207.986583(28),,[210] 85-At-209,208.986159(9),,[210] 85-At-210,209.987131(9),,[210] 85-At-211,210.987481(4),,[210] 85-At-212,211.990735(4),,[210] 85-At-213,212.992921(6),,[210] 85-At-214,213.996356(5),,[210] 85-At-215,214.998641(8),,[210] 85-At-216,216.002409(5),,[210] 85-At-217,217.004710(8),,[210] 85-At-218,218.008681(13),,[210] 85-At-219,219.011300(90),,[210] 85-At-220,220.01530(12)#,,[210] 85-At-221,221.01814(32)#,,[210] 85-At-222,222.02233(32)#,,[210] 85-At-223,223.02534(43)#,,[210] 86-Rn-196,196.00231(22)#,,[222] 86-Rn-197,197.00166(30)#,,[222] 86-Rn-198,197.99878(22),,[222] 86-Rn-199,198.99831(24)#,,[222] 86-Rn-200,199.99568(19)#,,[222] 86-Rn-201,200.99554(21)#,,[222] 86-Rn-202,201.99322(16)#,,[222] 86-Rn-203,202.99332(44)#,,[222] 86-Rn-204,203.99137(15)#,,[222] 86-Rn-205,204.99167(12)#,,[222] 86-Rn-206,205.99016(10)#,,[222] 86-Rn-207,206.990730(70),,[222] 86-Rn-208,207.989631(14),,[222] 86-Rn-209,208.990380(30),,[222] 86-Rn-210,209.989680(11),,[222] 86-Rn-211,210.990585(8),,[222] 86-Rn-212,211.990689(4),,[222] 86-Rn-213,212.993868(8),,[222] 86-Rn-214,213.995346(10),,[222] 86-Rn-215,214.998729(9),,[222] 86-Rn-216,216.000258(8),,[222] 86-Rn-217,217.003915(5),,[222] 86-Rn-218,218.005586(4),,[222] 86-Rn-219,219.009475(3),,[222] 86-Rn-220,220.0113841(29),,[222] 86-Rn-221,221.01546(11)#,,[222] 86-Rn-222,222.0175705(27),,[222] 86-Rn-223,223.02179(32)#,,[222] 86-Rn-224,224.02409(32)#,,[222] 86-Rn-225,225.02844(32)#,,[222] 86-Rn-226,226.03089(43)#,,[222] 86-Rn-227,227.03541(45)#,,[222] 86-Rn-228,228.03808(50)#,,[222] 87-Fr-200,200.00650(25)#,,[223] 87-Fr-201,201.00399(38)#,,[223] 87-Fr-202,202.00329(46)#,,[223] 87-Fr-203,203.00105(25)#,,[223] 87-Fr-204,204.00059(22)#,,[223] 87-Fr-205,204.99866(25),,[223] 87-Fr-206,205.99849(19),,[223] 87-Fr-207,206.99686(12),,[223] 87-Fr-208,207.997130(80),,[223] 87-Fr-209,208.995920(30),,[223] 87-Fr-210,209.996398(23),,[223] 87-Fr-211,210.995529(22),,[223] 87-Fr-212,211.996195(28),,[223] 87-Fr-213,212.996175(9),,[223] 87-Fr-214,213.998955(10),,[223] 87-Fr-215,215.000326(8),,[223] 87-Fr-216,216.003188(14),,[223] 87-Fr-217,217.004616(8),,[223] 87-Fr-218,218.007563(6),,[223] 87-Fr-219,219.009241(8),,[223] 87-Fr-220,220.012313(5),,[223] 87-Fr-221,221.014246(8),,[223] 87-Fr-222,222.017544(23),,[223] 87-Fr-223,223.0197307(29),,[223] 87-Fr-224,224.023240(50),,[223] 87-Fr-225,225.025607(11),,[223] 87-Fr-226,226.02934(10),,[223] 87-Fr-227,227.03183(10),,[223] 87-Fr-228,228.03572(22)#,,[223] 87-Fr-229,229.03843(39)#,,[223] 87-Fr-230,230.04251(48)#,,[223] 87-Fr-231,231.04541(56)#,,[223] 87-Fr-232,232.04965(69)#,,[223] 88-Ra-203,203.00921(25)#,,[226] 88-Ra-204,204.00648(19)#,,[226] 88-Ra-205,205.00619(22)#,,[226] 88-Ra-206,206.00378(16)#,,[226] 88-Ra-207,207.00373(45)#,,[226] 88-Ra-208,208.00178(15)#,,[226] 88-Ra-209,209.00194(13)#,,[226] 88-Ra-210,210.00045(10)#,,[226] 88-Ra-211,211.000890(70),,[226] 88-Ra-212,211.999783(15),,[226] 88-Ra-213,213.000350(30),,[226] 88-Ra-214,214.000091(12),,[226] 88-Ra-215,215.002704(9),,[226] 88-Ra-216,216.003518(10),,[226] 88-Ra-217,217.006306(10),,[226] 88-Ra-218,218.007124(12),,[226] 88-Ra-219,219.010069(9),,[226] 88-Ra-220,220.011015(11),,[226] 88-Ra-221,221.013908(8),,[226] 88-Ra-222,222.015362(5),,[226] 88-Ra-223,223.018497(3),,[226] 88-Ra-224,224.0202020(29),,[226] 88-Ra-225,225.023604(3),,[226] 88-Ra-226,226.0254026(27),,[226] 88-Ra-227,227.0291707(27),,[226] 88-Ra-228,228.0310641(27),,[226] 88-Ra-229,229.034820(70),,[226] 88-Ra-230,230.037080(40),,[226] 88-Ra-231,231.04122(32)#,,[226] 88-Ra-232,232.04369(39)#,,[226] 88-Ra-233,233.04800(50)#,,[226] 88-Ra-234,234.05055(58)#,,[226] 89-Ac-207,207.01209(25)#,,[227] 89-Ac-208,208.01149(22)#,,[227] 89-Ac-209,209.00957(26),,[227] 89-Ac-210,210.00926(20),,[227] 89-Ac-211,211.00765(14),,[227] 89-Ac-212,212.00781(10),,[227] 89-Ac-213,213.006570(60),,[227] 89-Ac-214,214.006890(60),,[227] 89-Ac-215,215.006450(60),,[227] 89-Ac-216,216.008721(29),,[227] 89-Ac-217,217.009333(14),,[227] 89-Ac-218,218.011630(50),,[227] 89-Ac-219,219.012400(50),,[227] 89-Ac-220,220.014750(60),,[227] 89-Ac-221,221.015580(50),,[227] 89-Ac-222,222.017829(6),,[227] 89-Ac-223,223.019126(8),,[227] 89-Ac-224,224.021708(5),,[227] 89-Ac-225,225.023221(8),,[227] 89-Ac-226,226.026090(4),,[227] 89-Ac-227,227.0277470(29),,[227] 89-Ac-228,228.0310148(28),,[227] 89-Ac-229,229.032930(50),,[227] 89-Ac-230,230.03603(11),,[227] 89-Ac-231,231.03855(11),,[227] 89-Ac-232,232.04202(11),,[227] 89-Ac-233,233.04455(32)#,,[227] 89-Ac-234,234.04842(43)#,,[227] 89-Ac-235,235.05110(45)#,,[227] 89-Ac-236,236.05518(54)#,,[227] 90-Th-210,210.01503(17)#,,232.0381(1) 90-Th-211,211.01486(45)#,,232.0381(1) 90-Th-212,212.01292(15)#,,232.0381(1) 90-Th-213,213.01296(14)#,,232.0381(1) 90-Th-214,214.01145(10)#,,232.0381(1) 90-Th-215,215.011730(70),,232.0381(1) 90-Th-216,216.011051(17),,232.0381(1) 90-Th-217,217.013070(30),,232.0381(1) 90-Th-218,218.013268(15),,232.0381(1) 90-Th-219,219.015520(50),,232.0381(1) 90-Th-220,220.015733(24),,232.0381(1) 90-Th-221,221.018171(11),,232.0381(1) 90-Th-222,222.018454(14),,232.0381(1) 90-Th-223,223.020795(10),,232.0381(1) 90-Th-224,224.021459(13),,232.0381(1) 90-Th-225,225.023941(8),,232.0381(1) 90-Th-226,226.024891(5),,232.0381(1) 90-Th-227,227.027699(3),,232.0381(1) 90-Th-228,228.0287313(29),,232.0381(1) 90-Th-229,229.031755(3),,232.0381(1) 90-Th-230,230.0331266(22),,232.0381(1) 90-Th-231,231.0362971(22),,232.0381(1) 90-Th-232,232.0380504(22),100,232.0381(1) 90-Th-233,233.0415769(22),,232.0381(1) 90-Th-234,234.043595(4),,232.0381(1) 90-Th-235,235.047500(50),,232.0381(1) 90-Th-236,236.04971(32)#,,232.0381(1) 90-Th-237,237.05389(39)#,,232.0381(1) 90-Th-238,238.05624(39)#,,232.0381(1) 91-Pa-213,213.02118(27),,231.03588(2) 91-Pa-214,214.02074(21),,231.03588(2) 91-Pa-215,215.01910(15),,231.03588(2) 91-Pa-216,216.01911(11),,231.03588(2) 91-Pa-217,217.018290(80),,231.03588(2) 91-Pa-218,218.020010(80),,231.03588(2) 91-Pa-219,219.019880(80),,231.03588(2) 91-Pa-220,220.021880(60),,231.03588(2) 91-Pa-221,221.021860(60),,231.03588(2) 91-Pa-222,222.023730(80)#,,231.03588(2) 91-Pa-223,223.023960(80),,231.03588(2) 91-Pa-224,224.025610(60),,231.03588(2) 91-Pa-225,225.026120(80),,231.03588(2) 91-Pa-226,226.027933(13),,231.03588(2) 91-Pa-227,227.028793(8),,231.03588(2) 91-Pa-228,228.031037(5),,231.03588(2) 91-Pa-229,229.032089(10),,231.03588(2) 91-Pa-230,230.034533(4),,231.03588(2) 91-Pa-231,231.0358789(28),100,231.03588(2) 91-Pa-232,232.038582(8),,231.03588(2) 91-Pa-233,233.0402402(24),,231.03588(2) 91-Pa-234,234.043302(5),,231.03588(2) 91-Pa-235,235.045440(50),,231.03588(2) 91-Pa-236,236.04868(21),,231.03588(2) 91-Pa-237,237.05114(11),,231.03588(2) 91-Pa-238,238.054500(60),,231.03588(2) 91-Pa-239,239.05713(32)#,,231.03588(2) 91-Pa-240,240.06098(32)#,,231.03588(2) 92-U-218,218.02349(10)#,,238.02891(3) 92-U-219,219.024920(90),,238.02891(3) 92-U-220,220.02471(22)#,,238.02891(3) 92-U-221,221.02635(11)#,,238.02891(3) 92-U-222,222.02607(11)#,,238.02891(3) 92-U-223,223.027720(80),,238.02891(3) 92-U-224,224.027590(27),,238.02891(3) 92-U-225,225.029380(50),,238.02891(3) 92-U-226,226.029340(20),,238.02891(3) 92-U-227,227.031140(18),,238.02891(3) 92-U-228,228.031366(17),,238.02891(3) 92-U-229,229.033496(9),,238.02891(3) 92-U-230,230.033927(5),,238.02891(3) 92-U-231,231.036289(4),,238.02891(3) 92-U-232,232.0371463(29),,238.02891(3) 92-U-233,233.039628(3),,238.02891(3) 92-U-234,234.0409456(21),0.0055(2),238.02891(3) 92-U-235,235.0439231(21),0.7200(51),238.02891(3) 92-U-236,236.0455619(21),,238.02891(3) 92-U-237,237.0487240(21),,238.02891(3) 92-U-238,238.0507826(21),99.2745(106),238.02891(3) 92-U-239,239.0542878(21),,238.02891(3) 92-U-240,240.056586(6),,238.02891(3) 92-U-241,241.06033(32)#,,238.02891(3) 92-U-242,242.06293(22)#,,238.02891(3) 93-Np-225,225.033900(80),,[237] 93-Np-226,226.03513(10)#,,[237] 93-Np-227,227.034960(80),,[237] 93-Np-228,228.03618(21)#,,[237] 93-Np-229,229.036250(90),,[237] 93-Np-230,230.037810(60),,[237] 93-Np-231,231.038230(50),,[237] 93-Np-232,232.04010(11)#,,[237] 93-Np-233,233.040730(60),,[237] 93-Np-234,234.042889(9),,[237] 93-Np-235,235.0440559(23),,[237] 93-Np-236,236.046560(50),,[237] 93-Np-237,237.0481673(21),,[237] 93-Np-238,238.0509405(21),,[237] 93-Np-239,239.0529314(23),,[237] 93-Np-240,240.056169(16),,[237] 93-Np-241,241.058250(80),,[237] 93-Np-242,242.06164(22)#,,[237] 93-Np-243,243.064270(30)#,,[237] 93-Np-244,244.06785(32)#,,[237] 94-Pu-228,228.038730(30),,[244] 94-Pu-229,229.040140(80),,[244] 94-Pu-230,230.039646(26),,[244] 94-Pu-231,231.04126(11)#,,[244] 94-Pu-232,232.041179(20),,[244] 94-Pu-233,233.042990(50),,[244] 94-Pu-234,234.043305(8),,[244] 94-Pu-235,235.045282(22),,[244] 94-Pu-236,236.0460481(29),,[244] 94-Pu-237,237.0484038(25),,[244] 94-Pu-238,238.0495534(21),,[244] 94-Pu-239,239.0521565(21),,[244] 94-Pu-240,240.0538075(21),,[244] 94-Pu-241,241.0568453(21),,[244] 94-Pu-242,242.0587368(21),,[244] 94-Pu-243,243.061997(3),,[244] 94-Pu-244,244.064198(5),,[244] 94-Pu-245,245.067739(15),,[244] 94-Pu-246,246.070198(16),,[244] 94-Pu-247,247.07407(32)#,,[244] 95-Am-231,231.04556(32)#,,[243] 95-Am-232,232.04659(32)#,,[243] 95-Am-233,233.04647(23)#,,[243] 95-Am-234,234.04779(22)#,,[243] 95-Am-235,235.04803(22)#,,[243] 95-Am-236,236.04957(11)#,,[243] 95-Am-237,237.049970(60),,[243] 95-Am-238,238.051980(50),,[243] 95-Am-239,239.053018(3),,[243] 95-Am-240,240.055288(15),,[243] 95-Am-241,241.0568229(21),,[243] 95-Am-242,242.0595430(21),,[243] 95-Am-243,243.0613727(23),,[243] 95-Am-244,244.0642794(23),,[243] 95-Am-245,245.066445(4),,[243] 95-Am-246,246.069768(20),,[243] 95-Am-247,247.07209(11)#,,[243] 95-Am-248,248.07575(22)#,,[243] 95-Am-249,249.07848(32)#,,[243] 96-Cm-233,233.05080(43)#,,[247] 96-Cm-234,234.05024(32)#,,[247] 96-Cm-235,235.05159(24)#,,[247] 96-Cm-236,236.05141(22)#,,[247] 96-Cm-237,237.05289(22)#,,[247] 96-Cm-238,238.053020(40),,[247] 96-Cm-239,239.05495(11)#,,[247] 96-Cm-240,240.0555190(29),,[247] 96-Cm-241,241.0576467(24),,[247] 96-Cm-242,242.0588293(21),,[247] 96-Cm-243,243.0613822(24),,[247] 96-Cm-244,244.0627463(21),,[247] 96-Cm-245,245.0654856(29),,[247] 96-Cm-246,246.0672176(24),,[247] 96-Cm-247,247.070347(5),,[247] 96-Cm-248,248.072342(5),,[247] 96-Cm-249,249.075947(5),,[247] 96-Cm-250,250.078351(12),,[247] 96-Cm-251,251.082278(24),,[247] 96-Cm-252,252.08487(32)#,,[247] 97-Bk-235,235.05658(43)#,,[247] 97-Bk-236,236.05733(43)#,,[247] 97-Bk-237,237.05713(32)#,,[247] 97-Bk-238,238.05827(31)#,,[247] 97-Bk-239,239.05836(31)#,,[247] 97-Bk-240,240.05975(16)#,,[247] 97-Bk-241,241.06022(22)#,,[247] 97-Bk-242,242.06205(22)#,,[247] 97-Bk-243,243.063002(5),,[247] 97-Bk-244,244.065168(16),,[247] 97-Bk-245,245.0663554(26),,[247] 97-Bk-246,246.068670(60),,[247] 97-Bk-247,247.070299(6),,[247] 97-Bk-248,248.073080(80)#,,[247] 97-Bk-249,249.074980(3),,[247] 97-Bk-250,250.078311(4),,[247] 97-Bk-251,251.080753(12),,[247] 97-Bk-252,252.08430(22)#,,[247] 97-Bk-253,253.08688(39)#,,[247] 97-Bk-254,254.09060(32)#,,[247] 98-Cf-237,237.06207(54)#,,[251] 98-Cf-238,238.06141(43)#,,[251] 98-Cf-239,239.06258(25)#,,[251] 98-Cf-240,240.06230(22)#,,[251] 98-Cf-241,241.06372(27)#,,[251] 98-Cf-242,242.063690(40),,[251] 98-Cf-243,243.06542(15)#,,[251] 98-Cf-244,244.065990(4),,[251] 98-Cf-245,245.06804(11)#,,[251] 98-Cf-246,246.0687988(24),,[251] 98-Cf-247,247.070992(9),,[251] 98-Cf-248,248.072178(6),,[251] 98-Cf-249,249.074847(3),,[251] 98-Cf-250,250.0764000(24),,[251] 98-Cf-251,251.079580(5),,[251] 98-Cf-252,252.081620(5),,[251] 98-Cf-253,253.085127(7),,[251] 98-Cf-254,254.087316(13),,[251] 98-Cf-255,255.09104(22)#,,[251] 98-Cf-256,256.09344(32)#,,[251] 99-Es-240,240.06892(43)#,,[252] 99-Es-241,241.06866(32)#,,[252] 99-Es-242,242.06970(35)#,,[252] 99-Es-243,243.06963(31)#,,[252] 99-Es-244,244.07097(20)#,,[252] 99-Es-245,245.07132(22)#,,[252] 99-Es-246,246.07297(24)#,,[252] 99-Es-247,247.073650(30)#,,[252] 99-Es-248,248.075460(60)#,,[252] 99-Es-249,249.076410(30)#,,[252] 99-Es-250,250.07865(11)#,,[252] 99-Es-251,251.079984(7),,[252] 99-Es-252,252.082970(50),,[252] 99-Es-253,253.084818(3),,[252] 99-Es-254,254.088016(5),,[252] 99-Es-255,255.090266(12),,[252] 99-Es-256,256.09359(11)#,,[252] 99-Es-257,257.09598(44)#,,[252] 100-Fm-242,242.07343(43)#,,[257] 100-Fm-243,243.07451(25)#,,[257] 100-Fm-244,244.07408(31)#,,[257] 100-Fm-245,245.07538(30)#,,[257] 100-Fm-246,246.075280(40),,[257] 100-Fm-247,247.07682(16)#,,[257] 100-Fm-248,248.077184(13),,[257] 100-Fm-249,249.07902(15)#,,[257] 100-Fm-250,250.079515(13),,[257] 100-Fm-251,251.081566(9),,[257] 100-Fm-252,252.082460(6),,[257] 100-Fm-253,253.085176(5),,[257] 100-Fm-254,254.086848(3),,[257] 100-Fm-255,255.089955(5),,[257] 100-Fm-256,256.091767(8),,[257] 100-Fm-257,257.095099(7),,[257] 100-Fm-258,258.09707(22)#,,[257] 100-Fm-259,259.10059(30)#,,[257] 101-Md-245,245.08102(40)#,,[258] 101-Md-246,246.08193(41)#,,[258] 101-Md-247,247.08180(39)#,,[258] 101-Md-248,248.08291(26)#,,[258] 101-Md-249,249.08300(24)#,,[258] 101-Md-250,250.08449(32)#,,[258] 101-Md-251,251.08492(22)#,,[258] 101-Md-252,252.08663(21)#,,[258] 101-Md-253,253.08728(22)#,,[258] 101-Md-254,254.08973(11)#,,[258] 101-Md-255,255.091075(8),,[258] 101-Md-256,256.094050(60),,[258] 101-Md-257,257.095535(4),,[258] 101-Md-258,258.098425(5),,[258] 101-Md-259,259.10050(22)#,,[258] 101-Md-260,260.10365(34)#,,[258] 102-No-249,249.08782(37)#,,[259] 102-No-250,250.08749(22)#,,[259] 102-No-251,251.08896(19)#,,[259] 102-No-252,252.088966(14),,[259] 102-No-253,253.09065(26)#,,[259] 102-No-254,254.090949(19),,[259] 102-No-255,255.093232(13),,[259] 102-No-256,256.094276(9),,[259] 102-No-257,257.096850(30),,[259] 102-No-258,258.09820(22)#,,[259] 102-No-259,259.10102(11)#,,[259] 102-No-260,260.10264(22)#,,[259] 102-No-261,261.10574(32)#,,[259] 102-No-262,262.10752(58)#,,[259] 103-Lr-251,251.09436(32)#,,[262] 103-Lr-252,252.09533(32)#,,[262] 103-Lr-253,253.09526(24)#,,[262] 103-Lr-254,254.09659(36)#,,[262] 103-Lr-255,255.09677(22)#,,[262] 103-Lr-256,256.09876(24)#,,[262] 103-Lr-257,257.09961(22)#,,[262] 103-Lr-258,258.10188(11)#,,[262] 103-Lr-259,259.102990(80)#,,[262] 103-Lr-260,260.10557(12)#,,[262] 103-Lr-261,261.10694(22)#,,[262] 103-Lr-262,262.10969(32)#,,[262] 103-Lr-263,263.11139(39)#,,[262] 104-Rf-253,253.10068(49)#,,[261] 104-Rf-254,254.10017(31)#,,[261] 104-Rf-255,255.10149(22)#,,[261] 104-Rf-256,256.101180(29),,[261] 104-Rf-257,257.10307(29)#,,[261] 104-Rf-258,258.10357(22)#,,[261] 104-Rf-259,259.105630(80)#,,[261] 104-Rf-260,260.10643(22)#,,[261] 104-Rf-261,261.10875(11)#,,[261] 104-Rf-262,262.10992(30)#,,[261] 104-Rf-263,263.11254(20)#,,[261] 104-Rf-264,264.11398(48)#,,[261] 105-Db-255,255.10740(45)#,,[262] 105-Db-256,256.10811(39)#,,[262] 105-Db-257,257.10786(25)#,,[262] 105-Db-258,258.10944(37)#,,[262] 105-Db-259,259.10972(31)#,,[262] 105-Db-260,260.11143(25)#,,[262] 105-Db-261,261.11211(25)#,,[262] 105-Db-262,262.11415(20)#,,[262] 105-Db-263,263.11508(18)#,,[262] 105-Db-264,264.11747(25)#,,[262] 105-Db-265,265.11866(30)#,,[262] 106-Sg-258,258.11315(45)#,,[266] 106-Sg-259,259.11465(23)#,,[266] 106-Sg-260,260.114440(40),,[266] 106-Sg-261,261.11620(30)#,,[266] 106-Sg-262,262.11648(30)#,,[266] 106-Sg-263,263.11831(13)#,,[266] 106-Sg-264,264.11892(30)#,,[266] 106-Sg-265,265.12107(15)#,,[266] 106-Sg-266,266.12193(31)#,,[266] 107-Bh-260,260.12180(66)#,,[264] 107-Bh-261,261.12180(26)#,,[264] 107-Bh-262,262.12301(40)#,,[264] 107-Bh-263,263.12315(45)#,,[264] 107-Bh-264,264.12473(30)#,,[264] 107-Bh-265,265.12520(41)#,,[264] 107-Bh-266,266.12701(38)#,,[264] 107-Bh-267,267.12774(37)#,,[264] 108-Hs-263,263.12871(39)#,,[277] 108-Hs-264,264.128410(50),,[277] 108-Hs-265,265.13000(32)#,,[277] 108-Hs-266,266.13004(44)#,,[277] 108-Hs-267,267.13177(11)#,,[277] 108-Hs-268,268.13216(44)#,,[277] 108-Hs-269,269.13411(46)#,,[277] 108-Hs-277,,,[277] 109-Mt-265,265.13657(50)#,,[268] 109-Mt-266,266.13794(38)#,,[268] 109-Mt-267,267.13753(62)#,,[268] 109-Mt-268,268.13882(34)#,,[268] 109-Mt-269,269.13911(59)#,,[268] 109-Mt-270,270.14072(66)#,,[268] 109-Mt-271,271.14123(65)#,,[268] 110-Ds-267,267.14396(41)#,,[281] 110-Ds-268,268.14353(54)#,,[281] 110-Ds-269,269.14514(31)#,,[281] 110-Ds-270,270.14463(70)#,,[281] 110-Ds-271,271.14608(20)#,,[281] 110-Ds-272,272.14631(70)#,,[281] 110-Ds-273,273.14925(47)#,,[281] 110-Ds-281,,,[281] 111-Rg-272,272.15348(36)#,,[272] 112-Cn-285,,,[285] 113-Nh-286,,,[286] 114-Fl-289,,,[289] 115-Mc-289,,,[289] 116-Lv-293,,,[293] 117-Ts-294,,,[294] 118-Og-294,,,[294]\ """ periodictable-1.5.0/periodictable/nsf.py000066400000000000000000002073641310514471200203030ustar00rootroot00000000000000# -*- coding: utf-8 -*- # This program is public domain # Author: Paul Kienzle r""" Neutron scattering factors for the elements and isotopes. For details of neutron scattering factor values, see :class:`Neutron`. The property is set to *None* if there is no neutron scattering information for the element. Individual isotopes may have their own scattering information. Example ======= Print a table of coherent scattering length densities for isotopes of a particular element: .. doctest:: >>> import periodictable >>> for iso in periodictable.Ni: ... if iso.neutron.has_sld(): ... print("%s %7.4f"%(iso,iso.neutron.sld()[0])) 58-Ni 13.1526 60-Ni 2.5575 61-Ni 6.9417 62-Ni -7.9464 64-Ni -0.3379 Details ======= There are a number of functions available in periodictable.nsf :func:`neutron_energy` Return neutron energy given wavelength. :func:`neutron_wavelength` Return wavelength given neutron energy. :func:`neutron_wavelength_from_velocity` Return wavelength given neutron velocity. :func:`neutron_scattering` Computes scattering length density, cross sections and penetration depth for a compound. :func:`neutron_sld` Computes scattering length density for a compound. :func:`neutron_composite_sld` Returns a scattering length density for a compound whose composition is variable. :func:`energy_dependent_table` Lists isotopes with energy dependence. :func:`sld_table` Lists scattering length densitys for all elements in natural abundance. :func:`absorption_comparison_table` Compares the imaginary bound coherent scattering length to the absorption cross section. :func:`coherent_comparison_table` Compares the bound coherent scattering length to the coherent scattering cross section. :func:`total_comparison_table` Compares the total scattering cross section to the sum of the coherent and incoherent scattering cross sections. For private tables use :func:`init` to set the data. The neutron scattering information table is reproduced from the Atomic Institute for Austrian Universities\ [#Rauch2003]_ (retrieve March 2008): http://www.ati.ac.at/~neutropt/scattering/table.html The above site has references to the published values for every entry in the table. We have included these in the documentation directory associated with the periodictable package. .. Note: Enteries in the table have been measured independently, so the values measured for the scattering length of an element or isotope may be inconsistent with the values measured for the corresponding cross section. .. [#Rauch2003] Rauch, H. and Waschkowski, W. (2003) Neutron Scattering Lengths in ILL Neutron Data Booklet (second edition), A.-J. Dianoux, G. Lander, Eds. Old City Publishing, Philidelphia, PA. pp 1.1-1 to 1.1-17. .. [#Rauch2000] Rauch, H. and Waschkowski, W. (2000) Neutron scattering lengths. Schopper, H. (ed.). SpringerMaterials - The Landolt-Börnstein Database (http://www.springermaterials.com). doi: 10.1007/10499706_6 .. [#Koester1991] Koester, L., Rauch, H., Seymann. E. (1991) Atomic Data Nuclear Data Tables 49, 65 .. [#Lynn1990] Lynn, J.E. and Seeger, P.A. (1990) Resonance effects in neutron scattering lengths of rare-earth nuclides. Atomic Data and Nuclear Data Tables 44, 191-207. .. [#Sears1999] Sears, V. F. (1999) 4.4.4 Scattering lengths for neutrons. In Wilson & Prince eds. Intl. Tables for Crystallography C Kluwer Academic Publishers. pp 383. .. [#Sears1992] Sears, V.F. (1992) Neutron scattering lengths and cross sections. Neutron News 3, No. 3, 26-37. .. [#May1982] May, R.P., Ibel, K. and Haas, J. (1982) The forward scattering of cold neutrons by mixtures of light and heavy water. J. Appl. Cryst. 15, 15-19. .. [#Smith2006] Smith, G.S. and Majkrzak, C.M. (2006) 2.9 Neutron reflectometry. In E. Prince ed. Intl. Tables for Crystallography C Wiley InterScience. pp 126-146. doi: 10.1107/97809553602060000584 .. [#Glinka2011] Glinka, C.J. (2011) Incoherent Neutron Scattering from Multi-element Materials. J. Appl. Cryst. 44, 618-624. doi: 10.1107/S0021889811008223 """ from __future__ import print_function import numpy from numpy import sqrt, pi, asarray, inf from .core import Element, Isotope, default_table from .constants import (avogadro_number, plancks_constant, electron_volt, neutron_mass, atomic_mass_constant) from .util import require_keywords __all__ = ['init', 'Neutron', 'neutron_energy', 'neutron_wavelength', 'neutron_wavelength_from_velocity', 'neutron_scattering', 'neutron_sld', 'neutron_composite_sld', 'sld_plot', 'absorption_comparison_table', 'coherent_comparison_table', 'incoherent_comparison_table', 'total_comparison_table', 'energy_dependent_table', 'sld_table', 'neutron_sld_from_atoms', #'scattering_potential', ] ABSORPTION_WAVELENGTH = 1.798 # Velocity (m/s) <=> wavelength (A) # lambda = h / p = h (eV) (J/eV) / ( m_n (kg) v (m/s) ) (10^10 A/m) # # Since plancks constant is in eV # lambda = (1e10 * h*electron_volt/(neutron_mass/N_A)) / velocity # Energy (eV) <=> wavelength (A) # h^2/(2 m_n kg lambda A) (10^20 A/m) (1000 meV/eV) / (electron_volt J/eV) # Since plancks constant is in eV # (h J)^2/electron_volt = ((h eV)(electron_volt J/eV))^2/electron_volt # = (h eV)^2 * electron_volt ENERGY_FACTOR = (plancks_constant**2*electron_volt / (2 * neutron_mass * atomic_mass_constant)) * 1e23 VELOCITY_FACTOR = (plancks_constant*electron_volt / (neutron_mass * atomic_mass_constant)) * 1e10 def neutron_wavelength(energy): r""" Convert neutron energy to wavelength. :Parameters: *energy* : float or vector | meV :Returns: *wavelength* : float or vector | |Ang| Energy is converted to wavelength using .. math:: E = 1/2 m_n v^2 = h^2 / (2 m_n \lambda^2) \Rightarrow \lambda = \sqrt{h^2 / (2 m_n E)} where $h$ = planck's constant in |Js| $m_n$ = neutron mass in kg """ return sqrt(ENERGY_FACTOR / asarray(energy)) def neutron_wavelength_from_velocity(velocity): r""" Convert neutron velocity to wavelength. :Parameters: *velocity* : float or vector | m/s :Returns: *wavelength* : float or vector | |Ang| Velocity is converted to wavelength using .. math:: \lambda = h/p = h/(m_n v) where $h$ = planck's constant in |Js| $m_n$ = neutron mass in kg """ return VELOCITY_FACTOR / velocity def neutron_energy(wavelength): r""" Convert neutron wavelength to energy. :Parameters: *wavelength* : float or vector | |Ang| :Returns: *energy* : float or vector | meV Wavelength is converted to energy using .. math:: E = 1/2 m_n v^2 = h^2 / (2 m_n \lambda^2) where: $h$ = planck's constant in |Js| $m_n$ = neutron mass in kg """ return ENERGY_FACTOR / asarray(wavelength)**2 def _CHECK_scattering_potential(sld): r""" Convert neutron scattering length density to energy potential. :Parameters: *sld* : float or vector | |1e-6/Ang^2| Scattering length density. :Returns: *energy* : float or vector | $10^{-6}$ eV Scattering potential. Computes:[#Smith2006]_ .. math:: V = 2 \pi \hbar^2 N_b / m_n where: $\hbar = h / (2 \pi)$ $h$ = planck's constant in |Js| $N_b = \sum{ n_i b_i } / V$ $m_n$ = neutron mass in kg """ return (ENERGY_FACTOR/pi) * asarray(sld) class Neutron(object): r""" Neutron scattering factors are attached to each element in the periodic table for which values are available. If no information is available, then the neutron field of the element will be *None*. Even when neutron information is available, it may not be complete, so individual fields may be *None*. The following fields are defined: * b_c (fm) Bounds coherent scattering length. * total (barn) Total scattering cross section $\sigma_s$. This does not include the absorption cross section. To compute the total collision cross section use $\sigma_t = \sigma_s + \sigma_a$ * absorption (barn) Absorption cross section $\sigma_a$ at 1.798 |Ang|. Scale to your beam by dividing by periodictable.nsf.ABSORPTION_WAVELENGTH and multiplying by your wavelength. Additional fields not used for calculation include: * b_c_i (fm) Imaginary bound coherent scattering length. This is related to absorption cross section by $\sigma_a = 4 \pi b_i/k$ where $k = 2 \pi/\lambda$ and an additional factor of 1000 for converting between |Ang|\ |cdot|\ fm and barns. b_c_i is not available for all isotopes for which absorption cross sections have been measured. * bp, bm (fm) Spin-dependent scattering for I+1/2 and I-1/2 (not always available). Incoherent scattering arises from the spin-dependent scattering b+ and b-. The Neutron Data Booklet\ [#Rauch2003]_ gives formulas for calculating coherent and incoherent scattering from b+ and b- alone. * bp_i, bm_i (fm) Imaginary portion of bp and bm. * is_energy_dependent (boolean) Do not use this data if scattering is energy dependent. * coherent (barn) Coherent scattering cross section. This is tabulated but not used. In theory coherent scattering is related to bound coherent scattering by $\sigma_s = 4 \pi b_c^2/100$. In practice, these values are different, with the following table showing the largest relative difference: ======== ======== ======== ======== ======== Sc 3% Ti 4% V 34% Mn 1% Cd 4% Te 4% Xe 9% Sm 100% Eu 46% Gd 61% Tb 1% Ho 11% W 4% Au 7% Hg 2% ======== ======== ======== ======== ======== * incoherent (barn) Incoherent scattering cross section $\sigma_i$. This is tabulated but not used. Instead, the incoherent cross section is computed from the total cross section minus the coherent cross section even for single atoms so that results from compounds are consistent with results from single atoms. For elements, the scattering cross-sections are based on the natural abundance of the individual isotopes. Individual isotopes may have the following additional fields * abundance (%) Isotope abundance used to compute the properties of the element in natural abundance. * nuclear_spin (string) Spin on the nucleus: '0', '1/2', '3/2', etc. Each field ``T`` above has a corresponding ``T_units`` attribute with the name of the units. For scattering calculations, the scattering length density is the value of interest. This is computed from the *number_density* of the individual elements, as derived from the element density and atomic mass. .. Note:: 1 barn = 100 |fm^2| """ b_c = None b_c_i = None b_c_units = "fm" bp = None bp_i = None bp_units = "fm" bm = None bm_i = None bm_units = "fm" coherent = None coherent_units = "barn" incoherent = None incoherent_units = "barn" total = None total_units = "barn" absorption = None absorption_units = "barn" abundance = 0. abundance_units = "%" is_energy_dependent = False def __init__(self): self._number_density = None def __str__(self): return ("b_c=%.3g coh=%.3g inc=%.3g abs=%.3g" % (self.b_c, self.coherent, self.incoherent, self.absorption)) def has_sld(self): """Returns *True* if sld is defined for this element/isotope.""" return None not in [self.b_c, self._number_density] @require_keywords def sld(self, wavelength=ABSORPTION_WAVELENGTH): """ Returns scattering length density for the element at natural abundance and density. :Parameters: *wavelength* : float | |Ang| :Returns: *sld* : (float, float, float) | |1e-6/Ang^2| (*real*, -*imaginary*, *incoherent*) scattering length density. .. Note: Values may not be correct when the element or isotope has *is_energy_dependent=True* See :func:`neutron_scattering` for details. """ # Compute number and absorption density assuming isotope has # same structure as the bulk element if not self.has_sld(): return None, None, None b_c = self.b_c sigma_s = self.total sigma_a = self.absorption/ABSORPTION_WAVELENGTH*wavelength number_density = self._number_density*1e-24 # PAK 2017-04-21: compute incoherent cross section from total cross section sigma_c = 4*pi/100 * b_c**2 sigma_i = max(sigma_s - sigma_c, 0.) # Compute SLD sld_re = number_density * b_c * 10 sld_im = number_density * sigma_a / (2 * wavelength) * 0.01 sld_inc = number_density * sqrt(sigma_i / (4*pi/100)) * 10 return sld_re, sld_im, sld_inc @require_keywords def scattering(self, wavelength=ABSORPTION_WAVELENGTH): r""" Returns neutron scattering information for the element at natural abundance and density. :Parameters: *wavelength* : float | |Ang| :Returns: *sld* : (float, float, float) | |1e-6/Ang^2| (*real*, -*imaginary*, *incoherent*) scattering length density *xs* : (float, float, float) | |1/cm| (*coherent*, *absorption*, *incoherent*) cross sections. *penetration* : float | cm 1/e penetration length. .. Note: Values may not be correct when the element or isotope has *is_energy_dependent=True* See :func:`neutron_scattering` for details. """ # Compute number and absorption density assuming isotope has # same structure as the bulk element if not self.has_sld(): return None, None, None b_c = self.b_c sigma_s = self.total sigma_a = self.absorption*wavelength/ABSORPTION_WAVELENGTH number_density = self._number_density*1e-24 # PAK 2017-04-21: compute incoherent cross section from total cross section sigma_c = 4*pi/100 * b_c**2 sigma_i = max(sigma_s - sigma_c, 0.) # Compute SLD sld_re = number_density * b_c * 10 sld_im = number_density * sigma_a / (2 * wavelength) * 0.01 sld_inc = number_density * sqrt(sigma_i / (4*pi/100)) * 10 # Compute scattering cross section per unit volume total_xs = number_density * sigma_s coh_xs = number_density * sigma_c abs_xs = number_density * sigma_a inc_xs = number_density * sigma_i # Compute 1/e length penetration = 1/(abs_xs + total_xs) return (sld_re, sld_im, sld_inc), (coh_xs, abs_xs, inc_xs), penetration def init(table, reload=False): """ Loads the Rauch table from the neutron data book. """ if 'neutron' in table.properties and not reload: return table.properties.append('neutron') assert ('density' in table.properties and 'mass' in table.properties), \ "Neutron table requires mass and density properties" # Defaults for missing neutron information missing = Neutron() Isotope.neutron = missing Element.neutron = missing for line in nsftable.split('\n'): columns = line.split(',') nsf = Neutron() p = columns[1] spin = columns[2] nsf.b_c, nsf.bp, nsf.bm = [fix_number(a) for a in columns[3:6]] nsf.is_energy_dependent = (columns[6] == 'E') nsf.coherent, nsf.incoherent, nsf.total, nsf.absorption \ = [fix_number(a) for a in columns[7:]] parts = columns[0].split('-') Z = int(parts[0]) symbol = parts[1] isotope_number = int(parts[2]) if len(parts) == 3 else 0 # Fetch element from the table and check that the symbol matches element = table[Z] assert element.symbol == symbol, \ "Symbol %s does not match %s" % (symbol, element.symbol) # Plug the default number density for the element into the nsf so # it can calculate sld. nsf._number_density = element.number_density # For new elements, clear out 'neutron' attribute for isotopes # This protects against isotope using the element data when # they don't have any specific neutron data. #if isotope_number == 0 or not hasattr(element,'neutron'): # for iso in element: iso.neutron = None if isotope_number == 0: # Bulk values using laboratory abundances of isotopes element.neutron = nsf else: # Values for the individual isotope isotope = element.add_isotope(isotope_number) isotope.neutron = nsf isotope.nuclear_spin = spin # p column contains either abundance(uncertainty) or "half-life Y" isotope.neutron.abundance = fix_number(p) if ' ' not in p else 0 # If the element is not yet initialized, copy info into the atom. # This serves to set the element info for elements with only # one isotope. if element.neutron is missing: element.neutron = nsf for line in nsftableI.split('\n'): columns = line.split(',') # Fetch the nsf record parts = columns[0].split('-') Z = int(parts[0]) symbol = parts[1] isotope_number = int(parts[2]) if len(parts) == 3 else 0 element = table[Z] if isotope_number == 0: nsf = element.neutron else: nsf = element[isotope_number].neutron # Read imaginary values nsf.b_c_i, nsf.bp_i, nsf.bm_i = [fix_number(a) for a in columns[1:]] # Xe total cross section is missing from the table # put it in even though it has not been independently measured if table.Xe.neutron.total is None: table.Xe.neutron.total = table.Xe.neutron.coherent + table.Xe.neutron.incoherent # Note: docs and function prototype are reproduced in __init__ @require_keywords def neutron_scattering(compound, density=None, wavelength=ABSORPTION_WAVELENGTH, energy=None, natural_density=None): r""" Computes neutron scattering cross sections for molecules. :Parameters: *compound* : Formula initializer Chemical formula *density* : float | |g/cm^3| Mass density *natural_density* : float | |g/cm^3| Mass density of formula with naturally occuring abundances *wavelength* 1.798 : float | |Ang| Neutron wavelength. *energy* : float | meV Neutron energy. If energy is specified then wavelength is ignored. :Returns: *sld* : (float, float, float) | |1e-6/Ang^2| (*real*, -*imaginary*, *incoherent*) scattering length density. *xs* : (float, float, float) | |1/cm| (*coherent*, *absorption*, *incoherent*) cross sections. *penetration* : float | cm 1/e penetration depth of the beam :Raises: *AssertionError* : density is missing. .. Note: Values may not correct if any element or isotope has *is_energy_dependent=True* The coherent and incoherent cross sections are calculated from the bound scattering lengths for nuclei. The actual cross sections depend on the incoming neutron energy and sample temperature, especially for light elements. For low energy neutrons (cold neutrons), the tabulated cross sections are generally a lower limit. The measured incoherent scattering from hydrogen, for example, can be considerably larger (by more than 20%) than its bound value. For example, the incoherent scattering cross section of H2O is 5.621/cm as computed from these tables compared to ~7.0/cm as measured with 5 meV neutrons at 290K. [#May1982]_ The scattering factor tables are not self consistent. The following functions show discrepencies between the various measurements of the scattering potential: :func:`absorption_comparison_table` :func:`coherent_comparison_table` :func:`total_comparison_table` To compute the neutron cross sections we first need to average quantities for the unit cell of the molecule. Molar mass *m* (g/mol) is the sum of the masses of each component: .. math:: m = \sum{n_i m_i}\ {\rm for\ each\ atom}\ i=1,2,\ldots Cell volume $V$ (|Ang^3|/molecule) is molar mass $m$ over density $rho$, with a correction based on Avogadro's number $N_A$ (atoms/mol) and the length conversion $10^8$ |Ang|/cm: .. math:: V = m/\rho \cdot 1/N_A \cdot (10^8)^3 Number density $N$ is the number of scatterers per unit volume: .. math:: N = \left.\sum{n_i} \right/ V Coherent scattering cross section $\sigma_c$ of the molecule is computed from the average scattering length of its constituent atoms, weighted by their frequency. .. math:: b_c = \left.\sum n_i b_c \right/ \sum n_i This is converted to a scattering cross section and scaled by 1 barn = 100 |fm^2|: .. math:: \sigma_c = \left. 4 \pi b_c^2 \right/ 100 Similarly, the absorption cross section $\sigma_a$, the incoherent cross section $\sigma_i$, and the total cross section $\sigma_s$ can be computed from the corresponding cross sections of the constituent elements,\ [#Sears1999]_ already expressed in barns: .. math:: \sigma_a &= \left. \sum n_j \sigma_{aj} \right/ \sum n_j \\ \sigma_i &= \left. \sum n_j \sigma_{ij} \right/ \sum n_j \\ \sigma_s &= \left. \sum n_j \sigma_{sj} \right/ \sum n_j The neutron cross sections are tabulated at wavelength 1.798 |Ang|. In the thermal neutron energy range most absorption cross sections scale linearly with wavelength,\ [#Lynn1990]_ and can be adjusted with a simple multiplication: .. math:: \sigma_a = \sigma_a \lambda / \lambda_o = \sigma_a \lambda / 1.798 If *isotope.neutron.is_energy_dependent()* is true for any part of the material, then this relation may not hold, and the returned values are only valid for 1.798 |Ang|. From the scattering cross sections, the scattering length for a material $b = b' - i b''$ can be computed using the following relations:[#Sears1999]_ .. math:: \sigma_c &= 4 \pi |b_c|^2 \\ \sigma_a &= \left. 4 \pi \left< b'' \right> \right/k \ {\rm for} \ k=2\pi / \lambda \\ \sigma_i &= 4 \pi |b_i|^2 \\ \sigma_s &= 4 \pi \left< |b|^2 \right> Transforming we get: .. math:: b'' &= \left. \sigma_a \right/ (2 \lambda) \\ b_i &= \sqrt{ \sigma_i / (4 \pi) } The incoherent scattering length $b_i$ can be treated primarily as an absorption length in large scale structure calculations, with the complex scattering length approximated by $b = b_c - i (b'' + b_i)$. The scattering potential is often expressed as a scattering length density (SLD). This is just the number density of the scatterers times their scattering lengths, with a correction for units. .. math:: \rho_{\rm re} &= 10 N b_c \\ \rho_{\rm im} &= -N b'' / 100 \\ \rho_{\rm inc} &= 10 N b_i with the factors of 10 chosen to give SLD in units of $\AA^{-2}$. The resulting $\rho = \rho_{\rm re} + i \rho_{\rm im}$ can be used in the scattering equations. Treatment of the incoherent scattering $\rho_{\rm inc}$ will depend on the equation. For example, it can be treated as an absorption in specular reflectivity calculations since the incoherently scattered neutrons are removed from the multilayer recurrence calculation. Similarly, scattering cross section includes number density: .. math:: \Sigma_{\rm coh} &= N \sigma_c \\ \Sigma_{\rm inc} &= N \sigma_i \\ \Sigma_{\rm abs} &= N \sigma_a \\ \Sigma_{\rm s} &= N \sigma_s The 1/e penetration depth *t_u* represents the the depth into the sample at which the unscattered intensity is reduced by a factor of $e$: .. math:: t_u = \left. 1 \right/ (\Sigma_{\rm s} + \Sigma_{\rm abs}) Note that the calculated penetration depth includes the effects of both absorption and incoherent scattering (which spreads the beam in the full $4\pi$ spherical surface, and so it looks like absorption with respect to the beam), as well as the coherent scattering from the sample. If you instead want to calculate the effective shielding of the sample, you should recalculate penetration depth without the coherent scattering. Transmission rate can be computed from $e^{-d/t_u}$ for penetration i depth $t_u$ and sample thickness $d$. In general, the total scattering cross section is not the sum of the coherent and incoherent cross sections, $\Sigma_{\rm s} \ne \Sigma_{\rm coh}+\Sigma_{\rm inc}$.\ [#Glinka2011]_ Instead, we compute $\Sigma_{\rm inc} = \Sigma_{\rm s} - \Sigma_{\rm coh}$ in accordance with Sect. 4.4.4 of the Internation Tables for Crystallography Volume C. Including unit conversion with $\mu=10^{-6}$ the full scattering equations are: .. math:: \rho_{\rm re}\,(\mu/\AA^2) &= (N/\AA^3) \, (b_c\,{\rm fm}) \, (10^{-5} \AA/{\rm\,fm}) \, (10^6\,\mu) \\ \rho_{\rm im}\,(\mu/\AA^2) &= (N/\AA^3) \, (\sigma_a\,{\rm barn}) \, (10^{-8}\,\AA^2/{\rm barn}) / (2 \lambda\, \AA) \, (10^6\,\mu) \\ \rho_{\rm inc}\,(\mu/\AA^2) &= (N/\AA^3) \, \sqrt{(\sigma_i\, {\rm barn})/(4 \pi) \, (100\, {\rm fm}^2/{\rm barn})} \, (10^{-5}\, \AA/{\rm fm}) \, (10^6\, \mu) \\ \Sigma_{\rm coh}\,(1/{\rm cm}) &= (N/\AA^3) \, (\sigma_c\, {\rm barn}) \, (10^{-8}\, \AA^2/{\rm barn}) \, (10^8\, \AA/{\rm cm}) \\ \Sigma_{\rm inc}\,(1/{\rm cm}) &= (N/\AA^3) \,(\sigma_i\, {\rm barn}) \, (10^{-8}\, \AA^2/{\rm barn}) \, (10^8\, \AA/{\rm cm}) \\ \Sigma_{\rm abs}\,(1/{\rm cm}) &= (N/\AA^3) \,(\sigma_a\,{\rm barn}) \, (10^{-8}\, \AA^2/{\rm barn}) \, (10^8\, \AA/{\rm cm}) \\ \Sigma_{\rm s}\,(1/{\rm cm}) &= (N/\AA^3) \,(\sigma_s\,{\rm barn}) \, (10^{-8}\, \AA^2/{\rm barn}) \, (10^8\, \AA/{\rm cm}) \\ t_u\,({\rm cm}) &= 1/(\Sigma_{\rm s}\, 1/{\rm cm} \,+\, \Sigma_{\rm abs}\, 1/{\rm cm}) """ from . import formulas compound = formulas.formula(compound, density=density, natural_density=natural_density) assert compound.density is not None, "scattering calculation needs density" if energy is not None: wavelength = neutron_wavelength(energy) assert wavelength is not None, "scattering calculation needs energy or wavelength" # Sum over the quantities molar_mass = num_atoms = 0 sigma_s = sigma_a = b_c = 0 is_energy_dependent = False for element, quantity in compound.atoms.items(): if not element.neutron.has_sld(): return None, None, None #print element,quantity,element.neutron.b_c,element.neutron.absorption,element.neutron.total molar_mass += element.mass*quantity num_atoms += quantity sigma_a += quantity * element.neutron.absorption sigma_s += quantity * element.neutron.total b_c += quantity * element.neutron.b_c is_energy_dependent |= element.neutron.is_energy_dependent # If nothing to sum, return values for a vacuum. This might be because # the material has no atoms or it might be because the density is zero. if molar_mass*compound.density == 0: return (0, 0, 0), (0, 0, 0), inf # Turn sums into scattering factors b_c /= num_atoms sigma_s /= num_atoms sigma_a *= wavelength/ABSORPTION_WAVELENGTH/num_atoms # Compute number density cell_volume = (molar_mass/compound.density)/avogadro_number*1e24 # (10^8 A/cm)^3 number_density = num_atoms / cell_volume # PAK 2017-04-21: compute incoherent cross section from total cross section sigma_c = 4*pi/100 * b_c**2 # = 4 pi |b_c/10|^2 sigma_i = max(sigma_s - sigma_c, 0.0) # Compute SLD sld_re = number_density * b_c * 10 sld_im = number_density * sigma_a / (2 * wavelength) * 0.01 sld_inc = number_density * sqrt(sigma_i / (4*pi/100)) * 10 # Compute scattering cross section per unit volume total_xs = number_density * sigma_s coh_xs = number_density * sigma_c abs_xs = number_density * sigma_a inc_xs = number_density * sigma_i # Compute 1/e length penetration = 1/(abs_xs + total_xs) return (sld_re, sld_im, sld_inc), (coh_xs, abs_xs, inc_xs), penetration def neutron_sld(*args, **kw): """ Computes neutron scattering length densities for molecules. :Parameters: *compound* : Formula initializer Chemical formula *density* : float | |g/cm^3| Mass density *natural_density* : float | |g/cm^3| Mass density of formula with naturally occuring abundances *wavelength* : float | |Ang| Neutron wavelength. *energy* : float | meV Neutron energy. If energy is specified then wavelength is ignored. :Returns: *sld* : (float, float, float) | |1e-6/Ang^2| (*real*, -*imaginary*, *incoherent*) scattering length density. :Raises: *AssertionError* : density is missing. Returns the scattering length density of the compound. See :func:`neutron_scattering` for details. """ return neutron_scattering(*args, **kw)[0] def neutron_sld_from_atoms(*args, **kw): r""" .. deprecated:: 0.91 :func:`neutron_sld` now accepts dictionaries of \{atom\: count\} directly. """ return neutron_scattering(*args, **kw)[0] def _sum_piece(wavelength, compound): """ Helper for neutron_composite_sld which precomputes quantities of interest for material fragments in a composite formula. """ # Sum over the quantities molar_mass = num_atoms = 0 sigma_a = sigma_s = b_c = 0 is_energy_dependent = False for element, quantity in compound.atoms.items(): #print element,quantity,element.neutron.b_c,element.neutron.absorption,element.neutron.total molar_mass += element.mass*quantity num_atoms += quantity sigma_a += quantity * element.neutron.absorption sigma_s += quantity * element.neutron.total b_c += quantity * element.neutron.b_c is_energy_dependent |= element.neutron.is_energy_dependent return num_atoms, molar_mass, b_c, sigma_s, sigma_a def neutron_composite_sld(materials, wavelength=ABSORPTION_WAVELENGTH): """ Create a composite SLD calculator. :Parameters: *materials* : [Formula] List of materials *wavelength* = 1.798: float OR [float] | |Ang| Probe wavelength(s). :Returns: *calculator* : f(w, density=1) -> (*real*, -*imaginary*, *incoherent*) The composite calculator takes a vector of weights and returns the scattering length density of the composite. This is useful for operations on large molecules, such as calculating a set of contrasts or fitting a material composition. Table lookups and partial sums and constants are precomputed so that the calculation consists of a few simple array operations regardless of the size of the material fragments. """ parts = [_sum_piece(wavelength, m) for m in materials] V = [numpy.array(v) for v in zip(*parts)] num_atoms_parts, molar_mass_parts, b_c_parts, sigma_s_parts, sigma_a_parts = V def _compute(weights, density=1): # Sum over the quantities molar_mass = numpy.sum(weights*molar_mass_parts) num_atoms = numpy.sum(weights*num_atoms_parts) sigma_a = numpy.sum(weights*sigma_a_parts) sigma_s = numpy.sum(weights*sigma_s_parts) b_c = numpy.sum(weights*b_c_parts) # If nothing to sum, return values for a vacuum. This might be because # the material has no atoms or it might be because the density is zero. if molar_mass*density == 0: return 0, 0, 0 # Turn sums into scattering factors b_c /= num_atoms sigma_a *= wavelength/ABSORPTION_WAVELENGTH/num_atoms # at tabulated wavelength sigma_s /= num_atoms # Compute number density cell_volume = (molar_mass/density)/avogadro_number*1e24 number_density = num_atoms / cell_volume # PAK 2017-04-21: compute incoherent cross section from total cross section sigma_c = 4*pi/100 * b_c**2 sigma_i = max(sigma_s - sigma_c, 0.0) # Compute SLD sld_re = number_density * b_c * 10 sld_im = number_density * sigma_a / (2 * wavelength) * 0.01 sld_inc = number_density * sqrt(sigma_i / (4*pi/100)) * 10 return sld_re, sld_im, sld_inc return _compute def sld_plot(table=None): """ Plots SLD as a function of element number. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. :Returns: None """ from .plot import table_plot table = default_table(table) SLDs = dict((el, el.neutron.sld()[0]) for el in table if el.neutron.has_sld()) SLDs[table.D] = table.D.neutron.sld()[0] table_plot(SLDs, label='Scattering length density ($10^{-6}$ Nb)', title='Neutron SLD for elements in natural abundance') # We are including the complete original table here in case somebody in # future wants to extract uncertainties or other information. # # Z-Symbol-A # This is the atomic number, the symbol and the isotope. # If Z-Symbol only, the line represents an element with scattering determined # by the natural abundance of the isotopes in laboratory samples. If there # is only one isotope, then there is no corresponding element definition. # concentration/half-life # This is the natural abundance of the isotope expressed as a percentage, or # it is the half-life in years (number Y) or seconds (number S). # spin I # For isotopes, the nuclear spin. # b_c, bp, bm # Bound coherent scattering length in fm # b+/b- if present are spin dependent scattering for I+1/2 and I-1/2 # respectively # c # 'E' if there is a strong energy dependency. # '+/-' if separate b+/b- values are available [doesn't seem true -PAK] # coherent, incoherent, total # The coherent and incoherent scattering cross-sections in barns. # absorption # The thermal absorption cross section in barns at 1.798 Angstroms/25.30 meV. # # Numbers in parenthesis represents uncertainty. # Numbers followed by '*' are estimated. # Numbers may be given as limit, e.g., <1.0e-6 # # Formatting corrections by Paul Kienzle nsftable = """\ 0-n-1,618 S,1/2,-37.0(6),0,-37.0(6),,43.01(2),,43.01(2),0 1-H,,,-3.7409(11),,,,1.7568(10),80.26(6),82.02(6),0.3326(7) 1-H-1,99.985,1/2,-3.7423(12),10.817(5),-47.420(14),+/-,1.7583(10),80.27(6),82.03(6),0.3326(7) 1-H-2,0.0149,1,6.674(6),9.53(3),0.975(60),,5.592(7),2.05(3),7.64(3),0.000519(7) 1-H-3,12.26 Y,1/2,4.792(27),4.18(15),6.56(37),,2.89(3),0.14(4),3.03(5),<6.0E-6 2-He,,,3.26(3),,,,1.34(2),0,1.34(2),0.00747(1) 2-He-3,0.013,1/2,5.74(7),4.7(5),8.8(1.4),E,4.42(10),1.6(4),6.0(4),5333.0(7.0) 2-He-4,99.987,0,3.26(3),,,,1.34(2),0,1.34(2),0 3-Li,,,-1.90(3),,,,0.454(10),0.92(3),1.37(3),70.5(3) 3-Li-6,7.5,1,2.0(1),0.67(14),4.67(17),+/-,0.51(5),0.46(5),0.97(7),940.0(4.0) 3-Li-7,92.5,3/2,-2.22(2),-4.15(6),1.00(8),+/-,0.619(11),0.78(3),1.40(3),0.0454(3) 4-Be-9,100,3/2,7.79(1),,,,7.63(2),0.0018(9),7.63(2),0.0076(8) 5-B,,,5.30(4),,,,3.54(5),1.70(12),5.24(11),767.0(8.0) 5-B-10,19.4,3,-0.2(4),-4.2(4),5.2(4),,0.144(6),3.0(4),3.1(4),3835.0(9.0) 5-B-11,80.2,3/2,6.65(4),5.6(3),8.3(3),,5.56(7),0.21(7),5.77(10),0.0055(33) 6-C,,,6.6484(13),,,,5.551(2),0.001(4),5.551(3),0.00350(7) 6-C-12,98.89,0,6.6535(14),,,,5.559(3),0,5.559(3),0.00353(7) 6-C-13,1.11,1/2,6.19(9),5.6(5),6.2(5),+/-,4.81(14),0.034(11),4.84(14),0.00137(4) 7-N,,,9.36(2),,,,11.01(5),0.50(12),11.51(11),1.90(3) 7-N-14,99.635,1,9.37(2),10.7(2),6.2(3),,11.03(5),0.50(12),11.53(11),1.91(3) 7-N-15,0.365,1/2,6.44(3),6.77(10),6.21(10),,5.21(5),0.00005(10),5.21(5),0.000024(8) 8-O,,,5.805(4),,,,4.232(6),0.000(8),4.232(6),0.00019(2) 8-O-16,99.75,0,5.805(5),,,,4.232(6),0,4.232(6),0.00010(2) 8-O-17,0.039,5/2,5.6(5),5.52(20),5.17(20),,4.20(22),0.004(3),4.20(22),0.236(10) 8-O-18,0.208,0,5.84(7),,,,4.29(10),0,4.29(10),0.00016(1) 9-F-19,100,1/2,5.654(12),5.632(10),5.767(10),+/-,4.017(14),0.0008(2),4.018(14),0.0096(5) 10-Ne,,,4.566(6),,,,2.620(7),0.008(9),2.628(6),0.039(4) 10-Ne-20,90.5,0,4.631(6),,,,2.695(7),0,2.695(7),0.036(4) 10-Ne-21,0.27,3/2,6.66(19),,,,5.6(3),0.05(2),5.7(3),0.67(11) 10-Ne-22,9.2,0,3.87(1),,,,1.88(1),0,1.88(1),0.046(6) 11-Na-23,100,3/2,3.63(2),6.42(4),-1.00(6),+/-,1.66(2),1.62(3),3.28(4),0.530(5) 12-Mg,,,5.375(4),,,,3.631(5),0.08(6),3.71(4),0.063(3) 12-Mg-24,78.99,0,5.49(18),,,,4.03(4),0,4.03(4),0.050(5) 12-Mg-25,10,5/2,3.62(14),4.73(30),1.76(20),+/-,1.65(13),0.28(4),1.93(14),0.19(3) 12-Mg-26,11,0,4.89(15),,,,3.00(18),0,3.00(18),0.0382(8) 13-Al-27,100,5/2,3.449(5),3.67(2),3.15(2),,1.495(4),0.0082(6),1.503(4),0.231(3) 14-Si,,,4.15071(22),,,,2.1633(10),0.004(8),2.167(8),0.171(3) 14-Si-28,92.2,0,4.106(6),,,,2.120(6),0,2.120(6),0.177(3) 14-Si-29,4.7,1/2,4.7(1),4.50(15),4.7(4),+/-,2.78(12),0.001(2),2.78(12),0.101(14) 14-Si-30,3.1,0,4.58(8),,,,2.64(9),0,2.64(9),0.107(2) 15-P-31,100,1/2,5.13(1),,,+/-,3.307(13),0.005(10),3.312(16),0.172(6) 16-S,,,2.847(1),,,,1.0186(7),0.007(5),1.026(5),0.53(1) 16-S-32,95,0,2.804(2),,,,0.9880(14),0,0.9880(14),0.54(4) 16-S-33,0.74,3/2,4.74(19),,,+/-,2.8(2),0.3(6),3.1(6),0.54(4) 16-S-34,4.2,0,3.48(3),,,,1.52(3),0,1.52(3),0.227(5) 16-S-36,0.02,0,3.0(1.0)*,,,,1.1(8),0,1.1(8),0.15(3) 17-Cl,,,9.5792(8),,,,11.528(2),5.3(5),16.8(5),33.5(3) 17-Cl-35,75.77,3/2,11.70(9),16.3(2),4.0(3),+/-,17.06(6),4.7(6),21.8(6),44.1(4) 17-Cl-37,24.23,3/2,3.08(6),3.10(7),3.05(7),+/-,1.19(5),0.001(3),1.19(5),0.433(6) 18-Ar,,,1.909(6),,,,0.458(3),0.225(5),0.683(4),0.675(9) 18-Ar-36,0.34,0,24.9(7),,,,77.9(4),0,77.9(4),5.2(5) 18-Ar-38,0.07,0,3.5(3.5),,,,1.5(3.1),0,1.5(3.1),0.8(5) 18-Ar-40,99.59,0,1.7,,,,0.421(3),0,0.421(3),0.660(9) 19-K,,,3.67(2),,,,1.69(2),0.27(11),1.96(11),2.1(1) 19-K-39,93.3,3/2,3.79(2),5.15,1.51,+/-,1.76(2),0.25(11),2.01(11),2.1(1) 19-K-40,0.012,4,3.1(1.0)*,,,,1.1(6),0.5(5)*,1.6(9),35.0(8.0) 19-K-41,6.7,3/2,2.69(8),,,,0.91(5),0.3(6),1.2(6),1.46(3) 20-Ca,,,4.70(2),,,,2.78(2),0.05(3),2.83(2),0.43(2) 20-Ca-40,96.94,0,4.78(5),,,,2.90(2),0,2.90(2),0.41(2) 20-Ca-42,0.64,0,3.36(10),,,,1.42(8),0,1.42(8),0.68(7) 20-Ca-43,0.13,7/2,-1.56(9),,,,0.31(4),0.5(5),0.8(5),6.2(6) 20-Ca-44,2.13,0,1.42(6),,,,0.25(2),0,0.25(2),0.88(5) 20-Ca-46,0.003,0,3.55(21),,,,1.6(2),0,1.6(2),0.74(7) 20-Ca-48,0.18,0,0.39(9),,,,0.019(9),0,0.019(9),1.09(14) 21-Sc-45,100,7/2,12.1(1),6.91(22),18.99(28),+/-,19.0(3),4.5(3),23.5(6),27.5(2) 22-Ti,,,-3.370(13),,,,1.485(2),2.87(3),4.35(3),6.09(13) 22-Ti-46,8,0,4.72(5),,,,3.05(7),0,3.05(7),0.59(18) 22-Ti-47,7.5,5/2,3.53(7),0.46(23),7.64(13),,1.66(11),1.5(2),3.2(2),1.7(2) 22-Ti-48,73.7,0,-5.86(2),,,,4.65(3),0,4.65(3),7.84(25) 22-Ti-49,5.5,7/2,0.98(5),2.6(3),-1.2(4),,0.14(1),3.3(3),3.4(3),2.2(3) 22-Ti-50,5.3,0,5.88(10),,,,4.80(12),0,4.80(12),0.179(3) 23-V,,,-0.443(14),,,,0.01838(12),5.08(6),5.10(6),5.08(4) 23-V-50,0.25,6,7.6(6)*,,,,7.3(1.1),0.5(5)*,7.8(1.0),60.0(40.0) 23-V-51,99.75,7/2,-0.402(2),4.93(25),-7.58(28),+/-,0.0203(2),5.07(6),5.09(6),4.9(1) 24-Cr,,,3.635(7),,,,1.660(6),1.83(2),3.49(2),3.05(6) 24-Cr-50,4.35,0,-4.50(5),,,,2.54(6),0,2.54(6),15.8(2) 24-Cr-52,83.8,0,4.914(15),,,,3.042(12),0,3.042(12),0.76(6) 24-Cr-53,9.59,3/2,-4.20(3),1.16(10),-13.0(2),,2.22(3),5.93(17),8.15(17),18.1(1.5) 24-Cr-54,2.36,0,4.55(10),,,,2.60(11),0,2.60(11),0.36(4) 25-Mn-55,100,5/2,-3.750(18),-4.93(46),-1.46(33),,1.75(2),0.40(2),2.15(3),13.3(2) 26-Fe,,,9.45(2),,,,11.22(5),0.40(11),11.62(10),2.56(3) 26-Fe-54,5.8,0,4.2(1),,,,2.2(1),0,2.2(1),2.25(18) 26-Fe-56,91.7,0,10.1(2),,,,12.42(7),0,12.42(7),2.59(14) 26-Fe-57,2.19,1/2,2.3(1),,,,0.66(6),0.3(3)*,1.0(3),2.48(30) 26-Fe-58,0.28,0,15(7),,,,28.0(26.0),0,28.0(26.0),1.28(5) 27-Co-59,100,7/2,2.49(2),-9.21(10),3.58(10),+/-,0.779(13),4.8(3),5.6(3),37.18(6) 28-Ni,,,10.3(1),,,,13.3(3),5.2(4),18.5(3),4.49(16) 28-Ni-58,67.88,0,14.4(1),,,,26.1(4),0,26.1(4),4.6(3) 28-Ni-60,26.23,0,2.8(1),,,,0.99(7),0,0.99(7),2.9(2) 28-Ni-61,1.19,3/2,7.60(6),,,,7.26(11),1.9(3),9.2(3),2.5(8) 28-Ni-62,3.66,0,-8.7(2),,,,9.5(4),0,9.5(4),14.5(3) 28-Ni-64,1.08,0,-0.37(7),,,,0.017(7),0,0.017(7),1.52(3) 29-Cu,,,7.718(4),,,,7.485(8),0.55(3),8.03(3),3.78(2) 29-Cu-63,69.1,3/2,6.477(13),,,+/-,5.2(2),0.006(1),5.2(2),4.50(2) 29-Cu-65,30.9,3/2,10.204(20),,,+/-,14.1(5),0.40(4),14.5(5),2.17(3) 30-Zn,,,5.680(5),,,,4.054(7),0.077(7),4.131(10),1.11(2) 30-Zn-64,48.9,0,5.23(4),,,,3.42(5),0,3.42(5),0.93(9) 30-Zn-66,27.8,0,5.98(5),,,,4.48(8),0,4.48(8),0.62(6) 30-Zn-67,4.1,5/2,7.58(8),5.8(5),10.1(7),+/-,7.18(15),0.28(3),7.46(15),6.8(8) 30-Zn-68,18.6,0,6.04(3),,,,4.57(5),0,4.57(5),1.1(1) 30-Zn-70,0.62,0,6.9(1.0)*,,,,4.5(1.5),0,4.5(1.5),0.092(5) 31-Ga,,,7.288(2),,,,6.675(4),0.16(3),6.83(3),2.75(3) 31-Ga-69,60,3/2,8.043(16),6.3(2),10.5(4),+/-,7.80(4),0.091(11),7.89(4),2.18(5) 31-Ga-71,40,3/2,6.170(11),5.5(6),7.8(1),+/-,5.15(5),0.084(8),5.23(5),3.61(10) 32-Ge,,,8.185(20),,,,8.42(4),0.18(7),8.60(6),2.20(4) 32-Ge-70,20.7,0,10.0(1),,,,12.6(3),0,12.6(3),3.0(2) 32-Ge-72,27.5,0,8.51(10),,,,9.1(2),0,9.1(2),0.8(2) 32-Ge-73,7.7,9/2,5.02(4),8.1(4),1.2(4),,3.17(5),1.5(3),4.7(3),15.1(4) 32-Ge-74,36.4,0,7.58(10),,,,7.2(2),0,7.2(2),0.4(2) 32-Ge-76,7.7,0,8.2(1.5),,,,8.0(3.0),0,8.0(3.0),0.16(2) 33-As-75,100,3/2,6.58(1),6.04(5),7.47(8),+/-,5.44(2),0.060(10),5.50(2),4.5(1) 34-Se,,,7.970(9),,,,7.98(2),0.32(6),8.30(6),11.7(2) 34-Se-74,0.9,0,0.8(3.0),,,,0.1(6),0,0.1(6),51.8(1.2) 34-Se-76,9,0,12.2(1),,,,18.7(3),0,18.7(3),85.0(7.0) 34-Se-77,7.5,0,8.25(8),,,,8.6(2),0.05(25),8.65(16),42.0(4.0) 34-Se-78,23.5,0,8.24(9),,,,8.5(2),0,8.5(2),0.43(2) 34-Se-80,50,0,7.48(3),,,,7.03(6),0,7.03(6),0.61(5) 34-Se-82,8.84,0,6.34(8),,,,5.05(13),0,5.05(13),0.044(3) 35-Br,,,6.79(2),,,,5.80(3),0.10(9),5.90(9),6.9(2) 35-Br-79,50.49,3/2,6.79(7),,,+/-,5.81(2),0.15(6),5.96(13),11.0(7) 35-Br-81,49.31,3/2,6.78(7),,,+/-,5.79(12),0.05(2),5.84(12),2.7(2) 36-Kr,,,7.81(2),,,,7.67(4),0.01(14),7.68(13),25.0(1.0) 36-Kr-78,0.35,0,,,,,,0,,6.4(9) 36-Kr-80,2.5,0,,,,,,0,,11.8(5) 36-Kr-82,11.6,0,,,,,,0,,29.0(20.0) 36-Kr-83,11.5,9/2,,,,,,,,185.0(30.0) 36-Kr-84,57,0,,,,,,0,6.6,0.113(15) 36-Kr-86,17.3,0,8.07(26),,,,8.2(4),0,8.2(4),0.003(2) 37-Rb,,,7.08(2),,,,6.32(4),0.5(4),6.8(4),0.38(1) 37-Rb-85,72.17,5/2,7.07(10),,,,6.2(2),0.5(5)*,6.7(5),0.48(1) 37-Rb-87,27.83,3/2,7.27(12),,,,6.6(2),0.5(5)*,7.1(5),0.12(3) 38-Sr,,,7.02(2),,,,6.19(4),0.06(11),6.25(10),1.28(6) 38-Sr-84,0.56,0,5.0(2.0),,,,6.0(2.0),0,6.0(2.0),0.87(7) 38-Sr-86,9.9,0,5.68(5),,,,4.04(7),0,4.04(7),1.04(7) 38-Sr-87,7,9/2,7.41(7),,,,6.88(13),0.5(5)*,7.4(5),16.0(3.0) 38-Sr-88,82.6,0,7.16(6),,,,6.42(11),0,6.42(11),0.058(4) 39-Y-89,100,1/2,7.75(2),8.4(2),5.8(5),+/-,7.55(4),0.15(8),7.70(9),1.28(2) 40-Zr,,,7.16(3),,,,6.44(5),0.02(15),6.46(14),0.185(3) 40-Zr-90,51.48,0,6.5(1),,,,5.1(2),0,5.1(2),0.011(59 40-Zr-91,11.23,5/2,8.8(1),7.9(2),10.1(2),+/-,9.5(2),0.15(4),9.7(2),1.17(10) 40-Zr-92,17.11,0,7.5(2),,,,6.9(4),0,6.9(4),0.22(6) 40-Zr-94,17.4,0,8.3(2),,,,8.4(4),0,8.4(4),0.0499(24) 40-Zr-96,2.8,0,5.5(1),,,,3.8(1),0,3.8(1),0.0229(10) 41-Nb-93,100,9/2,7.054(3),7.06(4),7.35(4),+/-,6.253(5),0.0024(3),6.255(5),1.15(6) 42-Mo,,,6.715(20),,,,5.67(3),0.04(5),5.71(4),2.48(4) 42-Mo-92,15.48,0,6.93(8),,,,6.00(14),0,6.00(14),0.019(2) 42-Mo-94,9.1,0,6.82(7),,,,5.81(12),0,5.81(12),0.015(2) 42-Mo-95,15.72,5/2,6.93(7),,,,6.00(10),0.5(5)*,6.5(5),13.1(3) 42-Mo-96,16.53,0,6.22(6),,,,4.83(9),0,4.83(9),0.5(2) 42-Mo-97,9.5,5/2,7.26(8),,,,6.59(15),0.5(5)*,7.1(5),2.5(2) 42-Mo-98,23.78,0,6.60(7),,,,5.44(12),0,5.44(12),0.127(6) 42-Mo-100,9.6,0,6.75(7),,,,5.69(12),0,5.69(12),0.4(2) 43-Tc-99,210000 Y,9/2,6.8(3),,,,5.8(5),0.5(5)*,6.3(7),20.0(1.0) 44-Ru,,,7.02(2),,,,6.21(5),0.4(1),6.6(1),2.56(13) 44-Ru-96,5.8,0,,,,,,0,,0.28(2) 44-Ru-98,1.9,0,,,,,,0,,<8.0 44-Ru-99,12.7,5/2,,,,,,,,6.9(1.0) 44-Ru-100,12.6,0,,,,,,0,,4.8(6) 44-Ru-101,17.07,5/2,,,,,,,,3.3(9) 44-Ru-102,31.61,0,,,,,,0,,1.17(7) 44-Ru-104,18.58,0,,,,,,0,,0.31(2) 45-Rh-103,100,1/2,5.90(4),8.15(6),6.74(6),,4.34(6),0.3(3)*,4.6(3),144.8(7) 46-Pd,,,5.91(6),,,,4.39(9),0.093(9),4.48(9),6.9(4) 46-Pd-102,1,0,7.7(7)*,,,,7.5(1.4),0,7.5(1.4),3.4(3) 46-Pd-104,11,0,7.7(7)*,,,,7.5(1.4),0,7.5(1.4),0.6(3) 46-Pd-105,22.33,5/2,5.5(3),,,+/-,3.8(4),0.8(1.0),4.6(1.1),20.0(3.0) 46-Pd-106,27.33,0,6.4(4),,,,5.1(6),0,5.1(6),0.304(29) 46-Pd-108,26.71,0,4.1(3),,,,2.1(3),0,2.1(3),8.5(5) 46-Pd-110,11.8,0,7.7(7)*,,,,7.5(1.4),0,7.5(1.4),0.226(31) 47-Ag,,,5.922(7),,,,4.407(10),0.58(3),4.99(3),63.3(4) 47-Ag-107,51.8,1/2,7.555(11),8.14(9),5.8(3),+/-,7.17(2),0.13(3),7.30(4),37.6(1.2) 47-Ag-109,48.2,1/2,4.165(11),3.24(8),6.9(2),+/-,2.18(1),0.32(5),2.50(5),91.0(1.0) 48-Cd,,,4.83(5),,,E,3.04(6),3.46(13),6.50(12),2520.0(50.0) 48-Cd-106,1.2,0,5.0(2.0)*,,,,3.1(2.5),0,3.1(2.5),1.0(2.0) 48-Cd-108,0.9,0,5.31(24),,,,3.7(1),0,3.7(1),1.1(3) 48-Cd-110,12.39,0,5.78(8),,,,4.4(1),0,4.4(1),11.0(1.0) 48-Cd-111,12.75,1/2,6.47(8),,,,5.3(2),0.3(3)*,5.6(4),24.0(5.0) 48-Cd-112,24.07,0,6.34(6),,,,5.1(2),0,5.1(2),2.2(5) 48-Cd-113,12.36,1/2,-8.0(1),,,E,12.1(4),0.3(3)*,12.4(5),20600.0(400.0) 48-Cd-114,28.86,0,7.48(5),,,,7.1(2),0,7.1(2),0.34(2) 48-Cd-116,7.58,0,6.26(9),,,,5.0(2),0,5.0(2),0.075(13) 49-In,,,4.065(20),,,,2.08(2),0.54(11),2.62(11),193.8(1.5) 49-In-113,4.28,9/2,5.39(6),,,,3.65(8),0.000037(5),3.65(8),12.0(1.1) 49-In-115,95.72,9/2,4.00(3),2.1(1),6.4(4),,2.02(2),0.55(11),2.57(11),202.0(2.0) 50-Sn,,,6.225(2),,,,4.871(3),0.022(5),4.892(6),0.626(9) 50-Sn-112,1,0,6.0(1.0)*,,,,4.5(1.5),0,4.5(1.5),1.00(11) 50-Sn-114,0.66,0,6.0(3),,,,4.8(5),0,4.8(5),0.114(30) 50-Sn-115,0.35,1/2,6.0(1.0)*,,,,4.5(1.5),0.3(3)*,4.8(1.5),30.0(7.0) 50-Sn-116,14.3,0,6.10(1),,,,4.42(7),0,4.42(7),0.14(3) 50-Sn-117,7.61,1/2,6.59(8),0.22(10),-0.23(10),,5.28(8),0.3(3)*,5.6(3),2.3(5) 50-Sn-118,24.03,0,6.23(4),,,,4.63(8),0,4.63(8),0.22(5) 50-Sn-119,8.58,1/2,6.28(3),0.14(10),0.0(1),,4.71(8),0.3(3)*,5.0(3),2.2(5) 50-Sn-120,32.86,0,6.67(4),,,,5.29(8),0,5.29(8),0.14(3) 50-Sn-122,4.72,0,5.93(3),,,,4.14(7),0,4.14(7),0.18(2) 50-Sn-124,5.94,0,6.15(3),,,,4.48(8),0,4.48(8),0.133(5) 51-Sb,,,5.57(3),,,,3.90(4),0.00(7),3.90(6),4.91(5) 51-Sb-121,57.25,5/2,5.71(6),5.7(2),5.8(2),,4.10(9),0.0003(19),4.10(19),5.75(12) 51-Sb-123,42.75,7/2,5.38(7),5.2(2),5.4(2),,3.64(9),0.001(4),3.64(9),3.8(2) 52-Te,,,5.68(2),,,,4.23(4),0.09(6),4.32(5),4.7(1) 52-Te-120,0.09,0,5.3(5),,,,3.5(7),0,3.5(7),2.3(3) 52-Te-122,2.4,0,3.8(2),,,,1.8(2),0,1.8(2),3.4(5) 52-Te-123,0.87,1/2,-0.05(25),-1.2(2),3.5(2),,0.002(3),0.52(5),0.52(5),418.0(30.0) 52-Te-124,4.61,0,7.95(10),,,,8.0(2),0,8.0(2,6.8(1.3) 52-Te-125,6.99,1/2,5.01(8),4.9(2),5.5(2),,3.17(10),0.008(8),3.18(10),1.55(16) 52-Te-126,18.71,0,5.55(7),,,,3.88(10),0,3.88(10),1.04(15) 52-Te-128,31.79,0,5.88(8),,,,4.36(10),0,4.36(10),0.215(8) 52-Te-130,34.48,0,6.01(7),,,,4.55(11),0,4.55(11),0.29(6) 53-I-127,100,5/2,5.28(2),6.6(2),3.4(2),,3.50(3),0.31(6),3.81(7),6.15(6) 54-Xe,,,4.69(4),,,,3.04(4),0,,23.9(1.2) 54-Xe-124,0.1,0,,,,,,0,,165.0(20.0) 54-Xe-126,0.09,0,,,,,,0,,3.5(8) 54-Xe-128,1.9,0,,,,,,0,,<8.0 54-Xe-129,26.14,1/2,,,,,,,,21.0(5.0) 54-Xe-130,3.3,0,,,,,,0,,<26.0 54-Xe-131,21.18,3/2,,,,,,,,85.0(10.0) 54-Xe-132,26.89,0,,,,,,0,,0.45(6) 54-Xe-134,10.4,0,,,,,,0,,0.265(20) 54-Xe-136,8.9,0,,,,,,0,,0.26(2) 55-Cs-133,100,7/2,5.42(2),,,+/-,3.69(15),0.21(5),3.90(6),29.0(1.5) 56-Ba,,,5.07(3),,,,3.23(4),0.15(11),3.38(10),1.1(1) 56-Ba-130,0.1,0,-3.6(6),,,,1.6(5),0,1.6(5),30.0(5.0) 56-Ba-132,0.09,0,7.8(3),,,,7.6(6),0,7.6(6),7.0(8) 56-Ba-134,2.4,0,5.7(1),,,,4.08(14),0,4.08(14),2.0(1.6) 56-Ba-135,6.59,3/2,4.66(10),,,,2.74(12),0.5(5)*,3.2(5),5.8(9) 56-Ba-136,7.81,0,4.90(8),,,,3.03(10),0,3.03(10),0.68(17) 56-Ba-137,11.32,3/2,6.82(10),,,,5.86(17),0.5(5)*,6.4(5),3.6(2) 56-Ba-138,71.66,0,4.83(8),,,,2.94(10),0,2.94(19),0.27(14) 57-La,,,8.24(4),,,,8.53(8),1.13(19),9.66(17),8.97(2) 57-La-138,0.09,5,8.0(2.0)*,,,,8.0(4.0),0.5(5)*,8.5(4.0),57.0(6.0) 57-La-139,99.91,7/2,8.24(4),11.4(3),4.5(4),+/-,8.53(8),1.13(15),9.66(17),8.93(4) 58-Ce,,,4.84(2),,,,2.94(2),0.00(10),2.94(10),0.63(4) 58-Ce-136,0.19,0,5.76(9),,,,4.23(13),0,4.23(13),7.3(1.5) 58-Ce-138,0.26,0,6.65(9),,,,5.64(15),0,5.64(15),1.1(3) 58-Ce-140,88.48,0,4.81(9),,,,2.94(11),0,2.94(11),0.57(4) 58-Ce-142,11.07,0,4.72(9),,,,2.84(11),0,2.84(11),0.95(5) 59-Pr-141,100,5/2,4.58(5),,,+/-,2.64(6),0.015(3),2.66(6),11.5(3) 60-Nd,,,7.69(5),,,,7.43(19),9.2(8),16.6(8),50.5(1.2) 60-Nd-142,27.11,0,7.7(3),,,,7.5(6),0,7.5(6),18.7(7) 60-Nd-143,12.17,7/2,14.0(2.0)*,,,,25.0(7.0),55.0(7.0),80.0(2.0),337.0(10.0) 60-Nd-144,23.85,0,2.8(3),,,,1.0(2),0,1.0(2),3.6(3) 60-Nd-145,8.5,7/2,14.0(2.0)*,,,,25.0(7.0),5.0(5.0)*,30.0(9.0),42.0(2.0) 60-Nd-146,17.22,0,8.7(2),,,,9.5(4),0,9.5(4),1.4(1) 60-Nd-148,5.7,0,5.7(3),,,,4.1(4),0,4.1(4),2.5(2) 60-Nd-150,5.6,0,5.28(20),,,,3.5(3),0,3.5(3),1.2(2) 61-Pm-147,2.62 Y,7/2,12.6(4),,,,20.0(1.3),1.3(2.0),21.3(1.5),168.4(3.5) 62-Sm,,,0.00(5),,,E,0.422(9),39.0(3.0),39.4(3.0),5922.0(56.0) 62-Sm-144,3.1,0,-3.0(4.0)*,,,,1.0(3.0),0,1.0(3.0),0.7(3) 62-Sm-147,15,7/2,14.0(3.0),,,,25.0(11.0),14.0(19.0.),39.0(16.0),57.0(3.0) 62-Sm-148,11.2,0,-3.0(4.0)*,,,,1.0(3.0),0,1.0(3.0),2.4(6) 62-Sm-149,13.8,7/2,18.7(28),,,E,63.5(6),137.0(5.0),200.0(5.0),42080.0(400.0) 62-Sm-150,7.4,0,14.0(3.0),,,,25.0(11.0),0,25.0(11.0),104.0(4.0) 62-Sm-152,26.7,0,-5.0(6),,,,3.1(8),0,3.1(8),206.0(6.0) 62-Sm-154,22.8,0,8.0(1.0),,,,11.0(2.0),0,11.0(2.0),8.4(5) 63-Eu,,,5.3(3),,,E,6.57(4),2.5(4),9.2(4),4530.0(40.0) 63-Eu-151,47.8,5/2,,,,E,5.5(2),3.1(4),8.6(4),9100.0(100.0) 63-Eu-153,52.8,5/2,8.22(12),,,,8.5(2),1.3(7),9.8(7),312.0(7.0) 64-Gd,,,9.5(2),,,E,29.3(8),151.0(2.0),180.0(2.0),49700.0(125.0) 64-Gd-152,0.2,0,10.0(3.0)*,,,,13.0(8.0),0,13.0(8.0),735.0(20.0) 64-Gd-154,2.2,0,10.0(3.0)*,,,,13.0(8.0),0,13.0(8.0),85.0(12.0) 64-Gd-155,14.9,3/2,13.8(3),,,E,40.8(4),25.0(6.0),66.0(6.0),61100.0(400.0) 64-Gd-156,20.6,0,6.3(4),,,,5.0(6),0,5.0(6),1.5(1.2) 64-Gd-157,15.7,3/2,4.0(2.0),,,E,650.0(4.0),394.0(7.0),1044.0(8.0),259000.0(700.0) 64-Gd-158,24.7,0,9.0(2.0),,,,10.0(5.0),0,10.0(5.0),2.2(2) 64-Gd-160,21.7,0,9.15(5),,,,10.52(11),0,10.52(11),0.77(2) 65-Tb-159,100,3/2,7.34(2),6.8(2),8.1(2),+/-,6.84(6),0.004(3),6.84(6),23.4(4) 66-Dy,,,16.9(3),,,,35.9(8),54.4(1.2),90.3(9),994.0(13.0) 66-Dy-156,0.06,0,6.1(5),,,,4.7(8),0,4.7(8),33.0(3.0) 66-Dy-158,0.1,0,6.0(4.0)*,,,,5.0(6.0),0,5.(6.),43.0(6.0) 66-Dy-160,2.3,0,6.7(4),,,,5.6(7),0,5.6(7),56.0(5.0) 66-Dy-161,18.9,5/2,10.3(4),,,,13.3(1.0),3.0(1.0),16.0(1.0),600.0(25.0) 66-Dy-162,25.5,0,-1.4(5),,,,0.25(18),0,0.25(18),194.0(10.0) 66-Dy-163,24.9,5/2,5.0(4),6.1(5),3.5(5),,3.1(5),0.21(19),3.3(5),124.0(7.0) 66-Dy-164,28.2,0,49.4(5),,,,307.0(3.0),0,307.0(3.0),2840.0(40.0) 67-Ho-165,100,7/2,8.44(3),6.9(2),10.3(2),+/-,8.06(8),0.36(3),8.42(16),64.7(1.2) 68-Er,,,7.79(2),,,,7.63(4),1.1(3),8.7(3),159.0(4.0) 68-Er-162,0.14,0,9.01(11),,,,9.7(4),0,9.7(4),19.0(2.0) 68-Er-164,1.6,0,7.95(14),,,,8.4(4),0,8.4(4),13.0(2.0) 68-Er-166,33.4,0,10.51(19),,,,14.1(5),0,14.1(5),19.6(1.5) 68-Er-167,22.9,7/2,3.06(5),5.3(3),0.0(3),,1.1(2),0.13(6),1.2(2),659.0(16.0) 68-Er-168,27,0,7.43(8),,,,6.9(7),0,6.9(7),2.74(8) 68-Er-170,15,0,9.61(6),,,,11.6(1.2),0,11.6(1.2),5.8(3) 69-Tm-169,100,1/2,7.07(3),,,+/-,6.28(5),0.10(7),6.38(9),100.0(2.0) 70-Yb,,,12.41(3),,,,19.42(9),4.0(2),23.4(2),34.8(8) 70-Yb-168,0.14,0,-4.07(2),,,E,2.13(2),0,2.13(2),2230.0(40.0) 70-Yb-170,3,0,6.8(1),,,,5.8(2),0,5.8(2),11.4(1.0) 70-Yb-171,14.3,1/2,9.7(1),6.5(2),19.4(4),,11.7(2),3.9(2),15.6(3),48.6(2.5) 70-Yb-172,21.9,0,9.5(1),,,,11.2(2),0,11.2(2),0.8(4) 70-Yb-173,16.3,5/2,9.56(10),2.5(2),13.3(3),,11.5(2),3.5,15,17.1(1.3) 70-Yb-174,31.8,0,19.2(1),,,,46.8(5),0,46.8(5),69.4(5.0) 70-Yb-176,12.7,0,8.7(1),,,,9.6(2),0,9.6(2),2.85(5) 71-Lu,,,7.21(3),,,,6.53(5),0.7(4),7.2(4),74.0(2.0) 71-Lu-175,97.4,7/2,7.28(9),,,,6.59(5),0.6(4),7.2(4),21.0(3.0) 71-Lu-176,2.6,7,6.1(2),,,,4.7(2),1.2(3),5.9,2065.(35.) 72-Hf,,,7.77(14),,,,7.6(3),2.6(5),10.2(4),104.1(5) 72-Hf-174,0.184,0,10.9(1.1),,,,15.0(3.0),0,15.0(3.0),561.0(35.0) 72-Hf-176,5.2,0,6.61(18),,,,5.5(3),0,5.5(3),23.5(3.1) 72-Hf-177,18.5,0,0.8(1.0)*,,,,0.1(2),0.1(3),0.2(2),373.0(10.0) 72-Hf-178,27.2,0,5.9(2),,,,4.4(3),0,4.4(3),84.0(4.0) 72-Hf-179,13.8,9/2,7.46(16),,,,7.0(3),0.14(2),7.1(3),41.0(3.0) 72-Hf-180,35.1,0,13.2(3),,,,21.9(1.0),0,21.9(1.0),13.04(7) 73-Ta,,,6.91(7),,,,6.00(12),0.01(17),6.01(12),20.6(5) 73-Ta-180,0.012,9,7.0(2.0)*,,,,6.2(3.5),0.5(5)*,7.0(4.0),563.0(60.0) 73-Ta-181,99.98,7/2,6.91(7),,,+/-,6.00(12),0.011(2),6.01(12),20.5(5) 74-W,,,4.755(18),,,,2.97(2),1.63(6),4.60(6),18.3(2) 74-W-180,0.13,0,5.0(3.0)*,,,,3.0(4.0),0,3.0(4.0),30.0(20.0) 74-W-182,26.3,1/2,7.04(4),,,,6.10(7),0,6.10(7),20.7(5) 74-W-183,14.3,1/2,6.59(4),6.3(4),7.0(4),,5.36(7),0.3(3)*,5.7(3),10.1(3) 74-W-184,30.7,0,7.55(6),,,,7.03(11),0,7.03(11),1.7(1) 74-W-186,28.6,0,-0.73(4),,,,0.065(7),0,0.065(7),37.9(6) 75-Re,,,9.2(2),,,,10.6(5),0.9(6),11.5(3),89.7(1.0) 75-Re-185,37.5,5/2,9.0(3),,,,10.2(7),0.5(9),10.7(6),112.0(2.0) 75-Re-187,62.5,5/2,9.3(3),,,,10.9(7),1.0(6),11.9(4),76.4(1.0) 76-Os,,,10.7(2),,,,14.4(5),0.3(8),14.7(6),16.0(4.0) 76-Os-184,0.02,0,10.0(2.0)*,,,,13.0(5.0),0,13.0(5.0),3000.0(150.0) 76-Os-186,1.6,0,12.0(1.7),,,,17.0(5.0),0,17.0(5.0),80.0(13.0) 76-Os-187,1.6,1/2,10.0(2.0)*,,,,13.0(5.0),0.3(3)*,13.0(5.0),320.0(10.0) 76-Os-188,13.3,0,7.8(3),,,,7.3(6),0,7.3(6),4.7(5) 76-Os-189,16.1,3/2,11.0(3),,,,14.4(8),0.5(5)*,14.9(9),25.0(4.0) 76-Os-190,26.4,0,11.4(3),,,,15.2(8),0,15.2(8),13.1(3) 76-Os-192,41,0,11.9(4),,,,16.6(1.2),0,16.6(1.2),2.0(1) 77-Ir,,,10.6(3),,,,14.1(8),0.0(3.0),14.0(3.0),425.0(2.0) 77-Ir-191,37.4,3/2,,,,,,,,954.0(10.0) 77-Ir-193,62.6,3/2,,,,,,,,111.0(5.0) 78-Pt,,,9.60(1),,,,11.58(2),0.13(11),11.71(11),10.3(3) 78-Pt-190,0.01,0,9.0(1.0),,,,10.0(2.0),0,10.0(2.0),152.0(4.0) 78-Pt-192,1.78,0,9.9(5),,,,12.3(1.2),0,12.3(1.2),10.0(2.5) 78-Pt-194,32.9,0,10.55(8),,,,14.0(2),0,14.0(2),1.44(19) 78-Pt-195,33.8,1/2,8.91(9),9.5(3),7.2(3),+/-,9.8(2),0.13(4),9.9(2),27.5(1.2) 78-Pt-196,25.3,0,9.89(8),,,,12.3(2),0,12.3(2),0.72(4) 78-Pt-198,7.2,0,7.8(1),,,,7.6(2),0,7.6(2),3.66(19) 79-Au-197,100,3/2,7.90(7),6.26(10),9.90(14),+/-,7.32(12),0.43(5),7.75(13),98.65(9) 80-Hg,,,12.595(45),,,,20.24(5),6.6(1),26.8(1),372.3(4.0) 80-Hg-196,0.15,0,30.3(1.0),,,E,115.0(8.0),0,115.0(8.0),3080.0(180.0) 80-Hg-198,10.1,0,,,,,,0,,2.0(3) 80-Hg-199,16.9,0,16.9(4),,,E,36.0(2.0),30.0(3.0),66.0(2.0),2150.0(48.0) 80-Hg-200,23.1,0,,,,,,0,,<60.0 80-Hg-201,13.2,3/2,,,,,,,,7.8(2.0) 80-Hg-202,29.7,0,11.002(43),,,,15.2108(2),0,15.2108(2),4.89(5) 80-Hg-204,6.8,0,,,,,,0,,0.43(10) 81-Tl,,,8.776(5),,,,9.678(11),0.21(15),9.89(15),3.43(6) 81-Tl-203,29.5,1/2,8.51(8),9.08(10),6.62(10),,6.14(28),0.14(4),6.28(28),11.4(2) 81-Tl-205,70.5,1/2,8.87(7),5.15(10),9.43(10),+/-,11.39(17),0.007(1),11.40(17),0.104(17) 82-Pb,,,9.401(2),,,,11.115(7),0.0030(7),11.118(7),0.171(2) 82-Pb-204,1.4,0,10.893(78),,,,12.3(2),0,12.3(2),0.65(7) 82-Pb-206,24.1,0,9.221(78),,,,10.68(12),0,10.68(12),0.0300(8) 82-Pb-207,22.1,1/2,9.286(16),,,+/-,10.82(9),0.002(2),10.82(9),0.699(10) 82-Pb-208,52.4,0,9.494(30),,,,11.34(5),0,11.34(5),0.00048(3) 83-Bi-209,100,9/2,8.532(2),8.26(1),8.74(1),,9.148(4),0.0084(19),9.156(4),0.0338(7) 88-Ra-226,1620 Y,0,10.0(1.0),,,,13.0(3.0),0,13.0(3.0),12.8(1.5) 90-Th-232,100,0,10.31(3),,,,13.36(8),0,13.36(8),7.37(6) 91-Pa-231,32500 Y,3/2,9.1(3),,,,10.4(7),0.1(3.3),10.5(3.2),200.6(2.3) 92-U,,,8.417(5),,,,8.903(11),0.005(16),8.908(11),7.57(2) 92-U-233,159000 Y,5/2,10.1(2),,,,12.8(5),0.1(6),12.9(3),574.7(1.0) 92-U-234,0.005,0,12.4(3),,,,19.3(9),0,19.3(9),100.1(1.3) 92-U-235,0.72,7/2,10.50(3),,,,13.78(11),0.2(2),14.0(2),680.9(1.1) 92-U-238,99.27,0,8.407(7),,,,8.871(11),0,8.871(11),2.68(2) 93-Np-237,2140000 Y,5/2,10.55(10),,,,14.0(3),0.5(5)*,14.5(6),175.9(2.9) 94-Pu-239,24400 Y,1/2,7.7(1),,,,7.5(2),0.2(6),7.7(6),1017.3(2.1) 94-Pu-240,6540 Y,0,3.5(1),,,,1.54(9),0,1.54(9),289.6(1.4) 94-Pu-242,376000 Y,0,8.1(1),,,,8.2(2),0,8.2(2),18.5(5) 95-Am-243,7370 Y,5/2,8.3(2),,,,8.7(4),0.3(2.6),9.0(2.6),75.3(1.8) 96-Cm-244,17.9 Y,0,9.5(3),,,,11.3(7),0,11.3(7),16.2(1.2) 96-Cm-246,4700 Y,0,9.3(2),,,,10.9(5),0,10.9(5),1.36(17) 96-Cm-248,340000 Y,0,7.7(2),,,,7.5(4),0,7.5(4),3.00(26)\ """ # Imaginary values for select isotopes # isotope, b_c_i, bp_i, bm_i nsftableI = """\ 2-He-3,-1.48,,-5.925 3-Li-6,-0.26,-0.08(1),-0.62(2) 5-B,-0.21,, 47-Ag-107,-0.01,, 47-Ag-109,-0.025,, 48-Cd,-1.2,, 48-Cd-113,-12,, 49-In,-0.054,, 49-In-115,-0.056,, 52-Te-123,-0.1,, 62-Sm,-1.5,, 62-Sm-149,-11,, 64-Gd,-13.6,, 64-Gd-155,-10.3,, 71-Lu-176,-0.57(2),, 80-Hg-196,-0.8,,\ """ # Excluding the following because the measurements for the real parts # were not used in nsftable table. # 63-Eu-151,-2.46,, # 64-Gd-157,-47,-75, def fix_number(str): """ Converts strings of the form e.g., 35.24(2)* into numbers without uncertainty. Also accepts a limited range, e.g., <1e-6, which is converted as 1e-6. Missing values are set to 0. """ if str == '': return None idx = str.find('(') if idx >= 0: str = str[0:idx] if str[0] == '<': str = str[1:] return float(str) def sld_table(wavelength=1, table=None, isotopes=True): """ Scattering length density table for wavelength 4.75 |Ang|. :Parameters: *table* : PeriodicTable If *table* is not specified, use the common periodic table. *isotopes* = True : boolean Whether to consider isotopes or not. :Returns: None Example >>> sld_table(wavelength=4.75) # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE Neutron scattering length density table atom mass density sld imag incoh H 1.008 0.071 -1.582 0.000 10.691 1-H 1.008 0.071 -1.583 0.000 10.691 D 2.014 0.141 2.823 0.000 1.705 T 3.016 0.212 2.027 0.000 0.453 He 4.003 0.122 0.598 0.000 0.035 3-He 3.016 0.092 1.054 0.272 0.706 * 4-He 4.003 0.122 0.598 0.000 0.035 ... 248-Cm 248.072 13.569 2.536 0.000 0.207 * Energy dependent cross sections """ table = default_table(table) # Table for comparison with scattering length density calculators # b_c for Sc, Te, Xe, Sm, Eu, Gd, W, Au, Hg are different from Neutron News # The Rauch data have cited references to back up the numbers # (see doc directory), though it is not clear what criteria are # used to select amongst the available measurements. print(" Neutron scattering length density table") print("%-7s %7s %7s %7s %7s %7s" %('atom', 'mass', 'density', 'sld', 'imag', 'incoh')) for el in table: if el.neutron.has_sld(): coh, jcoh, inc = el.neutron.sld(wavelength=wavelength) print("%-7s %7.3f %7.3f %7.3f %7.3f %7.3f%s" %(el, el.mass, el.density, coh, jcoh, inc, ' *' if el.neutron.is_energy_dependent else '')) if isotopes: isos = [iso for iso in el if iso.neutron != None and iso.neutron.has_sld()] else: isos = [] for iso in isos: coh, jcoh, inc = iso.neutron.sld(wavelength=wavelength) print("%-7s %7.3f %7.3f %7.3f %7.3f %7.3f%s" %(iso, iso.mass, iso.density, coh, jcoh, inc, ' *' if iso.neutron.is_energy_dependent else '')) print("* Energy dependent cross sections") def energy_dependent_table(table=None): """ Prints a table of energy dependent isotopes. :Parameters: *table* : PeriodicTable If *table* is not specified, use the common periodic table. :Returns: None Example >>> energy_dependent_table() Elements and isotopes with energy dependent absorption: He-3 Cd Cd-113 Sm Sm-149 Eu Eu-151 Gd Gd-155 Gd-157 Yb-168 Hg-196 Hg-199 """ table = default_table(table) # List of energy dependent elements and isotopes print("Elements and isotopes with energy dependent absorption:") for el in table: if not hasattr(el, 'neutron'): continue dep = [] if el.neutron.is_energy_dependent: dep += [str(el)] dep += [str(el)+'-'+str(iso.isotope) for iso in el if iso.neutron != None and iso.neutron.is_energy_dependent] if len(dep) > 0: print(" " + " ".join(dep)) def _diff(iso, a, b, tol=0.01): if None in (a, b): if a is not None or b is not None: if a is None and b > tol: print("%10s %8s %8.2f"%(iso, "----", b)) elif b is None and a > tol: print("%10s %8.2f %8s"%(iso, a, "----")) elif abs(a - b) > tol: print("%10s %8.2f %8.2f %5.1f%%" % (iso, a, b, (100*(a-b)/b if b != 0 else inf))) def compare(fn1, fn2, table=None, tol=0.01): table = default_table(table) for el in table: try: res1 = fn1(el) except Exception: res1 = None try: res2 = fn2(el) except Exception: res2 = None _diff(el, res1, res2, tol=tol) for iso in el: try: res1 = fn1(iso) except Exception: res1 = None try: res2 = fn2(iso) except Exception: res2 = None _diff(iso, res1, res2, tol=tol) def absorption_comparison_table(table=None, tol=None): r""" Prints a table comparing absorption to the imaginary bound coherent scattering length b_c_i. This is used to checking the integrity of the data and formula. The relationship between absorption and b_c_i is: .. math:: \sigma_a = -2 \lambda b_i \cdot 1000 The wavelength $\lambda = 1.798 \AA$ is the neutron wavelength at which the absorption is tallied. The factor of 1000 transforms from |Ang|\ |cdot|\ fm to barn. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. *tol* = 0.01 : float | barn Show differences greater than this amount. :Returns: None Example >>> absorption_comparison_table (tol=0.5) # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE Comparison of absorption and (-2000 lambda b_c_i) 3-He 5333.00 5322.08 0.2% Li 70.50 ---- 6-Li 940.00 934.96 0.5% B 767.00 755.16 1.6% 10-B 3835.00 ---- N 1.90 ---- ... """ print("Comparison of absorption and (-2000 lambda b_c_i)") compare(lambda el: el.neutron.absorption, lambda el: -2000*el.neutron.b_c_i*ABSORPTION_WAVELENGTH, table=table, tol=tol) return def coherent_comparison_table(table=None, tol=None): r""" Prints a table of $4 \pi b_c^2/100$ and coherent for each isotope. This is useful for checking the integrity of the data and formula. The table only prints where b_c exists. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. *tol* = 0.01 : float | barn Amount of difference to show :Returns: None Example >>> coherent_comparison_table (tol=0.5) # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE Comparison of (4 pi b_c^2/100) and coherent n 172.03 43.01 300.0% 1-n 172.03 43.01 300.0% Sc 18.40 19.00 -3.2% 45-Sc 18.40 19.00 -3.2% 65-Cu 13.08 14.10 -7.2% 70-Zn 5.98 4.50 33.0% 84-Sr 3.14 6.00 -47.6% ... """ print("Comparison of (4 pi b_c^2/100) and coherent") compare(lambda el: 4*pi/100*el.neutron.b_c**2, lambda el: el.neutron.coherent, table=table, tol=tol) def total_comparison_table(table=None, tol=None): """ Prints a table of neutron.total and sum coh,inc for each isotope where these exist. This is used to checking the integrity of the data and formula. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. *tol* = 0.01 : float | barn Amount of difference to show :Returns: None Example >>> total_comparison_table (tol=0.1) Comparison of total cross section to (coherent + incoherent) n 43.01 ---- 1-n 43.01 ---- 84-Kr 6.60 ---- 149-Sm 200.00 200.50 -0.2% Eu 9.20 9.07 1.4% Gd 180.00 180.30 -0.2% 155-Gd 66.00 65.80 0.3% 161-Dy 16.00 16.30 -1.8% 180-Ta 7.00 6.70 4.5% 187-Os 13.00 13.30 -2.3% """ print("Comparison of total cross section to (coherent + incoherent)") compare(lambda el: el.neutron.total, lambda el: el.neutron.coherent+el.neutron.incoherent, table=table, tol=tol) def incoherent_comparison_table(table=None, tol=None): """ Prints a table of incoherent computed from total and b_c with incoherent. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. *tol* = 0.01 : float | barn Amount of difference to show :Returns: None Example >>> incoherent_comparison_table (tol=0.5) # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE Comparison of incoherent and (total - 4 pi b_c^2/100) Sc 4.50 5.10 -11.8% 45-Sc 4.50 5.10 -11.8% 65-Cu 0.40 1.42 -71.7% 70-Zn 0.00 -1.48 -100.0% 84-Sr 0.00 2.86 -100.0% 113-Cd 0.30 4.36 -93.1% ... """ print("Comparison of incoherent and (total - 4 pi b_c^2/100)") compare(lambda el: el.neutron.incoherent, lambda el: el.neutron.total - 4*pi/100*el.neutron.b_c**2, table=table, tol=tol) def print_scattering(compound, wavelength=ABSORPTION_WAVELENGTH): """ Print the scattering for a single compound. """ from . import formulas compound = formulas.formula(compound) density = compound.density if compound.density is not None else 1.0 sld, xs, penetration = neutron_scattering(compound, wavelength=wavelength, density=density) print("%s at %g Ang (density=%g g/cm^3)" % (str(compound), wavelength, density)) print(" sld: %g + %g j (%g incoherent) 1e-6/Ang^2"%sld) print(" sigma_c: %g sigma_i: %g sigma_a: %g 1/cm"%sld) print(" mu: %g 1/cm 1/e penetration: %g cm"%(1/penetration, penetration)) def main(): """ Simple command line interface, showing the predicted neutron scattering. Usage:: python -m periodictable.nsf [-Lwavelength] compound@density compound@density ... For example:: $ python -m periodictable.nsf XeF6@3.56 scattering for XeF6 at 1.798 Ang (density=3.56 g/cm^3) sld: 3.37503 + 0.000582313 j (0.402605 incoherent) 1e-6/Ang^2 sigma_c: 3.37503 sigma_i: 0.000582313 sigma_a: 0.402605 1/cm 1/e penetration: 2.23871 cm """ import sys compounds = sys.argv[1:] if compounds[0].startswith('-L'): wavelength = float(compounds[0][2:]) compounds = compounds[1:] else: wavelength = ABSORPTION_WAVELENGTH for c in compounds: print_scattering(c, wavelength) if __name__ == "__main__": main()periodictable-1.5.0/periodictable/plot.py000066400000000000000000000021011310514471200204510ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle """ Table plotter """ __all__ = ['table_plot'] def table_plot(data, form="line", label=None, title=None): """ Plot periodic table data using element symbol vs. value. :Parameters: *data* : { Element: float } Data values to plot *form* = "line" : "line|grid" Table layout to use :Returns: None """ import pylab if form == "line": bbox = dict(boxstyle="round", lw=1, ec=(0, 0, 0), fc=(0.85, 0.8, 0.8)) for el, value in data.items(): if value is not None: pylab.text(el.number, value, el.symbol, bbox=bbox, va='center', ha='center') pylab.xlim(0, 100) pylab.xlabel('Element number') values = [v for v in data.values()] minv, maxv = min(values), max(values) margin = (maxv - minv)*0.05 pylab.ylim(minv-margin, maxv+margin) if label is not None: pylab.ylabel(label) if title is not None: pylab.title(title) periodictable-1.5.0/periodictable/util.py000066400000000000000000000055631310514471200204670ustar00rootroot00000000000000# This program is in the public domain # Author: Paul Kienzle """ Helper functions """ def cell_volume(a=None, b=None, c=None, alpha=None, beta=None, gamma=None): r""" Compute cell volume from lattice parameters. :Parameters: *a*, *b*, *c* : float | |Ang| Lattice spacings. *a* is required. *b* and *c* default to *a*. *alpha*, *beta*, *gamma* : float | |deg| Lattice angles. *alpha* defaults to 90\ |deg|. *beta* and *gamma* default to *alpha*. :Returns: *V* : float | |Ang^3| Cell volume :Raises: *TypeError* : missing or invalid parameters The following formula works for all lattice types: .. math:: V = a b c \sqrt{1 - \cos^2 \alpha - \cos^2 \beta - \cos^2 \gamma + 2 \cos \alpha \cos \beta \cos \gamma} """ from math import cos, radians, sqrt if a is None: raise TypeError('missing lattice parameters') if b is None: b = a if c is None: c = a calpha = cos(radians(alpha)) if alpha is not None else 0 cbeta = cos(radians(beta)) if beta is not None else calpha cgamma = cos(radians(gamma)) if gamma is not None else calpha V = a*b*c*sqrt(1 - calpha**2 - cbeta**2 - cgamma**2 + 2*calpha*cbeta*cgamma) return V def require_keywords(function): r""" Decorator which forces all keyword arguments to the function to be explicitly named. For example: >>> @require_keywords ... def fn(a, b, c=3): pass >>> fn(1, 2, 3) Traceback (most recent call last): ... TypeError: name=value required for c >>> fn(1, 2, c=6) >>> fn(b=1, a=2, c=6) Variable arguments are not currently supported: >>> @require_keywords ... def fn(a, b, c=6, *args, **kw): pass Traceback (most recent call last): ... NotImplementedError: only named arguments for now .. Note:: The call signature is not preserved. We can't preserve the function signature for the call since the only way we can count the number of non-keyword arguments is to use the \*args, \*\*kw call style. Python 3+ provides the '\*' call signature element which will force all keywords after '\*' to be named. """ import inspect import functools args, vararg, varkwd, defaults = inspect.getargspec(function) if defaults is None: defaults = [] named_args = args[:-len(defaults)] named_kwds = args[-len(defaults):] # Keep it simple for now if vararg or varkwd: raise NotImplementedError("only named arguments for now") @functools.wraps(function) def _require_kwds(*args, **kw): if len(args) > len(named_args): raise TypeError("name=value required for "+", ".join(named_kwds)) return function(*args, **kw) return _require_kwds periodictable-1.5.0/periodictable/xsf.py000066400000000000000000000560401310514471200203060ustar00rootroot00000000000000# This program is public domain # Author: Paul Kienzle r""" This module has one class and nine fuctions. :class:`Xray` X-ray scattering properties for the elements. The following attributes are added to each element: :func:`Xray.sftable` Three column table of energy vs. scattering factors f1, f2. :func:`Xray.scattering_factors` Returns f1, f2, the X-ray scattering factors for the given wavelengths interpolated from sftable. :func:`Xray.f0` Returns f0 for the given vector Q, with Q[i] in $[0, 24\pi]$ |1/Ang|. :func:`Xray.sld` Returns scattering length density (*real*, *imaginary*) for the given wavelengths or energies. The following functions are available for X-ray scatting information processing: :func:`xray_wavelength` Finds X-ray wavelength in angstroms given energy in keV. :func:`xray_energy` Finds X-ray energy in keV given wavelength in angstroms. :func:`init` Initializes a periodic table with the Lawrence Berkeley Laboratory Center for X-Ray Optics xray scattering factors. :func:`init_spectral_lines` Sets the K_alpha and K_beta1 wavelengths for select elements. :func:`sld_table` Prints the xray SLD table for the given wavelength. :func:`xray_sld` Computes xray scattering length densities for molecules. :func:`index_of_refraction` Express xray scattering length density as an index of refraction :func:`mirror_reflectivity` X-ray reflectivity from a mirror made of a single compound. :func:`xray_sld_from_atoms` The underlying scattering length density calculator. This works with a dictionary of atoms and quantities directly. :func:`emission_table` Prints a table of emission lines. K_alpha, K_beta1 (|Ang|): X-ray emission lines for elements beyond neon, with $K_\alpha = (2 K_{\alpha 1} + K_{\alpha 2})/3$. X-ray scattering factors: Low-Energy X-ray Interaction Coefficients: Photoabsorption, scattering and reflection for E in 30 to 30,000 eV, and Z in 1 to 92. .. Note:: For :ref:`custom tables `, use :func:`init` and :func:`init_spectral_lines` to set the data. Emission line tables ==================== Data for the $K_\alpha$ and $K_\beta$ lines comes from [#Deslattes2003], with the full tables available at ``_. Experimental Values are used, truncated to 4 digits of precision to correspond to the values for the subset of elements previously defined in the periodictable package. X-ray f1 and f2 tables ====================== The data for the tables is stored in the ``periodictable/xsf``. directory. The following information is from ``periodictable/xsf/read.me``, with minor formatting changes: These ``[*.nff]`` files were used to generate the tables published in reference [#Henke1993]_. The files contain three columns of data: Energy(eV), *f_1*, *f_2*, where *f_1* and *f_2* are the atomic (forward) scattering factors. There are 500+ points on a uniform logarithmic mesh with points added 0.1 eV above and below "sharp" absorption edges. The tabulated values of *f_1* contain a relativistic, energy independent, correction given by: .. math:: Z^* = Z - (Z/82.5)^{2.37} .. Note:: Below 29 eV *f_1* is set equal to -9999. The atomic photoabsorption cross section, $\mu_a$, may be readily obtained from the values of $f_2$ using the relation: .. math:: \mu_a = 2 r_e \lambda f_2 where $r_e$ is the classical electron radius, and $\lambda$ is the wavelength. The index of refraction for a material with *N* atoms per unit volume is calculated by: .. math:: n = 1 - N r_e \lambda^2 (f_1 + i f_2)/(2 \pi). These (semi-empirical) atomic scattering factors are based upon photoabsorption measurements of elements in their elemental state. The basic assumption is that condensed matter may be modeled as a collection of non-interacting atoms. This assumption is in general a good one for energies sufficiently far from absorption thresholds. In the threshold regions, the specific chemical state is important and direct experimental measurements must be made. These tables are based on a compilation of the available experimental measurements and theoretical calculations. For many elements there is little or no published data and in such cases it was necessary to rely on theoretical calculations and interpolations across Z. In order to improve the accuracy in the future considerably more experimental measurements are needed. Note that the following elements have been updated since the publication of Ref. [#Henke1993]_ in July 1993. Check ``_ for more recent updates. .. table:: ======== ========== ================= Element Updated Energy Range (eV) ======== ========== ================= Mg Jan 2011 10-1300 Zr Apr 2010 20-1000 La Jun 2007 14-440 Gd Jun 2007 12-450 Sc Apr 2006 50-1300 Ti Aug 2004 20-150 Ru Aug 2004 40-1300 W Aug 2004 35-250 Mo Aug 2004 25-60 Be Aug 2004 40-250 Mo Nov 1997 10-930 Fe Oct 1995 600-800 Si Jun 1995 30-500 Au Jul 1994 2000-6500 Mg,Al,Si Jan 1994 30-200 Li Nov 1994 2000-30000 ======== ========== ================= Data available at: #. http://henke.lbl.gov/optical_constants/asf.html .. [#Henke1993] B. L. Henke, E. M. Gullikson, and J. C. Davis. "X-ray interactions: photoabsorption, scattering, transmission, and reflection at E=50-30000 eV, Z=1-92", Atomic Data and Nuclear Data Tables 54 no.2, 181-342 (July 1993). .. [#Deslattes2003] R. D. Deslattes, E. G. Kessler, Jr., P. Indelicato, L. de Billy, E. Lindroth, and J. Anton. Rev. Mod. Phys. 75, 35-99 (2003). """ from __future__ import with_statement __all__ = ['Xray', 'init', 'init_spectral_lines', 'xray_energy', 'xray_wavelength', 'xray_sld', 'xray_sld_from_atoms', 'emission_table', 'sld_table', 'plot_xsf', 'index_of_refraction', 'mirror_reflectivity', ] import os.path import glob import numpy from numpy import nan, pi, exp, sin, cos, sqrt, radians from .core import Element, Ion, default_table, get_data_path from .constants import (avogadro_number, plancks_constant, speed_of_light, electron_radius) from .util import require_keywords def xray_wavelength(energy): """ Convert X-ray energy to wavelength. :Parameters: *energy* : float or vector | keV :Returns: *wavelength* : float | |Ang| Energy can be converted to wavelength using .. math:: \lambda = h c / E where: $h$ = planck's constant in eV\ |cdot|\ s $c$ = speed of light in m/s """ return plancks_constant*speed_of_light/numpy.asarray(energy)*1e7 def xray_energy(wavelength): """ Convert X-ray wavelength to energy. :Parameters: *wavelength* : float or vector | |Ang| :Returns: *energy* : float or vector | keV Wavelength can be converted to energy using .. math:: E = h c / \lambda where: $h$ = planck's constant in eV\ |cdot|\ s $c$ = speed of light in m/s """ return plancks_constant*speed_of_light/numpy.asarray(wavelength)*1e7 class Xray(object): """ X-ray scattering properties for the elements. Refer help(periodictable.xsf) from command prompt for details. """ _nff_path = get_data_path('xsf') sftable_units = ["eV", "", ""] scattering_factors_units = ["", ""] sld_units = ["1e-6/Ang^2", "1e-6/Ang^2"] _table = None def __init__(self, element): self.element = element def _gettable(self): if self._table is None: # Load table when necessary; note there is no table for # neutrons (n), and lowercase nitrogen=> n.nff, so it must # be checked for explicitly. filename = os.path.join(self._nff_path, self.element.symbol.lower()+".nff") if self.element.symbol != 'n' and os.path.exists(filename): xsf = numpy.loadtxt(filename, skiprows=1).T xsf[1, xsf[1] == -9999.] = numpy.NaN xsf[0] *= 0.001 # Use keV in table rather than eV self._table = xsf return self._table sftable = property(_gettable, doc="X-ray scattering factor table (E,f1,f2)") @require_keywords def scattering_factors(self, energy=None, wavelength=None): """ X-ray scattering factors f', f''. :Parameters: *energy* : float or vector | keV X-ray energy. :Returns: *scattering_factors* : (float, float) Values outside the range return NaN. Values are found from linear interpolation within the Henke Xray scattering factors database at the Lawrence Berkeley Laboratory Center for X-ray Optics. """ xsf = self.sftable if xsf is None: return None, None if wavelength is not None: energy = xray_energy(wavelength) if energy is None: raise TypeError('X-ray scattering factors need wavelength or energy') scalar = numpy.isscalar(energy) if scalar: energy = numpy.array([energy]) f1 = numpy.interp(energy, xsf[0], xsf[1], left=nan, right=nan) f2 = numpy.interp(energy, xsf[0], xsf[2], left=nan, right=nan) if scalar: f1, f2 = f1[0], f2[0] return f1, f2 def f0(self, Q): r""" Isotropic X-ray scattering factors *f0* for the input Q. :Parameters: *Q* : float or vector in $[0, 24\pi]$ | |1/Ang| X-ray scattering properties for the elements. :Returns: *f0* : float Values outside the valid range return NaN. .. Note:: *f0* is often given as a function of $\sin(\theta)/\lambda$ whereas we are using $Q = 4 \pi \sin(\theta)/\lambda$, or in terms of energy $Q = 4 \pi \sin(\theta) E/(h c)$. Reference: D. Wassmaier, A. Kerfel, Acta Crystallogr. A51 (1995) 416. http://dx.doi.org/10.1107/S0108767394013292 """ from . import cromermann f = cromermann.fxrayatq(Q=Q, symbol=self.element.symbol, charge=self.element.charge) return f @require_keywords def sld(self, wavelength=None, energy=None): r""" X ray scattering length density. :Parameters: *wavelength* : float or vector | |Ang| Wavelength of the X-ray. *energy* : float or vector | keV Energy of the X-ray (if *wavelength* not specified). .. note: Only one of *wavelength* and *energy* is needed. :Returns: *sld* : (float, float) | |1/Ang^2| (*real*, *imaginary*) X-ray scattering length density. :Raises: *TypeError* : neither *wavelength* nor *energy* was specified. The scattering length density is $r_e N (f_1 + i f_2)$. where $r_e$ is the electron radius and $N$ is the number density. The number density is $N = \rho_m/m N_A$, with mass density $\rho_m$ molar mass $m$ and Avogadro's number $N_A$. The constants are available directly: $r_e$ = periodictable.xsf.electron_radius $N_A$ = periodictable.constants.avogadro_number Data comes from the Henke Xray scattering factors database at the Lawrence Berkeley Laboratory Center for X-ray Optics. """ f1, f2 = self.scattering_factors(wavelength=wavelength, energy=energy) if f1 is None or self.element.number_density is None: return None, None rho = f1*electron_radius*self.element.number_density*1e-8 irho = f2*electron_radius*self.element.number_density*1e-8 return rho, irho # Note: docs and function prototype are reproduced in __init__ @require_keywords def xray_sld(compound, density=None, natural_density=None, wavelength=None, energy=None): """ Compute xray scattering length densities for molecules. :Parameters: *compound* : Formula initializer Chemical formula. *density* : float | |g/cm^3| Mass density of the compound, or None for default. *natural_density* : float | |g/cm^3| Mass density of the compound at naturally occurring isotope abundance. *wavelength* : float or vector | |Ang| Wavelength of the X-ray. *energy* : float or vector | keV Energy of the X-ray, if *wavelength* is not specified. :Returns: *sld* : (float, float) | |1e-6/Ang^2| (*real*, *imaginary*) scattering length density. :Raises: *AssertionError* : *density* or *wavelength*/*energy* is missing. """ from . import formulas compound = formulas.formula(compound, density=density, natural_density=natural_density) assert compound.density is not None, "scattering calculation needs density" if wavelength is not None: energy = xray_energy(wavelength) assert energy is not None, "scattering calculation needs energy or wavelength" mass, sum_f1, sum_f2 = 0, 0, 0 for element, quantity in compound.atoms.items(): mass += element.mass*quantity f1, f2 = element.xray.scattering_factors(energy=energy) #print element, f1, f2, wavelength sum_f1 += f1*quantity sum_f2 += f2*quantity if mass == 0: # because the formula is empty return 0, 0 N = (compound.density/mass*avogadro_number*1e-8) rho = N*sum_f1*electron_radius irho = N*sum_f2*electron_radius return rho, irho @require_keywords def index_of_refraction(compound, density=None, natural_density=None, energy=None, wavelength=None): """ Calculates the index of refraction for a given compound :Parameters: *compound* : Formula initializer Chemical formula. *density* : float | |g/cm^3| Mass density of the compound, or None for default. *natural_density* : float | |g/cm^3| Mass density of the compound at naturally occurring isotope abundance. *wavelength* : float or vector | |Ang| Wavelength of the X-ray. *energy* : float or vector | keV Energy of the X-ray, if *wavelength* is not specified. :Returns: *n* : float or vector | unitless index of refraction of the material at the given energy :Notes: Formula taken from http://xdb.lbl.gov (section 1.7) and checked against http://henke.lbl.gov/optical_constants/getdb2.html """ if energy is not None: wavelength = xray_wavelength(energy) assert wavelength is not None, "scattering calculation needs energy or wavelength" f1, f2 = xray_sld(compound, density=density, natural_density=natural_density, wavelength=wavelength) return 1 - wavelength**2/(2*pi)*(f1 + f2*1j)*1e-6 @require_keywords def mirror_reflectivity(compound, density=None, natural_density=None, energy=None, wavelength=None, angle=None, roughness=0): """ Calculates reflectivity of a thick mirror as function of energy and angle :Parameters: *compound* : Formula initializer Chemical formula. *density* : float | |g/cm^3| Mass density of the compound, or None for default. *natural_density* : float | |g/cm^3| Mass density of the compound at naturally occurring isotope abundance. *roughness* : float | |Ang| High-spatial-frequency surface roughness. *wavelength* : float or vector | |Ang| Wavelength of the X-ray. *energy* : float or vector | keV Energy of the X-ray, if *wavelength* is not specified. *angle* : vector | |deg| Incident beam angles. :Returns: *reflectivity* : matrix matrix of reflectivity as function of (angle, energy) :Notes: Formula taken from http://xdb.lbl.gov (section 4.2) and checked against http://henke.lbl.gov/optical_constants/mirror2.html """ if energy is not None: wavelength = xray_wavelength(energy) assert wavelength is not None, "scattering calculation needs energy or wavelength" angle = radians(angle) if (numpy.isscalar(wavelength)): wavelength=numpy.array( [wavelength] ) if (numpy.isscalar(angle)) : angle =numpy.array( [angle] ) nv = index_of_refraction(compound=compound, density=density, natural_density=natural_density, wavelength=wavelength) ki = 2*pi/wavelength[None, :] * sin(angle[:, None]) kf = 2*pi/wavelength[None, :] * sqrt(nv[None, :]**2 - cos(angle[:, None])**2) r = (ki-kf)/(ki+kf)*exp(-2*ki*kf*roughness**2) return abs(r)**2 def xray_sld_from_atoms(*args, **kw): """ .. deprecated:: 0.91 :func:`xray_sld` now accepts a dictionary of \{atom\: count\} directly. """ return xray_sld(*args, **kw) spectral_lines_data = """\ Ac 0.1380 0.1205 Ag 0.5608 0.4970 Al 8.3402 7.9601 Am 0.1181 0.1030 Ar 4.1929 3.8860 As 1.1772 1.0573 At 0.1537 0.1343 Au 0.1818 0.1589 Ba 0.3866 0.3408 Bi 0.1624 0.1419 Bk 0.1122 0.0979 Br 1.0411 0.9328 Ca 3.3595 3.0897 Cd 0.5364 0.4751 Ce 0.3586 0.3158 Cf 0.1094 0.0954 Cl 4.7287 4.4034 Cm 0.1151 0.1004 Co 1.7902 1.6208 Cr 2.2910 2.0848 Cs 0.4018 0.3543 Cu 1.5418 1.3922 Dy 0.2711 0.2378 Er 0.2539 0.2226 Es 0.1067 0.0930 Eu 0.3000 0.2635 Fe 1.9373 1.7566 Fm 0.1040 0.0907 Fr 0.1456 0.1271 Ga 1.3414 1.2079 Gd 0.2899 0.2546 Ge 1.2553 1.1289 Hf 0.2238 0.1960 Hg 0.1767 0.1544 Ho 0.2623 0.2301 I 0.4348 0.3839 In 0.5136 0.4545 Ir 0.1926 0.1685 K 3.7423 3.4539 Kr 0.9816 0.8785 La 0.3722 0.3279 Lu 0.2308 0.2023 Mg 9.8902 9.5211 Mn 2.1031 1.9102 Mo 0.7107 0.6323 Na 11.9103 11.5752 Nb 0.7476 0.6657 Nd 0.3333 0.2933 Ne 14.6102 14.4522 Ni 1.6592 1.5001 Np 0.1243 0.1085 Os 0.1984 0.1736 P 6.1581 5.7961 Pa 0.1310 0.1143 Pb 0.1670 0.1459 Pd 0.5869 0.5205 Pm 0.3217 0.2829 Po 0.1580 0.1380 Pr 0.3456 0.3042 Pt 0.1871 0.1636 Pu 0.1212 0.1057 Ra 0.1417 0.1238 Rb 0.9269 0.8286 Re 0.2043 0.1788 Rh 0.6147 0.5456 Rn 0.1496 0.1306 Ru 0.6445 0.5724 S 5.3731 5.0316 Sb 0.4718 0.4170 Sc 3.0320 2.7796 Se 1.1061 0.9921 Si 7.1263 6.7531 Sm 0.3105 0.2730 Sn 0.4920 0.4352 Sr 0.8766 0.7829 Ta 0.2171 0.1900 Tb 0.2802 0.2460 Tc 0.6764 0.6013 Te 0.4527 0.4000 Th 0.1344 0.1174 Ti 2.7497 2.5139 Tl 0.1717 0.1501 Tm 0.2459 0.2155 U 0.1276 0.1114 V 2.5048 2.2844 W 0.2106 0.1843 Xe 0.4178 0.3687 Y 0.8302 0.7407 Yb 0.2382 0.2088 Zn 1.4364 1.2952 Zr 0.7873 0.7018\ """ def init_spectral_lines(table): """ Sets the K_alpha and K_beta1 wavelengths for select elements """ Element.K_alpha_units = "angstrom" Element.K_beta1_units = "angstrom" for row in spectral_lines_data.split('\n'): el, K_alpha, K_beta1 = row.split() el = table.symbol(el) el.K_alpha = float(K_alpha) el.K_beta1 = float(K_beta1) def init(table, reload=False): if 'xray' in table.properties and not reload: return table.properties.append('xray') # Create an xray object for the particular element/ion. Note that # we must not use normal attribute tests such as "hasattr(el, 'attr')" # or "try: el.attr; except:" since the delegation methods on Ion will # just return the attribute from the base element. Instead we check # for an instance specific xray object for the particular ion prior # to delegating. # TODO: is there a better way to set up delegation on a field by # field basis? def _cache_xray(el): if '_xray' not in el.__dict__ and isinstance(el, (Element, Ion)): el._xray = Xray(el) return el._xray Element.xray = property(_cache_xray) Ion.xray = property(_cache_xray) ## Note: the simple approach below fails for e.g., Ni[58].ion[3].xray #for el in table: # for charge in el.ions: # el.ion[charge].xray = Xray(el.ion[charge]) # el.xray = Xray(el) def plot_xsf(el): """ Plots the xray scattering factors for the given element. :Parameters: *el* : Element :Returns: None """ import pylab xsf = el.xray.sftable pylab.title('X-ray scattering factors for '+el.name) pylab.plot(xsf[0], xsf[1]) pylab.plot(xsf[0], xsf[2]) pylab.xlabel('Energy (keV)') pylab.ylabel('Scattering factor') pylab.legend(['f1', 'f2']) pylab.show() def sld_table(wavelength=None, table=None): """ Prints the xray SLD table for the given wavelength. :Parameters: *wavelength* = Cu K-alpha : float | |Ang| X-ray wavelength. *table* : PeriodicTable The default periodictable unless a specific table has been requested. :Returns: None Example >>> sld_table() # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE X-ray scattering length density for 1.5418 Ang El rho irho H 1.19 0.00 He 1.03 0.00 Li 3.92 0.00 Be 13.93 0.01 B 18.40 0.01 C 17.86 0.03 N 6.88 0.02 O 9.74 0.04 F 12.16 0.07 Ne 10.26 0.09 Na 7.98 0.09 Mg 14.78 0.22 ... """ table = default_table(table) if wavelength == None: wavelength = table.Cu.K_alpha # NBCU spreadsheet format print("X-ray scattering length density for %g Ang"%wavelength) print("%3s %6s %6s"%('El', 'rho', 'irho')) for el in table: rho, irho = el.xray.sld(wavelength=table.Cu.K_alpha) if rho is not None: print("%3s %6.2f %6.2f"%(el.symbol, rho, irho)) def emission_table(table=None): """ Prints a table of emission lines. :Parameters: *table* : PeriodicTable The default periodictable unless a specific table has been requested. :Returns: None Example >>> emission_table() # doctest: +ELLIPSIS, +NORMALIZE_WHITESPACE El Kalpha Kbeta1 Ne 14.6102 14.4522 Na 11.9103 11.5752 Mg 9.8902 9.5211 Al 8.3402 7.9601 Si 7.1263 6.7531 ... """ table = default_table(table) print("%3s %7s %7s"%('El', 'Kalpha', 'Kbeta1')) for el in table: if hasattr(el, 'K_alpha'): print("%3s %7.4f %7.4f"%(el.symbol, el.K_alpha, el.K_beta1)) periodictable-1.5.0/periodictable/xsf/000077500000000000000000000000001310514471200177275ustar00rootroot00000000000000periodictable-1.5.0/periodictable/xsf/ac.nff000066400000000000000000000321301310514471200210040ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.19484 10.1617 -9999. 1.15672 10.3261 -9999. 1.11982 10.4931 -9999. 1.08410 10.6628 -9999. 1.04952 10.8353 -9999. 1.01604 11.0106 -9999. 0.982343 11.1886 -9999. 0.946689 11.3696 -9999. 0.912330 11.5535 -9999. 0.881524 11.7404 -9999. 0.859053 11.9303 -9999. 0.837152 12.1232 -9999. 0.815811 12.3193 -9999. 0.794970 12.5186 -9999. 0.773794 12.7210 -9999. 0.753182 12.9268 -9999. 0.733119 13.1359 -9999. 0.713591 13.3483 -9999. 0.687995 13.5642 -9999. 0.662100 13.7836 -9999. 0.637180 14.0066 -9999. 0.619840 14.2331 -9999. 0.613379 14.4633 -9999. 0.606984 14.6973 -9999. 0.597514 14.9350 -9999. 0.589582 15.1765 -9999. 0.593095 15.4220 -9999. 0.605186 15.6714 -9999. 0.639248 15.9249 -9999. 0.736397 16.1825 -9999. 0.901612 16.4442 -9999. 1.08234 16.7102 -9999. 1.33842 16.9805 -9999. 1.62334 17.2551 -9999. 1.96852 17.5342 -9999. 2.46480 17.8178 -9999. 2.86404 18.1060 -9999. 3.23904 18.3989 -9999. 3.73116 18.6964 -9999. 4.29807 18.9988 -9999. 4.76244 19.3061 -9999. 5.27453 19.6184 -9999. 5.84167 19.9357 -9999. 6.47315 20.2582 -9999. 7.17382 20.5858 -9999. 7.88646 20.9188 -9999. 8.33334 21.2571 -9999. 8.80555 21.6009 -9999. 9.29141 21.9503 -9999. 9.77487 22.3053 -9999. 10.2835 22.6661 -9999. 10.8186 23.0327 -9999. 11.0979 23.4053 -9999. 11.3550 23.7838 -9999. 11.6181 24.1685 -9999. 11.8873 24.5594 -9999. 12.1627 24.9566 -9999. 12.3644 25.3603 -9999. 12.5672 25.7705 -9999. 12.6684 26.1873 -9999. 12.6700 26.6109 -9999. 12.6715 27.0413 -9999. 12.6731 27.4786 -9999. 12.6121 27.9231 -9999. 12.5434 28.3747 -9999. 12.4752 28.8337 -9999. 12.4073 29.3000 12.4245 12.0941 29.7739 12.9268 11.6800 30.2555 13.3157 11.2806 30.7449 13.6584 10.9279 31.2421 13.9870 10.5862 31.7475 14.3327 10.2552 32.2609 14.6844 9.79875 32.7827 14.9076 9.32203 33.3130 15.0551 8.86851 33.8518 15.1417 8.43705 34.3993 15.1810 8.08192 34.9557 15.2439 7.76168 35.5211 15.3216 7.45413 36.0956 15.4359 7.12481 36.6794 15.4948 6.72992 37.2727 15.5134 6.35692 37.8755 15.4911 5.95761 38.4882 15.4129 5.58207 39.1107 15.2842 5.23526 39.7432 15.1457 4.95437 40.3861 15.0107 4.68855 41.0393 14.8686 4.43700 41.7031 14.7171 4.20324 42.3776 14.5621 3.98413 43.0630 14.4017 3.77644 43.7595 14.2347 3.57975 44.4673 14.0618 3.39405 45.1865 13.8834 3.21800 45.9174 13.7004 3.05106 46.6600 13.5172 2.89279 47.4147 13.3232 2.71994 48.1816 13.1085 2.55684 48.9609 12.8768 2.40351 49.7528 12.6248 2.25938 50.5576 12.3447 2.14838 51.3753 12.0809 2.06175 52.2062 11.8203 1.97862 53.0506 11.5528 1.89883 53.9087 11.2713 1.82477 54.7806 10.9865 1.76874 55.6667 10.6988 1.71443 56.5670 10.4019 1.66179 57.4820 10.0928 1.61393 58.4117 9.77245 1.56876 59.3564 9.43719 1.52485 60.3165 9.08338 1.48305 61.2921 8.70821 1.44287 62.2834 8.30415 1.40378 63.2908 7.87360 1.38238 64.3145 7.41514 1.36193 65.3547 6.92040 1.35982 66.4118 6.40075 1.36644 67.4859 5.83314 1.38985 68.5775 5.24931 1.42283 69.6867 4.61876 1.45087 70.8138 3.92783 1.48080 71.9591 3.16375 1.51197 73.1230 2.30143 1.54380 74.3057 1.32718 1.61195 75.5076 0.231366 1.68979 76.7289 -1.03035 1.79026 77.9699 -2.51345 1.90280 79.2310 -4.35667 2.05900 80.5125 -6.65942 2.31287 81.8147 -9.96555 2.88991 83.1380 -14.0760 4.53099 84.4827 -19.4477 7.43494 85.8491 -27.1953 18.5978 87.2377 -19.3023 28.8378 88.6487 -13.1090 31.7133 90.0825 -9.83729 33.5326 91.5395 -6.75249 35.3832 93.0201 -3.95562 36.5484 94.5246 -1.43201 37.7519 96.0535 1.10684 38.9950 97.6071 3.96560 39.8900 99.1858 6.49034 40.3877 100.790 8.92850 40.8916 102.420 11.6171 41.2553 104.077 14.0894 41.1960 105.760 16.4150 41.1369 107.471 18.8600 40.9401 109.209 21.1317 40.5311 110.975 23.4116 40.1262 112.770 26.1403 39.7253 114.594 28.6178 38.0711 116.448 30.4916 36.4661 118.331 32.1412 34.9287 120.245 33.6060 33.1579 122.190 34.7065 31.3848 124.166 35.5408 29.7066 126.175 36.2010 28.1180 128.215 36.7211 26.6144 130.289 37.1257 25.1912 132.397 37.4337 23.8442 134.538 37.6600 22.5691 136.714 37.8170 21.3623 138.925 37.9147 20.2200 141.172 37.9621 19.1387 143.456 37.9667 18.1153 145.776 37.9357 17.1466 148.134 37.8754 16.2297 150.530 37.7930 15.3618 152.964 37.6967 14.5404 155.439 37.6007 13.7629 157.953 37.5543 13.0269 160.507 37.4680 12.1385 163.103 37.2728 11.2915 165.742 37.0036 10.5036 168.422 36.6944 9.77065 171.146 36.3556 9.08888 173.915 35.9936 8.45466 176.727 35.6131 7.86472 179.586 35.2167 7.31592 182.491 34.8061 6.80544 185.442 34.3805 6.33057 188.442 33.9356 5.88883 191.489 33.4436 5.47793 194.587 32.9726 5.20869 197.734 32.5446 4.95307 200.932 32.1427 4.70998 204.182 31.7512 4.47883 207.485 31.3648 4.25903 210.840 30.9781 4.05000 214.251 30.5687 3.86342 217.716 30.1804 3.71588 221.237 29.8093 3.57398 224.816 29.4407 3.43750 228.452 29.0633 3.30623 232.147 28.6859 3.20132 235.902 28.3148 3.10263 239.717 27.9394 3.00698 243.595 27.5283 2.92899 247.535 27.1376 2.89535 251.538 26.7648 2.86210 255.607 26.3908 2.82922 259.741 26.0005 2.79672 263.942 25.5992 2.79482 268.211 25.2100 2.80759 272.549 24.8209 2.82042 276.957 24.4150 2.83331 281.437 24.0021 2.87205 285.989 23.5894 2.91497 290.615 23.1663 2.95854 295.315 22.7135 3.00275 300.092 22.2462 3.08284 304.945 21.7739 3.16921 309.878 21.2835 3.25799 314.890 20.7645 3.34927 319.983 20.2046 3.44310 325.158 19.5557 3.53955 330.418 18.8307 3.74168 335.762 18.0955 4.01578 341.192 17.2960 4.36634 346.711 16.5177 4.84028 352.319 15.7294 5.36568 358.017 14.9454 6.02678 363.808 14.1973 6.77229 369.692 13.4888 7.58577 375.672 12.7910 8.47388 381.748 12.0779 9.48334 387.922 11.4377 10.6580 394.197 10.9324 11.9781 400.573 10.5661 13.3610 407.052 10.3194 14.8519 413.635 10.2624 16.4588 420.326 10.7157 18.0072 427.124 11.1225 19.2218 434.032 11.5054 20.5184 441.052 12.1715 21.7418 448.186 12.7374 22.6794 455.435 13.2505 23.6574 462.802 13.8303 24.6776 470.287 14.5762 25.6178 477.894 15.2317 26.3638 485.623 15.8288 27.1314 493.478 16.4208 27.9215 501.459 17.0332 28.7345 509.570 17.6861 29.5711 517.812 18.4023 30.4322 526.187 19.2982 31.3183 534.698 20.3257 31.9799 543.346 21.2352 32.4755 552.134 22.0841 32.9787 561.065 22.9243 33.4898 570.139 23.7800 34.0088 579.361 24.7516 34.5358 588.732 25.7287 34.8784 598.254 26.6408 35.1989 607.930 27.5462 35.5223 617.763 28.5160 35.8486 627.755 29.6126 36.0451 637.908 30.5504 35.9998 648.226 31.3470 35.9546 658.711 32.0087 35.9095 669.365 32.5085 35.9817 680.191 33.1119 36.2717 691.193 33.8159 36.5641 702.372 34.5943 36.8589 713.733 35.5019 37.1560 725.277 36.4549 37.2292 737.008 37.3360 37.2373 748.928 38.1547 37.2454 761.042 38.9597 37.2536 773.351 39.7891 37.2611 785.859 40.6090 37.2116 798.570 41.4147 37.1623 811.486 42.2472 37.1130 824.611 43.1805 36.9595 837.949 44.0169 36.6430 851.502 44.7238 36.3162 865.274 45.3666 35.9784 879.269 45.9323 35.6313 893.491 46.4188 35.2876 907.943 46.8046 34.9471 922.628 46.9513 34.6098 937.551 47.0935 34.7477 952.715 47.3650 35.0086 968.124 47.8655 35.3800 983.783 48.5662 35.7551 999.695 49.4897 36.0629 1015.86 50.7351 36.2959 1032.29 51.8667 35.8451 1048.99 52.7803 35.3878 1065.96 53.5486 34.9295 1083.20 54.2395 34.4760 1100.72 54.8724 34.0283 1118.52 55.4595 33.5864 1136.61 56.0075 33.1489 1155. 56.5212 32.7169 1173.68 57.0039 32.2902 1192.66 57.4571 31.8683 1211.95 57.8805 31.4516 1231.55 58.2666 31.0398 1251.47 58.6182 30.6610 1271.72 58.9473 30.3175 1292.29 59.2950 30.0155 1313.19 59.6552 29.7150 1334.43 60.0185 29.4173 1356.01 60.3839 29.1225 1377.94 60.7509 28.8293 1400.23 61.1207 28.5386 1422.88 61.4969 28.2506 1445.89 61.8861 27.9642 1469.28 62.3036 27.6625 1493.04 62.7537 27.3367 1517.19 63.1705 26.9020 1541.73 63.5296 26.4584 1566.67 63.8441 26.0215 1592.01 64.1313 25.5904 1617.76 64.3959 25.1661 1643.92 64.6415 24.7484 1670.51 64.8707 24.3369 1697.53 65.0852 23.9319 1724.99 65.2964 23.5333 1752.89 65.4935 23.1220 1781.24 65.6688 22.7112 1810.05 65.8239 22.3023 1839.32 65.9593 21.9000 1869.07 66.0785 21.5047 1899.30 66.1831 21.1163 1930.02 66.2735 20.7340 1961.24 66.3501 20.3583 1992.96 66.4096 19.9889 2025.20 66.4718 19.6373 2057.95 66.5237 19.2680 2091.24 66.5526 18.9019 2125.06 66.5650 18.5402 2159.43 66.5601 18.1819 2194.36 66.5387 17.8286 2229.85 66.4997 17.4785 2265.92 66.4420 17.1327 2302.57 66.3651 16.7915 2339.81 66.2685 16.4546 2377.66 66.1503 16.1213 2416.11 66.0088 15.7926 2455.19 65.8429 15.4680 2494.90 65.6495 15.1470 2535.26 65.4258 14.8306 2576.26 65.1689 14.5184 2617.93 64.8744 14.2107 2660.27 64.5379 13.9078 2703.30 64.1527 13.6082 2747.03 63.7099 13.3130 2791.46 63.1989 13.0221 2836.61 62.6048 12.7354 2882.49 61.9070 12.4527 2929.11 61.0750 12.1740 2976.48 60.0626 11.8996 3024.63 58.7929 11.6293 3073.55 57.1227 11.3630 3123.26 54.7300 11.1005 3173.78 50.5497 10.8419 3218.90 18.9273 10.6195 3219.10 18.9283 26.6901 3225.11 39.9248 26.6132 3277.27 50.4875 25.9599 3330.28 51.3354 25.3260 3370.10 32.7822 24.8664 3370.30 32.7924 35.5979 3384.15 50.2369 35.3752 3438.88 57.4454 34.5167 3494.50 60.7790 33.6814 3551.02 63.0653 32.8693 3608.46 64.7813 32.0769 3666.82 66.0985 31.3042 3726.13 67.0830 30.5520 3786.40 67.7152 29.8169 3847.64 67.7823 29.1024 3908.90 59.2419 28.4156 3909.10 59.2458 33.0886 3909.87 62.4831 33.0787 3973.11 69.7932 32.2807 4037.38 71.6019 31.5030 4102.68 72.8901 30.7446 4169.03 73.9194 30.0047 4236.46 74.7774 29.2841 4304.98 75.5028 28.5799 4374.62 76.1136 27.8941 4445.37 76.6145 27.2255 4517.27 76.9886 26.5736 4590.33 77.1475 25.9364 4655.90 74.4943 25.3859 4656.10 74.4955 26.8664 4664.58 76.6445 26.7960 4740.03 78.1197 26.1838 4816.69 78.7580 25.5873 4894.60 79.1867 25.0064 4973.77 79.3039 24.4380 5001.90 77.8048 24.2412 5002.10 77.8060 25.1673 5054.21 79.9437 24.8079 5135.96 80.6378 24.2616 5219.03 81.1632 23.7233 5303.44 81.6124 23.1931 5389.22 82.0105 22.6710 5476.39 82.3697 22.1577 5564.97 82.6965 21.6527 5654.98 82.9953 21.1564 5746.44 83.2692 20.6687 5839.39 83.5208 20.1898 5933.83 83.7519 19.7194 6029.81 83.9644 19.2577 6127.33 84.1593 18.8046 6226.44 84.3380 18.3604 6327.15 84.5017 17.9248 6429.48 84.6514 17.4979 6533.48 84.7880 17.0794 6639.15 84.9121 16.6693 6746.54 85.0244 16.2678 6855.65 85.1257 15.8747 6966.54 85.2168 15.4902 7079.22 85.2983 15.1135 7193.72 85.3703 14.7450 7310.07 85.4335 14.3845 7428.31 85.4886 14.0323 7548.45 85.5359 13.6874 7670.54 85.5756 13.3507 7794.61 85.6086 13.0214 7920.68 85.6347 12.6994 8048.79 85.6545 12.3851 8178.98 85.6682 12.0778 8311.26 85.6762 11.7781 8445.69 85.6792 11.4854 8582.29 85.6771 11.1993 8721.11 85.6700 10.9201 8862.16 85.6582 10.6474 9005.50 85.6422 10.3817 9151.16 85.6223 10.1218 9299.17 85.5985 9.86891 9449.58 85.5716 9.62176 9602.42 85.5419 9.38093 9757.73 85.5102 9.14603 9915.55 85.4854 8.91641 10075.9 85.4578 8.67087 10238.9 85.4081 8.43204 10404.5 85.3520 8.19981 10572.8 85.2888 7.97408 10743.8 85.2192 7.75475 10917.6 85.1434 7.54171 11094.2 85.0617 7.33486 11273.6 84.9741 7.13407 11455.9 84.8806 6.93925 11641.2 84.7811 6.75028 11829.5 84.6754 6.56703 12020.8 84.5633 6.38940 12215.3 84.4442 6.21726 12412.8 84.3176 6.05052 12613.6 84.1829 5.88904 12817.6 84.0391 5.73273 13025.0 83.8850 5.58145 13235.6 83.7191 5.43509 13449.7 83.5393 5.29356 13667.2 83.3431 5.15672 13888.3 83.1266 5.02447 14112.9 82.8848 4.89670 14341.2 82.6102 4.77329 14573.1 82.2913 4.65415 14808.9 81.9091 4.53916 15048.4 81.4294 4.42822 15291.8 80.7795 4.32122 15539.1 79.7564 4.21807 15790.4 77.1453 4.11865 15870.9 64.5247 4.08765 15871.1 64.5254 10.0440 16045.8 78.7522 9.85468 16305.4 80.4992 9.58369 16569.1 81.3693 9.32016 16837.1 81.9175 9.06388 17109.4 82.2851 8.81466 17386.1 82.5272 8.57229 17667.4 82.6662 8.33659 17953.1 82.7060 8.10738 18243.5 82.6304 7.88447 18538.6 82.3829 7.66770 18838.4 81.7432 7.45689 19083.1 74.3577 7.29152 19083.3 74.3578 10.2918 19143.1 80.4818 10.2449 19452.7 82.1804 10.0079 19767.4 82.2526 9.77636 19839.9 79.6212 9.72425 19840.1 79.6216 11.0444 20087.1 83.3101 10.8520 20412.0 84.0784 10.6075 20742.1 84.6127 10.3664 21077.6 85.0374 10.1289 21418.5 85.3932 9.89502 21765.0 85.6998 9.66483 22117.0 85.9687 9.43841 22474.7 86.2074 9.21577 22838.2 86.4209 8.99695 23207.6 86.6132 8.78198 23583.0 86.7869 8.57088 23964.4 86.9446 8.36366 24352.0 87.0879 8.16031 24745.9 87.2185 7.96085 25146.2 87.3375 7.76526 25552.9 87.4460 7.57354 25966.2 87.5450 7.38566 26386.1 87.6353 7.20160 26812.9 87.7176 7.02134 27246.6 87.7925 6.84485 27687.3 87.8606 6.67210 28135.1 87.9224 6.50304 28590.2 87.9783 6.33766 29052.6 88.0288 6.17589 29522.5 88.0742 6.01770 30000.0 88.1149 5.86306 periodictable-1.5.0/periodictable/xsf/ag.nff000066400000000000000000000316201310514471200210130ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.18566 10.1617 -9999. 1.22941 10.3261 -9999. 1.27478 10.4931 -9999. 1.32182 10.6628 -9999. 1.38215 10.8353 -9999. 1.45541 11.0106 -9999. 1.53256 11.1886 -9999. 1.61379 11.3696 -9999. 1.69933 11.5535 -9999. 1.78755 11.7404 -9999. 1.87996 11.9303 -9999. 1.97715 12.1232 -9999. 2.07936 12.3193 -9999. 2.18686 12.5186 -9999. 2.29992 12.7210 -9999. 2.41824 12.9268 -9999. 2.53197 13.1359 -9999. 2.65105 13.3483 -9999. 2.77572 13.5642 -9999. 2.90627 13.7836 -9999. 3.04294 14.0066 -9999. 3.18605 14.2331 -9999. 3.33589 14.4633 -9999. 3.47681 14.6973 -9999. 3.60644 14.9350 -9999. 3.74092 15.1765 -9999. 3.88040 15.4220 -9999. 4.02509 15.6714 -9999. 4.17517 15.9249 -9999. 4.29713 16.1825 -9999. 4.41441 16.4442 -9999. 4.53488 16.7102 -9999. 4.65865 16.9805 -9999. 4.78579 17.2551 -9999. 4.90106 17.5342 -9999. 4.98937 17.8178 -9999. 5.07926 18.1060 -9999. 5.17077 18.3989 -9999. 5.29055 18.6964 -9999. 5.45984 18.9988 -9999. 5.63455 19.3061 -9999. 5.81485 19.6184 -9999. 6.00091 19.9357 -9999. 6.19293 20.2582 -9999. 6.42631 20.5858 -9999. 6.67287 20.9188 -9999. 6.92890 21.2571 -9999. 7.19476 21.6009 -9999. 7.47081 21.9503 -9999. 7.69770 22.3053 -9999. 7.91341 22.6661 -9999. 8.13517 23.0327 -9999. 8.36313 23.4053 -9999. 8.59750 23.7838 -9999. 8.81679 24.1685 -9999. 8.87260 24.5594 -9999. 8.92877 24.9566 -9999. 8.98530 25.3603 -9999. 9.04218 25.7705 -9999. 9.09949 26.1873 -9999. 9.21817 26.6109 -9999. 9.33838 27.0413 -9999. 9.46018 27.4786 -9999. 9.58355 27.9231 -9999. 9.70853 28.3747 -9999. 9.84446 28.8337 -9999. 10.0304 29.3000 -1.81922 10.2199 29.7739 -1.72868 10.4130 30.2555 -1.62587 10.6097 30.7449 -1.50683 10.8101 31.2421 -1.36942 10.9964 31.7475 -1.23794 11.1767 32.2609 -1.10469 11.3600 32.7827 -0.965780 11.5464 33.3130 -0.819277 11.7358 33.8518 -0.660791 11.9283 34.3993 -0.480585 12.1239 34.9557 -0.289667 12.2800 35.5211 -0.115068 12.4307 36.0956 0.544224E-01 12.5832 36.6794 0.222635 12.7376 37.2727 0.391268 12.8939 37.8755 0.561365 13.0521 38.4882 0.733759 13.2123 39.1107 0.909163 13.3744 39.7432 1.08835 13.5385 40.3861 1.27236 13.7046 41.0393 1.46409 13.8728 41.7031 1.66062 14.0329 42.3776 1.85709 14.1936 43.0630 2.05539 14.3561 43.7595 2.25726 14.5206 44.4673 2.46333 14.6868 45.1865 2.67431 14.8550 45.9174 2.89086 15.0252 46.6600 3.11409 15.1972 47.4147 3.34752 15.3713 48.1816 3.58781 15.5375 48.9609 3.82940 15.7033 49.7528 4.07512 15.8707 50.5576 4.32632 16.0400 51.3753 4.58400 16.2111 52.2062 4.84891 16.3840 53.0506 5.12192 16.5588 53.9087 5.40394 16.7354 54.7806 5.69619 16.9139 55.6667 6.00013 17.0943 56.5670 6.31814 17.2766 57.4820 6.65965 17.4609 58.4117 7.02554 17.6230 59.3564 7.38425 17.7648 60.3165 7.74300 17.9077 61.2921 8.10773 18.0518 62.2834 8.48132 18.1971 63.2908 8.86597 18.3435 64.3145 9.26387 18.4911 65.3547 9.67727 18.6400 66.4118 10.1095 18.7903 67.4859 10.5644 18.9419 68.5775 11.0481 19.0946 69.6867 11.5723 19.2486 70.8138 12.1880 19.3916 71.9591 12.7928 19.3995 73.1230 13.3763 19.4073 74.3057 13.9659 19.4152 75.5076 14.6042 19.4231 76.7289 15.2716 19.3269 77.9699 15.9027 19.1837 79.2310 16.5022 19.0416 80.5125 17.1136 18.9006 81.8147 17.7380 18.7252 83.1380 18.3594 18.5330 84.4827 18.9875 18.3428 85.8491 19.6399 18.1546 87.2377 20.4515 17.9682 88.6487 21.2684 17.5449 90.0825 21.9898 17.0948 91.5395 22.6998 16.6562 93.0201 23.6518 16.2288 94.5246 24.6488 15.3958 96.0535 25.3798 14.3678 97.6071 26.1748 13.3588 99.1858 26.6170 11.8096 100.790 26.6486 10.4401 102.420 26.4945 9.22940 104.077 26.2218 8.15907 105.760 25.8908 7.21290 107.471 25.5212 6.35320 109.209 25.0855 5.54204 110.975 24.5909 4.83444 112.770 24.0706 4.21718 114.594 23.5321 3.67872 116.448 22.9483 3.20904 118.331 22.3497 2.87080 120.245 21.8285 2.65218 122.190 21.3696 2.45021 124.166 20.9391 2.26363 126.175 20.5186 2.09125 128.215 20.1081 1.95934 130.289 19.7224 1.84480 132.397 19.3282 1.73695 134.538 18.9417 1.68905 136.714 18.5939 1.64838 138.925 18.2518 1.62622 141.172 17.9193 1.61766 143.456 17.6017 1.64747 145.776 17.3166 1.67547 148.134 17.0300 1.70176 150.530 16.7386 1.76394 152.964 16.4735 1.84444 155.439 16.2253 1.92861 157.953 15.9759 2.01662 160.507 15.7193 2.15015 163.103 15.5017 2.32060 165.742 15.3307 2.50385 168.422 15.1938 2.68031 171.146 15.0960 2.86721 173.915 15.0271 3.00223 176.727 14.9482 3.14361 179.586 14.8947 3.29165 182.491 14.8627 3.39185 185.442 14.8146 3.49172 188.442 14.7762 3.59453 191.489 14.7499 3.68459 194.587 14.7181 3.75705 197.734 14.6829 3.82883 200.932 14.6452 3.89043 204.182 14.6015 3.95302 207.485 14.5557 4.01661 210.840 14.5090 4.08124 214.251 14.4622 4.14690 217.716 14.4159 4.21361 221.237 14.3705 4.28140 224.816 14.3266 4.35028 228.452 14.2852 4.42028 232.147 14.2474 4.49139 235.902 14.2232 4.56365 239.717 14.2123 4.61085 243.595 14.1768 4.64794 247.535 14.1347 4.68533 251.538 14.0882 4.72301 255.607 14.0396 4.76100 259.741 13.9916 4.79115 263.942 13.9328 4.81758 268.211 13.8683 4.84415 272.549 13.8013 4.87086 276.957 13.7407 4.89747 281.437 13.6733 4.88211 285.989 13.5744 4.86682 290.615 13.4568 4.85156 295.315 13.3227 4.83621 300.092 13.1727 4.82077 304.945 13.0140 4.80537 309.878 12.8412 4.75691 314.890 12.6115 4.70031 319.983 12.3330 4.65850 325.158 12.0432 4.63031 330.418 11.7364 4.56246 335.762 11.2984 4.47942 341.192 10.7574 4.45994 346.711 10.1946 4.52242 352.319 9.55395 4.58117 358.017 8.84431 4.72932 363.808 8.04906 4.94624 369.692 7.15775 5.19718 375.672 6.09691 5.58879 381.748 4.70109 6.30297 387.922 3.39440 7.40671 394.197 2.22553 9.23062 400.573 1.55570 11.3138 407.052 1.60279 13.4510 413.635 1.87385 15.5235 420.326 2.55047 17.4481 427.124 3.76452 18.9749 434.032 4.89407 20.2222 441.052 5.94640 21.0287 448.186 6.91953 21.8673 455.435 7.85548 22.5317 462.802 8.74241 23.2092 470.287 9.68918 23.9071 477.894 10.6742 24.4322 485.623 11.6983 24.9566 493.478 12.6891 25.2194 501.459 13.5625 25.4740 509.570 14.3886 25.7312 517.812 15.2012 25.9911 526.187 16.0277 26.2212 534.698 16.8194 26.4202 543.346 17.6000 26.6207 552.134 18.3874 26.8227 561.065 19.2024 27.0262 570.139 20.1066 27.2313 579.361 21.0903 27.2392 588.732 21.9318 27.1301 598.254 22.6965 27.0214 607.930 23.4171 26.9132 617.763 24.1080 26.8054 627.755 24.7766 26.6944 637.908 25.4254 26.5824 648.226 26.0594 26.4708 658.711 26.6836 26.3597 669.365 27.3020 26.2491 680.191 27.9192 26.1389 691.193 28.5409 26.0293 702.372 29.1756 25.9200 713.733 29.8411 25.8113 725.277 30.6134 25.7029 737.008 31.3386 25.3172 748.928 31.9433 24.9300 761.042 32.4292 24.6050 773.351 32.9405 24.3539 785.859 33.5328 24.1054 798.570 34.1735 23.7375 811.486 34.6808 23.2537 824.611 35.0357 22.7837 837.949 35.3960 22.5089 851.502 35.8062 22.2374 865.274 36.3619 21.9692 879.269 36.8862 21.4603 893.491 37.2638 20.9270 907.943 37.5380 20.4070 922.628 37.7337 19.9845 937.551 37.9488 19.6336 952.715 38.2020 19.2806 968.124 38.4445 18.9190 983.783 38.6732 18.5649 999.695 38.8941 18.2156 1015.86 39.1139 17.8710 1032.29 39.3218 17.5164 1048.99 39.5138 17.1648 1065.96 39.6909 16.8161 1083.20 39.8538 16.4746 1100.72 40.0057 16.1400 1118.52 40.1474 15.8122 1136.61 40.2799 15.4912 1155. 40.4042 15.1767 1173.68 40.5204 14.8685 1192.66 40.6291 14.5665 1211.95 40.7309 14.2706 1231.55 40.8257 13.9807 1251.47 40.9144 13.6972 1271.72 40.9974 13.4198 1292.29 41.0752 13.1483 1313.19 41.1485 12.8825 1334.43 41.2173 12.6221 1356.01 41.2821 12.3669 1377.94 41.3431 12.1169 1400.23 41.4009 11.8719 1422.88 41.4560 11.6319 1445.89 41.5107 11.3967 1469.28 41.5644 11.1634 1493.04 41.6226 10.9306 1517.19 41.6749 10.6850 1541.73 41.7100 10.4425 1566.67 41.7373 10.2055 1592.01 41.7580 9.97405 1617.76 41.7731 9.74780 1643.92 41.7832 9.52656 1670.51 41.7887 9.31021 1697.53 41.7901 9.09884 1724.99 41.7888 8.89242 1752.89 41.7847 8.68657 1781.24 41.7746 8.48395 1810.05 41.7586 8.28470 1839.32 41.7374 8.09055 1869.07 41.7120 7.90089 1899.30 41.6823 7.71539 1930.02 41.6482 7.53446 1961.24 41.6103 7.35786 1992.96 41.5679 7.18545 2025.20 41.5225 7.01915 2057.95 41.4755 6.85339 2091.24 41.4228 6.69071 2125.06 41.3651 6.53174 2159.43 41.3027 6.37653 2194.36 41.2356 6.22489 2229.85 41.1637 6.07701 2265.92 41.0868 5.93230 2302.57 41.0046 5.79105 2339.81 40.9166 5.65313 2377.66 40.8226 5.51848 2416.11 40.7221 5.38707 2455.19 40.6147 5.25884 2494.90 40.4997 5.13370 2535.26 40.3763 5.01163 2576.26 40.2437 4.89256 2617.93 40.1008 4.77642 2660.27 39.9462 4.66311 2703.30 39.7784 4.55267 2747.03 39.5953 4.44501 2791.46 39.3945 4.33998 2836.61 39.1727 4.23759 2882.49 38.9257 4.13785 2929.11 38.6479 4.04062 2976.48 38.3318 3.94587 3024.63 37.9662 3.85353 3073.55 37.5349 3.76361 3123.26 37.0115 3.67596 3173.78 36.3499 3.59056 3225.11 35.4564 3.50738 3277.27 34.0841 3.42637 3330.28 30.9467 3.34743 3351. 18.1610 3.31742 3351.20 18.1618 10.8260 3384.15 31.9201 10.6678 3438.88 33.8150 10.4135 3494.50 33.8391 10.1657 3523.60 27.6385 10.0399 3523.80 27.6422 13.7502 3551.02 34.6661 13.5923 3608.46 36.6213 13.2689 3666.82 37.6552 12.9532 3726.13 38.2768 12.6444 3786.40 38.0760 12.3435 3805.70 35.7476 12.2496 3805.90 35.7534 14.0388 3847.64 39.3005 13.8258 3909.87 40.3636 13.5182 3973.11 41.1148 13.2155 4037.38 41.7267 12.9155 4102.68 42.2492 12.6208 4169.03 42.7075 12.3301 4236.46 43.1144 12.0439 4304.98 43.4794 11.7626 4374.62 43.8101 11.4863 4445.37 44.1104 11.2136 4517.27 44.3840 10.9460 4590.33 44.6343 10.6833 4664.58 44.8638 10.4251 4740.03 45.0746 10.1717 4816.69 45.2684 9.92324 4894.60 45.4468 9.67948 4973.77 45.6110 9.44039 5054.21 45.7624 9.20601 5135.96 45.9017 8.97641 5219.03 46.0301 8.75149 5303.44 46.1482 8.53119 5389.22 46.2569 8.31557 5476.39 46.3569 8.10442 5564.97 46.4485 7.89794 5654.98 46.5325 7.69578 5746.44 46.6094 7.49817 5839.39 46.6798 7.30492 5933.83 46.7438 7.11596 6029.81 46.8020 6.93126 6127.33 46.8547 6.75079 6226.44 46.9023 6.57444 6327.15 46.9451 6.40224 6429.48 46.9834 6.23409 6533.48 47.0175 6.06975 6639.15 47.0476 5.90945 6746.54 47.0741 5.75290 6855.65 47.0971 5.60018 6966.54 47.1167 5.45094 7079.22 47.1332 5.30552 7193.72 47.1469 5.16361 7310.07 47.1578 5.02523 7428.31 47.1663 4.89031 7548.45 47.1724 4.75869 7670.54 47.1763 4.63026 7794.61 47.1779 4.50510 7920.68 47.1777 4.38327 8048.79 47.1755 4.26427 8178.98 47.1718 4.14847 8311.26 47.1663 4.03554 8445.69 47.1593 3.92563 8582.29 47.1509 3.81844 8721.11 47.1413 3.71407 8862.16 47.1303 3.61232 9005.50 47.1181 3.51332 9151.16 47.1050 3.41702 9299.17 47.0910 3.32309 9449.58 47.0758 3.23157 9602.42 47.0597 3.14262 9757.73 47.0430 3.05603 9915.55 47.0254 2.97157 10075.9 47.0071 2.88946 10238.9 46.9881 2.80955 10404.5 46.9685 2.73178 10572.8 46.9483 2.65609 10743.8 46.9276 2.58245 10917.6 46.9064 2.51078 11094.2 46.8847 2.44106 11273.6 46.8626 2.37322 11455.9 46.8401 2.30723 11641.2 46.8171 2.24304 11829.5 46.7938 2.18059 12020.8 46.7702 2.11985 12215.3 46.7462 2.06077 12412.8 46.7218 2.00331 12613.6 46.6972 1.94743 12817.6 46.6723 1.89309 13025.0 46.6470 1.84024 13235.6 46.6215 1.78885 13449.7 46.5957 1.73889 13667.2 46.5696 1.69030 13888.3 46.5431 1.64307 14112.9 46.5164 1.59714 14341.2 46.4894 1.55249 14573.1 46.4620 1.50908 14808.9 46.4342 1.46688 15048.4 46.4061 1.42586 15291.8 46.3776 1.38599 15539.1 46.3486 1.34723 15790.4 46.3192 1.30955 16045.8 46.2892 1.27293 16305.4 46.2587 1.23733 16569.1 46.2276 1.20274 16837.1 46.1957 1.16911 17109.4 46.1632 1.13643 17386.1 46.1297 1.10467 17667.4 46.0954 1.07380 17953.1 46.0599 1.04381 18243.5 46.0233 1.01465 18538.6 45.9853 0.986325 18838.4 45.9458 0.958794 19143.1 45.9046 0.932041 19452.7 45.8614 0.906044 19767.4 45.8159 0.880780 20087.1 45.7677 0.856231 20412.0 45.7164 0.832377 20742.1 45.6615 0.809197 21077.6 45.6022 0.786673 21418.5 45.5377 0.764788 21765.0 45.4668 0.743521 22117.0 45.3880 0.722858 22474.7 45.2991 0.702780 22838.2 45.1973 0.683270 23207.6 45.0780 0.664314 23583.0 44.9342 0.645895 23964.4 44.7539 0.627998 24352.0 44.5141 0.610608 24745.9 44.1612 0.593712 25146.2 43.5138 0.577294 25513.9 35.7672 0.562829 25514.1 35.7674 3.56169 25552.9 41.4593 3.55330 25966.2 43.8729 3.46583 26386.1 44.5460 3.38000 26812.9 44.9598 3.29582 27246.6 45.2599 3.21329 27687.3 45.4949 3.13240 28135.1 45.6872 3.05314 28590.2 45.8492 2.97550 29052.6 45.9888 2.89948 29522.5 46.1180 2.82506 30000.0 46.1929 2.75222 periodictable-1.5.0/periodictable/xsf/al.nff000066400000000000000000000323501310514471200210210ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.11990 10.1617 -9999. 3.05822 10.3261 -9999. 2.99776 10.4931 -9999. 2.93850 10.6628 -9999. 2.88041 10.8353 -9999. 2.82347 11.0106 -9999. 2.76766 11.1886 -9999. 2.72200 11.3696 -9999. 2.69148 11.5535 -9999. 2.66129 11.7404 -9999. 2.63145 11.9303 -9999. 2.60195 12.1232 -9999. 2.57277 12.3193 -9999. 2.54392 12.5186 -9999. 2.51539 12.7210 -9999. 2.46668 12.9268 -9999. 2.41373 13.1359 -9999. 2.36192 13.3483 -9999. 2.30898 13.5642 -9999. 2.23405 13.7836 -9999. 2.15356 14.0066 -9999. 2.06069 14.2331 -9999. 1.96756 14.4633 -9999. 1.81305 14.6973 -9999. 1.35947 14.9350 -9999. 0.902011 15.1765 -9999. 0.609172 15.4220 -9999. 0.439681 15.6714 -9999. 0.372037 15.9249 -9999. 0.326005 16.1825 -9999. 0.285669 16.4442 -9999. 0.247205 16.7102 -9999. 0.213520 16.9805 -9999. 0.196522 17.2551 -9999. 0.181095 17.5342 -9999. 0.168385 17.8178 -9999. 0.160808 18.1060 -9999. 0.153573 18.3989 -9999. 0.146663 18.6964 -9999. 0.140063 18.9988 -9999. 0.133164 19.3061 -9999. 0.126575 19.6184 -9999. 0.120312 19.9357 -9999. 0.114360 20.2582 -9999. 0.109752 20.5858 -9999. 0.111010 20.9188 -9999. 0.112282 21.2571 -9999. 0.113569 21.6009 -9999. 0.114870 21.9503 -9999. 0.116186 22.3053 -9999. 0.117518 22.6661 -9999. 0.118864 23.0327 -9999. 0.120227 23.4053 -9999. 0.122751 23.7838 -9999. 0.126315 24.1685 -9999. 0.129984 24.5594 -9999. 0.133759 24.9566 -9999. 0.137643 25.3603 -9999. 0.141640 25.7705 -9999. 0.145495 26.1873 -9999. 0.148244 26.6109 -9999. 0.151045 27.0413 -9999. 0.153898 27.4786 -9999. 0.156806 27.9231 -9999. 0.159768 28.3747 -9999. 0.162787 28.8337 -9999. 0.165863 29.3000 2.34285 0.168996 29.7739 2.32717 0.172189 30.2555 2.31139 0.175442 30.7449 2.29552 0.178757 31.2421 2.27956 0.182134 31.7475 2.26350 0.185575 32.2609 2.24754 0.189081 32.7827 2.23175 0.192378 33.3130 2.21555 0.194561 33.8518 2.19843 0.196767 34.3993 2.18068 0.198999 34.9557 2.16235 0.201256 35.5211 2.14342 0.203539 36.0956 2.12388 0.205847 36.6794 2.10371 0.208182 37.2727 2.08287 0.210544 37.8755 2.06135 0.212932 38.4882 2.03911 0.215347 39.1107 2.01612 0.217789 39.7432 1.99237 0.220259 40.3861 1.96797 0.222758 41.0393 1.94295 0.225068 41.7031 1.91682 0.226470 42.3776 1.88912 0.227880 43.0630 1.86007 0.229299 43.7595 1.82966 0.230727 44.4673 1.79787 0.232164 45.1865 1.76466 0.233610 45.9174 1.73005 0.235064 46.6600 1.69399 0.236528 47.4147 1.65814 0.238001 48.1816 1.62074 0.235842 48.9609 1.57843 0.232104 49.7528 1.53229 0.228425 50.5576 1.48252 0.224805 51.3753 1.42904 0.221242 52.2062 1.37159 0.217735 53.0506 1.30972 0.214284 53.9087 1.24315 0.211759 54.7806 1.17229 0.209829 55.6667 1.09675 0.207917 56.5670 1.01559 0.206022 57.4820 0.928103 0.204145 58.4117 0.833427 0.202284 59.3564 0.729805 0.200441 60.3165 0.616720 0.200207 61.2921 0.494009 0.200602 62.2834 0.359171 0.200998 63.2908 0.206766 0.201394 64.3145 0.367838E-01 0.208215 65.3547 -0.150100 0.215821 66.4118 -0.363400 0.223705 67.4859 -0.612251 0.231878 68.5775 -0.913185 0.239512 69.6867 -1.29772 0.247287 70.8138 -1.83916 0.255315 71.9591 -2.82640 0.263603 72.6000 -4.71870 0.268298 72.8000 -4.77865 3.05391 73.1230 -3.57738 3.10106 74.3057 -2.58986 3.27808 75.5076 -2.24498 3.46521 76.7289 -2.04974 3.66301 77.9699 -1.91658 3.87212 79.2310 -1.81173 4.09316 80.5125 -1.71207 4.32681 81.8147 -1.61278 4.55877 83.1380 -1.51695 4.80227 84.4827 -1.40821 5.05877 85.8491 -1.24639 5.32897 87.2377 -1.04412 5.54566 88.6487 -0.869623 5.69070 90.0825 -0.729715 5.83953 91.5395 -0.602517 5.99225 93.0201 -0.481649 6.14897 94.5246 -0.363849 6.30978 96.0535 -0.246485 6.47480 97.6071 -0.127798 6.64413 99.1858 -0.572152E-02 6.81790 100.790 0.121587 6.99620 102.420 0.257648 7.17918 104.077 0.408417 7.36022 105.760 0.563135 7.52866 107.471 0.713525 7.70096 109.209 0.869599 7.87720 110.975 1.03257 8.05748 112.770 1.20465 8.24188 114.594 1.38785 8.43050 116.448 1.58511 8.62344 118.331 1.79993 8.82080 120.245 2.03832 9.02267 122.190 2.31105 9.22916 124.166 2.65726 9.44037 126.175 3.05450 9.49754 128.215 3.37636 9.51114 130.289 3.65455 9.52475 132.397 3.91635 9.53840 134.538 4.16654 9.55206 136.714 4.40886 9.56573 138.925 4.64594 9.57943 141.172 4.87987 9.59315 143.456 5.11258 9.60689 145.776 5.34618 9.62064 148.134 5.58438 9.63443 150.530 5.83549 9.64822 152.964 6.09089 9.62310 155.439 6.32655 9.59689 157.953 6.55613 9.57075 160.507 6.78302 9.54468 163.103 7.00948 9.51868 165.742 7.23759 9.49275 168.422 7.46980 9.46689 171.146 7.70942 9.44111 173.915 7.96219 9.41540 176.727 8.24313 9.38975 179.586 8.57964 9.31472 182.491 8.88946 9.13115 185.442 9.11623 8.95119 188.442 9.32069 8.77477 191.489 9.50496 8.60184 194.587 9.67311 8.43231 197.734 9.82798 8.26612 200.932 9.97197 8.10317 204.182 10.1053 7.93953 207.485 10.2265 7.77920 210.840 10.3376 7.62210 214.251 10.4388 7.46817 217.716 10.5299 7.31736 221.237 10.6083 7.16959 224.816 10.6680 7.03532 228.452 10.7284 6.92993 232.147 10.8042 6.82611 235.902 10.8811 6.72384 239.717 10.9592 6.62312 243.595 11.0380 6.52389 247.535 11.1176 6.42616 251.538 11.1983 6.32988 255.607 11.2808 6.23505 259.741 11.3664 6.14164 263.942 11.4630 6.04964 268.211 11.5725 5.94856 272.549 11.6747 5.80523 276.957 11.7511 5.66535 281.437 11.8159 5.52884 285.989 11.8724 5.39563 290.615 11.9222 5.26561 295.315 11.9664 5.13874 300.092 12.0058 5.01492 304.945 12.0408 4.89409 309.878 12.0718 4.77616 314.890 12.0993 4.66108 319.983 12.1235 4.54877 325.158 12.1445 4.43917 330.418 12.1625 4.33221 335.762 12.1777 4.22782 341.192 12.1900 4.12595 346.711 12.1992 4.02654 352.319 12.2049 3.92952 358.017 12.2045 3.83484 363.808 12.1998 3.75388 369.692 12.2008 3.67818 375.672 12.2048 3.60400 381.748 12.2097 3.53133 387.922 12.2152 3.46011 394.197 12.2210 3.39034 400.573 12.2270 3.32197 407.052 12.2333 3.25498 413.635 12.2399 3.18934 420.326 12.2470 3.12502 427.124 12.2549 3.06201 434.032 12.2652 3.00026 441.052 12.2773 2.93296 448.186 12.2849 2.86424 455.435 12.2892 2.79730 462.802 12.2920 2.73189 470.287 12.2937 2.66798 477.894 12.2943 2.60559 485.623 12.2945 2.54463 493.478 12.2942 2.48490 501.459 12.2939 2.42570 509.570 12.2928 2.36643 517.812 12.2896 2.30801 526.187 12.2852 2.25125 534.698 12.2801 2.19625 543.346 12.2748 2.14277 552.134 12.2700 2.09062 561.065 12.2653 2.03805 570.139 12.2592 1.98589 579.361 12.2522 1.93406 588.732 12.2437 1.88338 598.254 12.2344 1.83389 607.930 12.2243 1.78571 617.763 12.2138 1.73879 627.755 12.2034 1.69298 637.908 12.1929 1.64704 648.226 12.1814 1.60038 658.711 12.1674 1.55377 669.365 12.1491 1.50856 680.191 12.1287 1.46882 691.193 12.1108 1.43328 702.372 12.0954 1.39941 713.733 12.0820 1.36380 725.277 12.0674 1.32737 737.008 12.0514 1.29193 748.928 12.0350 1.25742 761.042 12.0181 1.22382 773.351 12.0009 1.19100 785.859 11.9834 1.15872 798.570 11.9652 1.12705 811.486 11.9463 1.09624 824.611 11.9269 1.06625 837.949 11.9070 1.03708 851.502 11.8866 1.00870 865.274 11.8656 0.981035 879.269 11.8441 0.954065 893.491 11.8220 0.927842 907.943 11.7992 0.902346 922.628 11.7759 0.877557 937.551 11.7519 0.853321 952.715 11.7270 0.829761 968.124 11.7013 0.806859 983.783 11.6747 0.784555 999.695 11.6472 0.762967 1015.86 11.6184 0.742081 1032.29 11.5888 0.722661 1048.99 11.5591 0.703173 1065.96 11.5278 0.683588 1083.20 11.4947 0.664537 1100.72 11.4600 0.646018 1118.52 11.4234 0.628015 1136.61 11.3849 0.610519 1155. 11.3440 0.593506 1173.68 11.3007 0.576965 1192.66 11.2544 0.560888 1211.95 11.2049 0.545258 1231.55 11.1516 0.530064 1251.47 11.0938 0.515441 1271.72 11.0310 0.501380 1292.29 10.9622 0.487892 1313.19 10.8865 0.474763 1334.43 10.8021 0.461987 1356.01 10.7069 0.449555 1377.94 10.5980 0.437459 1400.23 10.4713 0.425689 1422.88 10.3206 0.414239 1445.89 10.1361 0.403093 1469.28 9.90068 0.392100 1493.04 9.58044 0.381187 1517.19 9.09216 0.369680 1541.73 8.11537 0.358399 1559.50 1.89396 0.350553 1559.70 1.89589 4.16629 1566.67 7.10441 4.14105 1592.01 9.03572 4.05144 1617.76 9.80337 3.96379 1643.92 10.2995 3.87809 1670.51 10.6690 3.79420 1697.53 10.9642 3.71213 1724.99 11.2121 3.63182 1752.89 11.4254 3.54896 1781.24 11.6086 3.46653 1810.05 11.7695 3.38494 1839.32 11.9117 3.30527 1869.07 12.0391 3.22747 1899.30 12.1540 3.15148 1930.02 12.2583 3.07731 1961.24 12.3536 3.00489 1992.96 12.4408 2.93417 2025.20 12.5226 2.86696 2057.95 12.6001 2.79699 2091.24 12.6695 2.72803 2125.06 12.7334 2.66035 2159.43 12.7923 2.59405 2194.36 12.8467 2.52881 2229.85 12.8969 2.46498 2265.92 12.9433 2.40235 2302.57 12.9861 2.34101 2339.81 13.0257 2.28095 2377.66 13.0622 2.22204 2416.11 13.0960 2.16445 2455.19 13.1272 2.10810 2494.90 13.1560 2.05284 2535.26 13.1825 1.99885 2576.26 13.2068 1.94606 2617.93 13.2292 1.89447 2660.27 13.2498 1.84400 2703.30 13.2687 1.79474 2747.03 13.2859 1.74651 2791.46 13.3016 1.69945 2836.61 13.3159 1.65350 2882.49 13.3288 1.60862 2929.11 13.3405 1.56481 2976.48 13.3510 1.52204 3024.63 13.3604 1.48033 3073.55 13.3688 1.43961 3123.26 13.3762 1.39989 3173.78 13.3827 1.36116 3225.11 13.3883 1.32339 3277.27 13.3932 1.28657 3330.28 13.3973 1.25064 3384.15 13.4007 1.21564 3438.88 13.4034 1.18154 3494.50 13.4055 1.14831 3551.02 13.4070 1.11591 3608.46 13.4080 1.08436 3666.82 13.4085 1.05363 3726.13 13.4085 1.02369 3786.40 13.4081 0.994542 3847.64 13.4072 0.966167 3909.87 13.4060 0.938535 3973.11 13.4044 0.911645 4037.38 13.4025 0.885448 4102.68 13.4003 0.859966 4169.03 13.3978 0.835163 4236.46 13.3950 0.811033 4304.98 13.3920 0.787559 4374.62 13.3888 0.764708 4445.37 13.3853 0.742491 4517.27 13.3817 0.720878 4590.33 13.3779 0.699839 4664.58 13.3739 0.679399 4740.03 13.3698 0.659516 4816.69 13.3656 0.640176 4894.60 13.3612 0.621389 4973.77 13.3568 0.603106 5054.21 13.3522 0.585342 5135.96 13.3476 0.568080 5219.03 13.3429 0.551279 5303.44 13.3381 0.534968 5389.22 13.3332 0.519116 5476.39 13.3284 0.503715 5564.97 13.3235 0.488726 5654.98 13.3185 0.474187 5746.44 13.3135 0.460062 5839.39 13.3086 0.446336 5933.83 13.3036 0.433003 6029.81 13.2986 0.420026 6127.33 13.2936 0.407459 6226.44 13.2886 0.395224 6327.15 13.2836 0.383348 6429.48 13.2786 0.371815 6533.48 13.2737 0.360616 6639.15 13.2687 0.349739 6746.54 13.2638 0.339182 6855.65 13.2590 0.328927 6966.54 13.2541 0.318973 7079.22 13.2493 0.309309 7193.72 13.2446 0.299926 7310.07 13.2398 0.290817 7428.31 13.2352 0.281974 7548.45 13.2305 0.273391 7670.54 13.2259 0.265058 7794.61 13.2214 0.256972 7920.68 13.2169 0.249121 8048.79 13.2124 0.241506 8178.98 13.2081 0.234114 8311.26 13.2037 0.226938 8445.69 13.1994 0.219978 8582.29 13.1952 0.213218 8721.11 13.1910 0.206663 8862.16 13.1869 0.200304 9005.50 13.1829 0.194131 9151.16 13.1789 0.188140 9299.17 13.1749 0.182331 9449.58 13.1711 0.176693 9602.42 13.1672 0.171229 9757.73 13.1635 0.165921 9915.55 13.1598 0.160780 10075.9 13.1561 0.155788 10238.9 13.1526 0.150945 10404.5 13.1490 0.146248 10572.8 13.1456 0.141693 10743.8 13.1422 0.137274 10917.6 13.1388 0.132988 11094.2 13.1355 0.128831 11273.6 13.1323 0.124800 11455.9 13.1291 0.120890 11641.2 13.1260 0.117099 11829.5 13.1229 0.113422 12020.8 13.1199 0.109856 12215.3 13.1170 0.106398 12412.8 13.1141 0.103045 12613.6 13.1112 0.997941E-01 12817.6 13.1084 0.966416E-01 13025.0 13.1057 0.935848E-01 13235.6 13.1030 0.906209E-01 13449.7 13.1004 0.877473E-01 13667.2 13.0978 0.849611E-01 13888.3 13.0953 0.822598E-01 14112.9 13.0928 0.796408E-01 14341.2 13.0903 0.771018E-01 14573.1 13.0880 0.746402E-01 14808.9 13.0856 0.722539E-01 15048.4 13.0833 0.699405E-01 15291.8 13.0811 0.676979E-01 15539.1 13.0789 0.655240E-01 15790.4 13.0768 0.634165E-01 16045.8 13.0746 0.613737E-01 16305.4 13.0726 0.593935E-01 16569.1 13.0706 0.574741E-01 16837.1 13.0686 0.556136E-01 17109.4 13.0667 0.538102E-01 17386.1 13.0648 0.520623E-01 17667.4 13.0629 0.503681E-01 17953.1 13.0611 0.487260E-01 18243.5 13.0593 0.471345E-01 18538.6 13.0576 0.455920E-01 18838.4 13.0559 0.440970E-01 19143.1 13.0542 0.426482E-01 19452.7 13.0526 0.412440E-01 19767.4 13.0510 0.398831E-01 20087.1 13.0494 0.385533E-01 20412.0 13.0479 0.372771E-01 20742.1 13.0464 0.360423E-01 21077.6 13.0449 0.348475E-01 21418.5 13.0435 0.336915E-01 21765.0 13.0421 0.325731E-01 22117.0 13.0407 0.314909E-01 22474.7 13.0394 0.304440E-01 22838.2 13.0381 0.294311E-01 23207.6 13.0368 0.284511E-01 23583.0 13.0356 0.275030E-01 23964.4 13.0343 0.265858E-01 24352.0 13.0331 0.256985E-01 24745.9 13.0320 0.248401E-01 25146.2 13.0308 0.240097E-01 25552.9 13.0297 0.232064E-01 25966.2 13.0287 0.224293E-01 26386.1 13.0276 0.216776E-01 26812.9 13.0266 0.209505E-01 27246.6 13.0256 0.202471E-01 27687.3 13.0246 0.195668E-01 28135.1 13.0236 0.189087E-01 28590.2 13.0227 0.182722E-01 29052.6 13.0218 0.176565E-01 29522.5 13.0209 0.170611E-01 30000.0 13.0198 0.164852E-01 periodictable-1.5.0/periodictable/xsf/ar.nff000066400000000000000000000321261310514471200210300ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.949375E-15 10.1617 -9999. 0.964731E-15 10.3261 -9999. 0.980335E-15 10.4931 -9999. 0.996191E-15 10.6628 -9999. 0.101230E-14 10.8353 -9999. 0.102868E-14 11.0106 -9999. 0.104531E-14 11.1886 -9999. 0.106222E-14 11.3696 -9999. 0.107940E-14 11.5535 -9999. 0.109686E-14 11.7404 -9999. 0.111460E-14 11.9303 -9999. 0.113263E-14 12.1232 -9999. 0.115095E-14 12.3193 -9999. 0.116956E-14 12.5186 -9999. 0.118848E-14 12.7210 -9999. 0.120770E-14 12.9268 -9999. 0.122724E-14 13.1359 -9999. 0.124709E-14 13.3483 -9999. 0.126726E-14 13.5642 -9999. 0.128776E-14 13.7836 -9999. 0.130858E-14 14.0066 -9999. 0.132975E-14 14.2331 -9999. 0.135126E-14 14.4633 -9999. 0.137311E-14 14.6973 -9999. 0.139532E-14 14.9350 -9999. 0.141789E-14 15.1765 -9999. 0.144082E-14 15.4220 -9999. 0.146413E-14 15.6714 -9999. 0.148781E-14 15.7000 -9999. 0.149052E-14 15.9000 -9999. 7.37780 15.9249 -9999. 7.40169 16.1825 -9999. 7.65097 16.4442 -9999. 7.90865 16.7102 -9999. 8.17500 16.9805 -9999. 8.45033 17.2551 -9999. 8.71866 17.5342 -9999. 8.99489 17.8178 -9999. 9.27988 18.1060 -9999. 9.57390 18.3989 -9999. 9.87722 18.6964 -9999. 10.0769 18.9988 -9999. 10.2212 19.3061 -9999. 10.3675 19.6184 -9999. 10.5159 19.9357 -9999. 10.6665 20.2582 -9999. 10.8167 20.5858 -9999. 10.9668 20.9188 -9999. 11.1189 21.2571 -9999. 11.2731 21.6009 -9999. 11.4295 21.9503 -9999. 11.5880 22.3053 -9999. 11.7097 22.6661 -9999. 11.8098 23.0327 -9999. 11.9107 23.4053 -9999. 12.0125 23.7838 -9999. 12.1152 24.1685 -9999. 12.2187 24.5594 -9999. 12.3231 24.9566 -9999. 12.4285 25.3603 -9999. 12.5068 25.7705 -9999. 12.5003 26.1873 -9999. 12.4939 26.6109 -9999. 12.4875 27.0413 -9999. 12.4811 27.4786 -9999. 12.4746 27.9231 -9999. 12.4276 28.3747 -9999. 12.2749 28.8337 -9999. 12.1241 29.3000 7.16821 11.9752 29.7739 7.66932 11.8280 30.2555 8.27340 11.6127 30.7449 8.81707 11.2069 31.2421 9.21762 10.8152 31.7475 9.58113 10.4373 32.2609 9.92024 10.0726 32.7827 10.2556 9.72056 33.3130 10.6109 9.33987 33.8518 10.9293 8.90509 34.3993 11.1937 8.49054 34.9557 11.4568 8.09529 35.5211 11.7510 7.71845 36.0956 12.2163 7.34539 36.6794 12.5658 6.53408 37.2727 12.6642 5.81238 37.8755 12.8040 5.17039 38.4882 12.8512 4.33445 39.1107 12.6252 3.54127 39.7432 12.2858 2.89324 40.3861 11.9060 2.36379 41.0393 11.5048 1.93122 41.7031 11.1027 1.57782 42.3776 10.6932 1.29078 43.0630 10.3090 1.08938 43.7595 9.95151 0.919409 44.4673 9.59508 0.791494 45.1865 9.27243 0.726839 45.9174 8.98249 0.667465 46.6600 8.71430 0.649193 47.4147 8.48849 0.640955 48.1816 8.28327 0.632821 48.9609 8.09455 0.631336 49.7528 7.92147 0.630701 50.5576 7.75016 0.630240 51.3753 7.58985 0.648426 52.2062 7.44897 0.667137 53.0506 7.31746 0.686388 53.9087 7.19018 0.706194 54.7806 7.06923 0.733531 55.6667 6.95878 0.765241 56.5670 6.85645 0.798322 57.4820 6.76046 0.832833 58.4117 6.66879 0.868956 59.3564 6.58314 0.911925 60.3165 6.50575 0.957020 61.2921 6.43529 1.00435 62.2834 6.37198 1.05401 63.2908 6.31643 1.10613 64.3145 6.27180 1.16083 65.3547 6.23924 1.20753 66.4118 6.20776 1.24560 67.4859 6.17389 1.28488 68.5775 6.14316 1.32538 69.6867 6.11609 1.36717 70.8138 6.09323 1.41027 71.9591 6.08226 1.45474 73.1230 6.07497 1.48590 74.3057 6.06240 1.51689 75.5076 6.05142 1.54853 76.7289 6.04256 1.58083 77.9699 6.03653 1.61381 79.2310 6.03851 1.64747 80.5125 6.04560 1.67290 81.8147 6.04912 1.69023 83.1380 6.04944 1.70773 84.4827 6.04895 1.72541 85.8491 6.04836 1.74328 87.2377 6.04807 1.76133 88.6487 6.04839 1.77957 90.0825 6.04957 1.79800 91.5395 6.05193 1.81661 93.0201 6.05584 1.83542 94.5246 6.06176 1.85443 96.0535 6.07318 1.87363 97.6071 6.08987 1.88746 99.1858 6.10379 1.88943 100.790 6.11193 1.89139 102.420 6.11769 1.89336 104.077 6.12192 1.89533 105.760 6.12506 1.89730 107.471 6.12741 1.89927 109.209 6.12922 1.90125 110.975 6.13075 1.90322 112.770 6.13235 1.90520 114.594 6.13454 1.90718 116.448 6.13837 1.90917 118.331 6.14800 1.91115 120.245 6.16044 1.89697 122.190 6.16324 1.87609 124.166 6.15710 1.85544 126.175 6.14634 1.83502 128.215 6.13128 1.81482 130.289 6.11218 1.79485 132.397 6.08908 1.77509 134.538 6.06191 1.75556 136.714 6.02858 1.73624 138.925 5.99005 1.72085 141.172 5.95064 1.71079 143.456 5.91085 1.70079 145.776 5.86902 1.69085 148.134 5.82462 1.68096 150.530 5.77726 1.67114 152.964 5.72664 1.66137 155.439 5.67245 1.65166 157.953 5.61440 1.64200 160.507 5.55217 1.63240 163.103 5.48546 1.62286 165.742 5.41393 1.61338 168.422 5.33729 1.60394 171.146 5.25537 1.59457 173.915 5.16880 1.58525 176.727 5.07676 1.57121 179.586 4.97400 1.55385 182.491 4.85905 1.53667 185.442 4.73316 1.51969 188.442 4.59581 1.50289 191.489 4.44851 1.48628 194.587 4.28600 1.45771 197.734 4.09797 1.42787 200.932 3.88473 1.39864 204.182 3.64426 1.37000 207.485 3.37229 1.34195 210.840 3.06290 1.31448 214.251 2.70742 1.28885 217.716 2.29824 1.26755 221.237 1.82289 1.24660 224.816 1.25779 1.22600 228.452 0.569782 1.20574 232.147 -0.296219 1.18581 235.902 -1.44089 1.16544 239.717 -3.08671 1.14206 243.595 -5.87741 1.11916 247.535 -14.4571 1.09671 248.300 -25.6896 1.09244 248.500 -25.6342 17.6290 251.538 -7.08366 17.2582 255.607 -2.40344 16.7805 259.741 0.166927 16.3161 263.942 1.91869 15.8748 268.211 3.24484 15.5141 272.549 4.33175 15.1615 276.957 5.26029 14.8160 281.437 6.03813 14.4164 285.989 6.64307 14.0275 290.615 7.11879 13.6491 295.315 7.33982 13.2901 300.092 7.50143 13.3049 304.945 7.86258 13.3197 309.878 8.23435 13.3345 314.890 8.62413 13.3493 319.983 9.03010 13.3642 325.158 9.45508 13.3790 330.418 9.90596 13.3939 335.762 10.4258 13.4088 341.192 11.0469 13.3775 346.711 11.6410 13.0326 352.319 12.0564 12.6966 358.017 12.3689 12.3760 363.808 12.6364 12.1308 369.692 12.9140 11.8904 375.672 13.1707 11.6549 381.748 13.4117 11.4239 387.922 13.6365 11.1939 394.197 13.8435 10.9685 400.573 14.0357 10.7477 407.052 14.2135 10.5313 413.635 14.3773 10.3192 420.326 14.5262 10.1114 427.124 14.6550 9.90786 434.032 14.7656 9.73331 441.052 14.8826 9.57749 448.186 15.0071 9.42417 455.435 15.1301 9.27330 462.802 15.2514 9.12484 470.287 15.3706 8.97876 477.894 15.4874 8.83502 485.623 15.6020 8.69358 493.478 15.7147 8.55440 501.459 15.8258 8.41746 509.570 15.9359 8.28271 517.812 16.0459 8.15012 526.187 16.1633 8.01964 534.698 16.2826 7.87579 543.346 16.3899 7.72696 552.134 16.4946 7.58076 561.065 16.5968 7.42279 570.139 16.6841 7.26194 579.361 16.7596 7.10867 588.732 16.8307 6.96006 598.254 16.8983 6.81547 607.930 16.9630 6.67401 617.763 17.0256 6.53542 627.755 17.0871 6.39920 637.908 17.1496 6.26039 648.226 17.2072 6.11657 658.711 17.2530 5.97087 669.365 17.2871 5.82850 680.191 17.3113 5.70225 691.193 17.3398 5.58839 702.372 17.3800 5.47890 713.733 17.4241 5.36137 725.277 17.4608 5.23948 737.008 17.4930 5.12039 748.928 17.5228 5.00401 761.042 17.5514 4.89010 773.351 17.5813 4.77704 785.859 17.6101 4.66057 798.570 17.6318 4.54207 811.486 17.6481 4.42661 824.611 17.6607 4.31405 837.949 17.6700 4.20431 851.502 17.6761 4.09843 865.274 17.6804 3.99624 879.269 17.6839 3.89751 893.491 17.6866 3.80119 907.943 17.6884 3.70726 922.628 17.6898 3.61567 937.551 17.6906 3.52431 952.715 17.6894 3.43478 968.124 17.6866 3.34712 983.783 17.6823 3.26168 999.695 17.6768 3.17849 1015.86 17.6705 3.09750 1032.29 17.6641 3.01914 1048.99 17.6578 2.94133 1065.96 17.6497 2.86399 1083.20 17.6400 2.78871 1100.72 17.6292 2.71542 1118.52 17.6175 2.64404 1136.61 17.6050 2.57458 1155. 17.5919 2.50691 1173.68 17.5781 2.44096 1192.66 17.5637 2.37684 1211.95 17.5491 2.31438 1231.55 17.5341 2.25354 1251.47 17.5191 2.19371 1271.72 17.5035 2.13496 1292.29 17.4869 2.07717 1313.19 17.4695 2.02085 1334.43 17.4513 1.96606 1356.01 17.4325 1.91276 1377.94 17.4131 1.86093 1400.23 17.3932 1.81053 1422.88 17.3728 1.76153 1445.89 17.3518 1.71377 1469.28 17.3298 1.66758 1493.04 17.3071 1.62309 1517.19 17.2841 1.58151 1541.73 17.2620 1.54126 1566.67 17.2402 1.50205 1592.01 17.2184 1.46378 1617.76 17.1965 1.42649 1643.92 17.1745 1.39017 1670.51 17.1524 1.35477 1697.53 17.1301 1.32027 1724.99 17.1078 1.28665 1752.89 17.0853 1.25347 1781.24 17.0622 1.22101 1810.05 17.0386 1.18927 1839.32 17.0145 1.15836 1869.07 16.9898 1.12826 1899.30 16.9646 1.09895 1930.02 16.9389 1.07039 1961.24 16.9126 1.04257 1992.96 16.8855 1.01548 2025.20 16.8579 0.989487 2057.95 16.8299 0.963460 2091.24 16.8006 0.938054 2125.06 16.7703 0.913249 2159.43 16.7389 0.889031 2194.36 16.7062 0.865379 2229.85 16.6721 0.842275 2265.92 16.6364 0.819728 2302.57 16.5990 0.797721 2339.81 16.5597 0.776210 2377.66 16.5182 0.755213 2416.11 16.4743 0.734715 2455.19 16.4275 0.714694 2494.90 16.3775 0.695152 2535.26 16.3237 0.676050 2576.26 16.2657 0.657392 2617.93 16.2025 0.639191 2660.27 16.1334 0.621397 2703.30 16.0570 0.604026 2747.03 15.9718 0.587067 2791.46 15.8756 0.570498 2836.61 15.7656 0.554313 2882.49 15.6374 0.538497 2929.11 15.4846 0.523033 2976.48 15.2971 0.507955 3024.63 15.0567 0.493219 3073.55 14.7273 0.478818 3123.26 14.2181 0.464732 3173.78 13.1521 0.450984 3205.80 6.24201 0.442589 3206. 6.24309 4.24427 3225.11 12.6536 4.20735 3277.27 14.3229 4.10923 3330.28 15.0526 4.01218 3384.15 15.5322 3.91705 3438.88 15.8911 3.82343 3494.50 16.1776 3.73159 3551.02 16.4157 3.64110 3608.46 16.6183 3.55206 3666.82 16.7938 3.46483 3726.13 16.9480 3.37927 3786.40 17.0849 3.29525 3847.64 17.2072 3.21288 3909.87 17.3173 3.13212 3973.11 17.4169 3.05299 4037.38 17.5072 2.97543 4102.68 17.5894 2.89946 4169.03 17.6644 2.82509 4236.46 17.7330 2.75230 4304.98 17.7959 2.68108 4374.62 17.8535 2.61138 4445.37 17.9064 2.54318 4517.27 17.9550 2.47653 4590.33 17.9997 2.41134 4664.58 18.0407 2.34763 4740.03 18.0784 2.28537 4816.69 18.1131 2.22455 4894.60 18.1449 2.16515 4973.77 18.1741 2.10711 5054.21 18.2008 2.05046 5135.96 18.2253 1.99516 5219.03 18.2476 1.94116 5303.44 18.2681 1.88845 5389.22 18.2866 1.83704 5476.39 18.3035 1.78690 5564.97 18.3189 1.73800 5654.98 18.3327 1.69026 5746.44 18.3451 1.64375 5839.39 18.3563 1.59839 5933.83 18.3663 1.55414 6029.81 18.3751 1.51105 6127.33 18.3829 1.46904 6226.44 18.3897 1.42808 6327.15 18.3955 1.38820 6429.48 18.4005 1.34935 6533.48 18.4047 1.31151 6639.15 18.4082 1.27461 6746.54 18.4110 1.23868 6855.65 18.4130 1.20370 6966.54 18.4145 1.16969 7079.22 18.4155 1.13651 7193.72 18.4158 1.10426 7310.07 18.4158 1.07281 7428.31 18.4152 1.04224 7548.45 18.4142 1.01248 7670.54 18.4128 0.983540 7794.61 18.4110 0.955338 7920.68 18.4089 0.927890 8048.79 18.4065 0.901226 8178.98 18.4037 0.875280 8311.26 18.4007 0.850058 8445.69 18.3975 0.825508 8582.29 18.3941 0.801583 8721.11 18.3904 0.778350 8862.16 18.3865 0.755755 9005.50 18.3825 0.733792 9151.16 18.3783 0.712424 9299.17 18.3739 0.691653 9449.58 18.3695 0.671457 9602.42 18.3649 0.651829 9757.73 18.3602 0.632741 9915.55 18.3554 0.614198 10075.9 18.3505 0.596163 10238.9 18.3456 0.578635 10404.5 18.3406 0.561599 10572.8 18.3355 0.545041 10743.8 18.3304 0.528950 10917.6 18.3253 0.513313 11094.2 18.3201 0.498118 11273.6 18.3149 0.483353 11455.9 18.3097 0.469007 11641.2 18.3045 0.455068 11829.5 18.2993 0.441525 12020.8 18.2941 0.428368 12215.3 18.2889 0.415586 12412.8 18.2837 0.403169 12613.6 18.2786 0.391107 12817.6 18.2734 0.379390 13025.0 18.2683 0.368008 13235.6 18.2632 0.356953 13449.7 18.2581 0.346216 13667.2 18.2531 0.335787 13888.3 18.2481 0.325658 14112.9 18.2432 0.315820 14341.2 18.2382 0.306267 14573.1 18.2334 0.296989 14808.9 18.2286 0.287979 15048.4 18.2238 0.279229 15291.8 18.2191 0.270732 15539.1 18.2144 0.262482 15790.4 18.2098 0.254470 16045.8 18.2053 0.246691 16305.4 18.2007 0.239137 16569.1 18.1963 0.231803 16837.1 18.1919 0.224681 17109.4 18.1876 0.217767 17386.1 18.1833 0.211054 17667.4 18.1791 0.204536 17953.1 18.1749 0.198208 18243.5 18.1708 0.192065 18538.6 18.1668 0.186100 18838.4 18.1628 0.180310 19143.1 18.1589 0.174688 19452.7 18.1550 0.169231 19767.4 18.1512 0.163932 20087.1 18.1474 0.158795 20412.0 18.1437 0.153805 20742.1 18.1401 0.148966 21077.6 18.1365 0.144273 21418.5 18.1330 0.139723 21765.0 18.1295 0.135309 22117.0 18.1261 0.131031 22474.7 18.1227 0.126882 22838.2 18.1194 0.122859 23207.6 18.1162 0.118959 23583.0 18.1130 0.115178 23964.4 18.1099 0.111513 24352.0 18.1068 0.107960 24745.9 18.1038 0.104516 25146.2 18.1008 0.101178 25552.9 18.0979 0.979421E-01 25966.2 18.0951 0.948062E-01 26386.1 18.0923 0.917669E-01 26812.9 18.0895 0.888216E-01 27246.6 18.0868 0.859672E-01 27687.3 18.0842 0.832013E-01 28135.1 18.0816 0.805211E-01 28590.2 18.0791 0.779241E-01 29052.6 18.0766 0.754079E-01 29522.5 18.0742 0.729699E-01 30000.0 18.0718 0.706080E-01 periodictable-1.5.0/periodictable/xsf/as.nff000066400000000000000000000315431310514471200210330ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 4.62596 10.1617 -9999. 4.67742 10.3261 -9999. 4.72945 10.4931 -9999. 4.78206 10.6628 -9999. 4.83525 10.8353 -9999. 4.88904 11.0106 -9999. 4.94342 11.1886 -9999. 4.99841 11.3696 -9999. 5.05401 11.5535 -9999. 5.11023 11.7404 -9999. 5.16708 11.9303 -9999. 5.22456 12.1232 -9999. 5.28267 12.3193 -9999. 5.31932 12.5186 -9999. 5.31541 12.7210 -9999. 5.31150 12.9268 -9999. 5.30759 13.1359 -9999. 5.30369 13.3483 -9999. 5.29978 13.5642 -9999. 5.29589 13.7836 -9999. 5.29199 14.0066 -9999. 5.28751 14.2331 -9999. 5.28080 14.4633 -9999. 5.27410 14.6973 -9999. 5.26741 14.9350 -9999. 5.26072 15.1765 -9999. 5.25404 15.4220 -9999. 5.24738 15.6714 -9999. 5.24072 15.9249 -9999. 5.23407 16.1825 -9999. 5.22742 16.4442 -9999. 5.15507 16.7102 -9999. 5.06546 16.9805 -9999. 4.97741 17.2551 -9999. 4.89090 17.5342 -9999. 4.80588 17.8178 -9999. 4.72235 18.1060 -9999. 4.64026 18.3989 -9999. 4.53714 18.6964 -9999. 4.37679 18.9988 -9999. 4.22210 19.3061 -9999. 4.07288 19.6184 -9999. 3.92893 19.9357 -9999. 3.79007 20.2582 -9999. 3.65612 20.5858 -9999. 3.52329 20.9188 -9999. 3.39393 21.2571 -9999. 3.26932 21.6009 -9999. 3.14929 21.9503 -9999. 3.03366 22.3053 -9999. 2.88009 22.6661 -9999. 2.71399 23.0327 -9999. 2.55747 23.4053 -9999. 2.40998 23.7838 -9999. 2.27099 24.1685 -9999. 2.14002 24.5594 -9999. 2.01335 24.9566 -9999. 1.89149 25.3603 -9999. 1.77702 25.7705 -9999. 1.66947 26.1873 -9999. 1.56843 26.6109 -9999. 1.47351 27.0413 -9999. 1.37723 27.4786 -9999. 1.28202 27.9231 -9999. 1.19340 28.3747 -9999. 1.11090 28.8337 -9999. 1.03411 29.3000 6.58480 0.968319 29.7739 6.50149 0.916166 30.2555 6.42175 0.866823 30.7449 6.34270 0.820138 31.2421 6.26381 0.775967 31.7475 6.18643 0.734175 32.2609 6.10805 0.684550 32.7827 6.01692 0.635642 33.3130 5.91271 0.590347 33.8518 5.80605 0.567907 34.3993 5.70259 0.546319 34.9557 5.59388 0.527579 35.5211 5.48400 0.517980 36.0956 5.36967 0.508556 36.6794 5.24292 0.508966 37.2727 5.11497 0.517035 37.8755 4.97518 0.539057 38.4882 4.82707 0.569786 39.1107 4.64548 0.643758 39.7432 4.50161 0.766203 40.3861 4.38743 0.911940 41.0393 4.31305 1.07785 41.7031 4.28570 1.26123 42.3776 4.33582 1.39611 43.0630 4.39229 1.49928 43.7595 4.44656 1.51243 44.4673 4.45697 1.51714 45.1865 4.44758 1.52187 45.9174 4.42836 1.52316 46.6600 4.39149 1.51765 47.4147 4.33769 1.51216 48.1816 4.26228 1.50669 48.9609 4.14655 1.52291 49.7528 4.04859 1.57707 50.5576 3.96047 1.63316 51.3753 3.86962 1.69125 52.2062 3.76530 1.76089 53.0506 3.67160 1.84975 53.9087 3.58491 1.94308 54.7806 3.50091 2.04112 55.6667 3.41812 2.14411 56.5670 3.33371 2.25553 57.4820 3.25526 2.37750 58.4117 3.18186 2.50606 59.3564 3.11345 2.64157 60.3165 3.05149 2.78441 61.2921 3.00010 2.93498 62.2834 2.95565 3.07900 63.2908 2.91053 3.22779 64.3145 2.86898 3.38378 65.3547 2.83353 3.54730 66.4118 2.80821 3.71872 67.4859 2.80285 3.89844 68.5775 2.81237 4.05153 69.6867 2.80932 4.19949 70.8138 2.80338 4.35284 71.9591 2.79878 4.51180 73.1230 2.79918 4.67657 74.3057 2.81233 4.84610 75.5076 2.82603 4.99971 76.7289 2.83488 5.15819 77.9699 2.84378 5.32169 79.2310 2.85452 5.49038 80.5125 2.86840 5.66441 81.8147 2.88654 5.84396 83.1380 2.91036 6.02920 84.4827 2.94172 6.22031 85.8491 2.98592 6.41748 87.2377 3.05109 6.60275 88.6487 3.10712 6.77774 90.0825 3.15965 6.95736 91.5395 3.21489 7.14175 93.0201 3.27457 7.33102 94.5246 3.34070 7.52530 96.0535 3.41590 7.72473 97.6071 3.50767 7.92946 99.1858 3.62493 8.11231 100.790 3.72675 8.27853 102.420 3.82010 8.44815 104.077 3.91329 8.62126 105.760 4.00796 8.79790 107.471 4.10573 8.97817 109.209 4.20869 9.16212 110.975 4.31860 9.34518 112.770 4.42924 9.52799 114.594 4.54308 9.71439 116.448 4.66181 9.90442 118.331 4.78694 10.0982 120.245 4.92034 10.2957 122.190 5.06696 10.4971 124.166 5.23418 10.6848 126.175 5.39362 10.8604 128.215 5.54958 11.0388 130.289 5.70858 11.2202 132.397 5.87214 11.4045 134.538 6.04173 11.5919 136.714 6.21878 11.7824 138.925 6.40509 11.9760 141.172 6.60296 12.1727 143.456 6.81677 12.3728 145.776 7.06119 12.5761 148.134 7.34059 12.7351 150.530 7.59109 12.8589 152.964 7.82849 12.9840 155.439 8.06178 13.1103 157.953 8.29471 13.2378 160.507 8.52977 13.3666 163.103 8.76980 13.4965 165.742 9.02503 13.6241 168.422 9.27761 13.7343 171.146 9.52616 13.8454 173.915 9.77643 13.9574 176.727 10.0305 14.0703 179.586 10.2902 14.1841 182.491 10.5577 14.2988 185.442 10.8369 14.4145 188.442 11.1542 14.5311 191.489 11.4492 14.5715 194.587 11.7208 14.6486 197.734 11.9934 14.7407 200.932 12.2903 14.8454 204.182 12.6107 14.9511 207.485 12.9626 15.0574 210.840 13.3850 15.1643 214.251 13.8167 15.1280 217.716 14.2179 15.0612 221.237 14.5657 14.9705 224.816 14.8858 14.8805 228.452 15.1880 14.7910 232.147 15.4764 14.7019 235.902 15.7541 14.6134 239.717 16.0230 14.5256 243.595 16.2850 14.4384 247.535 16.5412 14.3515 251.538 16.7926 14.2651 255.607 17.0403 14.1791 259.741 17.2856 14.0939 263.942 17.5302 14.0092 268.211 17.7762 13.9249 272.549 18.0286 13.8410 276.957 18.3009 13.7377 281.437 18.5585 13.6104 285.989 18.7960 13.4683 290.615 19.0174 13.3255 295.315 19.2265 13.1846 300.092 19.4268 13.0448 304.945 19.6193 12.9066 309.878 19.8054 12.7700 314.890 19.9857 12.6346 319.983 20.1606 12.5006 325.158 20.3306 12.3680 330.418 20.4964 12.2373 335.762 20.6587 12.1079 341.192 20.8176 11.9796 346.711 20.9733 11.8526 352.319 21.1263 11.7270 358.017 21.2774 11.6029 363.808 21.4268 11.4798 369.692 21.5749 11.3580 375.672 21.7232 11.2377 381.748 21.8737 11.1186 387.922 22.0309 10.9970 394.197 22.1945 10.8686 400.573 22.3552 10.7162 407.052 22.4965 10.5560 413.635 22.6253 10.3978 420.326 22.7456 10.2422 427.124 22.8592 10.0890 434.032 22.9680 9.93846 441.052 23.0726 9.78966 448.186 23.1759 9.64207 455.435 23.2745 9.49261 462.802 23.3679 9.34204 470.287 23.4550 9.19197 477.894 23.5359 9.04395 485.623 23.6122 8.89855 493.478 23.6847 8.75560 501.459 23.7539 8.61510 509.570 23.8205 8.47678 517.812 23.8859 8.34005 526.187 23.9495 8.20331 534.698 24.0101 8.06476 543.346 24.0653 7.92655 552.134 24.1184 7.79076 561.065 24.1686 7.65049 570.139 24.2101 7.50992 579.361 24.2453 7.37433 588.732 24.2768 7.24206 598.254 24.3057 7.11270 607.930 24.3320 6.98562 617.763 24.3564 6.86082 627.755 24.3809 6.73778 637.908 24.4047 6.61126 648.226 24.4239 6.47875 658.711 24.4306 6.34346 669.365 24.4238 6.21097 680.191 24.4056 6.09532 691.193 24.3908 5.99258 702.372 24.3872 5.89425 713.733 24.3863 5.78824 725.277 24.3780 5.67781 737.008 24.3640 5.56959 748.928 24.3461 5.46339 761.042 24.3249 5.35912 773.351 24.3012 5.25587 785.859 24.2740 5.15157 798.570 24.2402 5.04684 811.486 24.2004 4.94425 824.611 24.1553 4.84371 837.949 24.1051 4.74520 851.502 24.0495 4.64821 865.274 23.9884 4.55276 879.269 23.9210 4.45888 893.491 23.8472 4.36687 907.943 23.7667 4.27681 922.628 23.6798 4.18867 937.551 23.5850 4.10056 952.715 23.4813 4.01395 968.124 23.3677 3.92886 983.783 23.2435 3.84551 999.695 23.1077 3.76402 1015.86 22.9591 3.68437 1032.29 22.7970 3.60698 1048.99 22.6193 3.53036 1065.96 22.4225 3.45446 1083.20 22.2040 3.38029 1100.72 21.9601 3.30767 1118.52 21.6863 3.23656 1136.61 21.3764 3.16708 1155. 21.0221 3.09908 1173.68 20.6118 3.03254 1192.66 20.1289 2.96728 1211.95 19.5479 2.90349 1231.55 18.8281 2.84117 1251.47 17.8969 2.78039 1271.72 16.6060 2.72110 1292.29 14.5682 2.66332 1313.19 9.94240 2.60676 1323.50 -10.3277 2.57963 1323.70 -10.3191 16.4311 1334.43 10.4900 16.2725 1356.01 15.5371 15.9618 1377.94 17.9553 15.6569 1400.23 19.5599 15.3578 1422.88 20.7456 15.0644 1445.89 21.6596 14.7768 1469.28 22.3592 14.4951 1493.04 22.8321 14.2193 1517.19 22.7982 13.9488 1526.90 20.2859 13.8426 1527.10 20.2925 15.7546 1541.73 23.7309 15.5518 1566.67 24.9157 15.2164 1592.01 25.7310 14.8881 1617.76 26.3969 14.5669 1643.92 26.9712 14.2527 1670.51 27.4804 13.9452 1697.53 27.9401 13.6443 1724.99 28.3637 13.3500 1752.89 28.7528 13.0487 1781.24 29.1071 12.7497 1810.05 29.4284 12.4541 1839.32 29.7222 12.1653 1869.07 29.9926 11.8833 1899.30 30.2427 11.6080 1930.02 30.4745 11.3387 1961.24 30.6901 11.0758 1992.96 30.8892 10.8192 2025.20 31.0814 10.5744 2057.95 31.2636 10.3223 2091.24 31.4305 10.0742 2125.06 31.5841 9.83089 2159.43 31.7266 9.59263 2194.36 31.8585 9.35857 2229.85 31.9808 9.12957 2265.92 32.0942 8.90515 2302.57 32.1993 8.68526 2339.81 32.2962 8.46975 2377.66 32.3858 8.25918 2416.11 32.4686 8.05289 2455.19 32.5449 7.85100 2494.90 32.6151 7.65350 2535.26 32.6795 7.46014 2576.26 32.7383 7.27115 2617.93 32.7920 7.08633 2660.27 32.8407 6.90567 2703.30 32.8851 6.72950 2747.03 32.9253 6.55696 2791.46 32.9615 6.38852 2836.61 32.9936 6.22360 2882.49 33.0222 6.06320 2929.11 33.0476 5.90606 2976.48 33.0698 5.75282 3024.63 33.0888 5.60288 3073.55 33.1050 5.45711 3123.26 33.1187 5.31436 3173.78 33.1298 5.17522 3225.11 33.1386 5.03945 3277.27 33.1451 4.90699 3330.28 33.1496 4.77772 3384.15 33.1521 4.65164 3438.88 33.1527 4.52871 3494.50 33.1516 4.40881 3551.02 33.1488 4.29189 3608.46 33.1445 4.17785 3666.82 33.1388 4.06672 3726.13 33.1317 3.95841 3786.40 33.1234 3.85275 3847.64 33.1138 3.74982 3909.87 33.1032 3.64949 3973.11 33.0915 3.55169 4037.38 33.0788 3.45642 4102.68 33.0652 3.36358 4169.03 33.0507 3.27315 4236.46 33.0355 3.18503 4304.98 33.0195 3.09915 4374.62 33.0028 3.01551 4445.37 32.9854 2.93405 4517.27 32.9674 2.85471 4590.33 32.9488 2.77744 4664.58 32.9297 2.70218 4740.03 32.9101 2.62882 4816.69 32.8900 2.55745 4894.60 32.8694 2.48796 4973.77 32.8484 2.42027 5054.21 32.8271 2.35440 5135.96 32.8054 2.29024 5219.03 32.7833 2.22777 5303.44 32.7609 2.16689 5389.22 32.7381 2.10769 5476.39 32.7150 2.05008 5564.97 32.6916 1.99396 5654.98 32.6680 1.93929 5746.44 32.6440 1.88612 5839.39 32.6197 1.83437 5933.83 32.5952 1.78399 6029.81 32.5703 1.73491 6127.33 32.5452 1.68727 6226.44 32.5198 1.64080 6327.15 32.4940 1.59559 6429.48 32.4680 1.55160 6533.48 32.4416 1.50872 6639.15 32.4149 1.46703 6746.54 32.3877 1.42647 6855.65 32.3602 1.38698 6966.54 32.3323 1.34861 7079.22 32.3039 1.31117 7193.72 32.2750 1.27479 7310.07 32.2455 1.23936 7428.31 32.2154 1.20490 7548.45 32.1847 1.17136 7670.54 32.1533 1.13871 7794.61 32.1211 1.10695 7920.68 32.0880 1.07604 8048.79 32.0539 1.04595 8178.98 32.0188 1.01667 8311.26 31.9824 0.988193 8445.69 31.9447 0.960474 8582.29 31.9055 0.933474 8721.11 31.8645 0.907218 8862.16 31.8216 0.881665 9005.50 31.7765 0.856803 9151.16 31.7289 0.832600 9299.17 31.6782 0.809046 9449.58 31.6242 0.786113 9602.42 31.5662 0.763808 9757.73 31.5034 0.742093 9915.55 31.4350 0.720972 10075.9 31.3597 0.700403 10238.9 31.2760 0.680383 10404.5 31.1816 0.660898 10572.8 31.0736 0.641932 10743.8 30.9475 0.623472 10917.6 30.7963 0.605504 11094.2 30.6087 0.588014 11273.6 30.3635 0.570989 11455.9 30.0146 0.554417 11641.2 29.4268 0.538285 11829.5 27.5708 0.522580 11866.6 21.2382 0.519571 11866.8 21.2385 3.89295 12020.8 29.2007 3.81789 12215.3 30.1347 3.72654 12412.8 30.6593 3.63671 12613.6 31.0279 3.54840 12817.6 31.3121 3.46164 13025.0 31.5428 3.37642 13235.6 31.7361 3.29277 13449.7 31.9017 3.21069 13667.2 32.0458 3.13016 13888.3 32.1726 3.05120 14112.9 32.2852 2.97380 14341.2 32.3859 2.89796 14573.1 32.4764 2.82366 14808.9 32.5581 2.75090 15048.4 32.6321 2.67966 15291.8 32.6994 2.60995 15539.1 32.7606 2.54173 15790.4 32.8165 2.47500 16045.8 32.8675 2.40974 16305.4 32.9140 2.34594 16569.1 32.9566 2.28358 16837.1 32.9956 2.22263 17109.4 33.0312 2.16308 17386.1 33.0638 2.10492 17667.4 33.0936 2.04811 17953.1 33.1207 1.99264 18243.5 33.1455 1.93849 18538.6 33.1681 1.88564 18838.4 33.1886 1.83407 19143.1 33.2072 1.78375 19452.7 33.2241 1.73466 19767.4 33.2393 1.68678 20087.1 33.2530 1.64008 20412.0 33.2652 1.59455 20742.1 33.2762 1.55017 21077.6 33.2859 1.50690 21418.5 33.2945 1.46474 21765.0 33.3019 1.42364 22117.0 33.3084 1.38361 22474.7 33.3140 1.34460 22838.2 33.3187 1.30661 23207.6 33.3225 1.26960 23583.0 33.3257 1.23356 23964.4 33.3281 1.19847 24352.0 33.3298 1.16430 24745.9 33.3310 1.13104 25146.2 33.3316 1.09866 25552.9 33.3316 1.06715 25966.2 33.3312 1.03648 26386.1 33.3303 1.00664 26812.9 33.3290 0.977596 27246.6 33.3273 0.949343 27687.3 33.3252 0.921857 28135.1 33.3228 0.895120 28590.2 33.3201 0.869114 29052.6 33.3171 0.843822 29522.5 33.3138 0.819225 30000.0 33.3103 0.795307 periodictable-1.5.0/periodictable/xsf/at.nff000066400000000000000000000321351310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 8.78144 10.1617 -9999. 8.87321 10.3261 -9999. 8.96593 10.4931 -9999. 9.04836 10.6628 -9999. 9.08532 10.8353 -9999. 9.12244 11.0106 -9999. 9.15970 11.1886 -9999. 9.19330 11.3696 -9999. 9.15142 11.5535 -9999. 9.10973 11.7404 -9999. 9.06823 11.9303 -9999. 9.02692 12.1232 -9999. 8.98581 12.3193 -9999. 8.94487 12.5186 -9999. 8.90413 12.7210 -9999. 8.86060 12.9268 -9999. 8.81284 13.1359 -9999. 8.76533 13.3483 -9999. 8.71808 13.5642 -9999. 8.67108 13.7836 -9999. 8.62434 14.0066 -9999. 8.57785 14.2331 -9999. 8.53090 14.4633 -9999. 8.48417 14.6973 -9999. 8.43768 14.9350 -9999. 8.39145 15.1765 -9999. 8.34548 15.4220 -9999. 8.29976 15.6714 -9999. 8.25429 15.9249 -9999. 8.20906 16.1825 -9999. 8.16198 16.4442 -9999. 8.11444 16.7102 -9999. 8.06719 16.9805 -9999. 8.02021 17.2551 -9999. 7.97351 17.5342 -9999. 7.92707 17.8178 -9999. 7.87530 18.1060 -9999. 7.77246 18.3989 -9999. 7.67096 18.6964 -9999. 7.57079 18.9988 -9999. 7.47192 19.3061 -9999. 7.37434 19.6184 -9999. 7.27804 19.9357 -9999. 7.12095 20.2582 -9999. 6.95257 20.5858 -9999. 6.78818 20.9188 -9999. 6.62767 21.2571 -9999. 6.46967 21.6009 -9999. 6.25684 21.9503 -9999. 6.05101 22.3053 -9999. 5.85195 22.6661 -9999. 5.65944 23.0327 -9999. 5.47326 23.4053 -9999. 5.29321 23.7838 -9999. 5.09702 24.1685 -9999. 4.86437 24.5594 -9999. 4.64233 24.9566 -9999. 4.43042 25.3603 -9999. 4.22819 25.7705 -9999. 4.03519 26.1873 -9999. 3.85100 26.6109 -9999. 3.61598 27.0413 -9999. 3.36080 27.4786 -9999. 3.12362 27.9231 -9999. 2.90318 28.3747 -9999. 2.69830 28.8337 -9999. 2.54915 29.3000 5.49962 2.43523 29.7739 5.27913 2.32640 30.2555 5.05622 2.25148 30.7449 4.84579 2.18201 31.2421 4.63754 2.11410 31.7475 4.42351 2.04636 32.2609 4.19951 1.98079 32.7827 3.96287 1.92159 33.3130 3.71232 1.86568 33.8518 3.43123 1.81485 34.3993 3.14421 1.82042 34.9557 2.86521 1.82600 35.5211 2.57343 1.83756 36.0956 2.28104 1.87157 36.6794 1.98418 1.90621 37.2727 1.66379 1.94150 37.8755 1.33234 2.02616 38.4882 1.00725 2.11514 39.1107 0.674212 2.20804 39.7432 0.322010 2.31810 40.3861 -0.340927E-01 2.44332 41.0393 -0.407025 2.57531 41.7031 -0.813161 2.72667 42.3776 -1.22845 2.90695 43.0630 -1.66735 3.09915 43.7595 -2.16488 3.30550 44.4673 -2.68641 3.63941 45.1865 -3.18944 4.00704 45.9174 -3.69481 4.41182 46.6600 -4.22642 4.88002 47.4147 -4.73564 5.42624 48.1816 -5.22429 6.03359 48.9609 -5.67958 6.70891 49.7528 -6.09790 7.40624 50.5576 -6.52062 8.15609 51.3753 -6.92777 8.98187 52.2062 -7.30629 9.89126 53.0506 -7.64532 10.8951 53.9087 -7.90647 12.0296 54.7806 -8.01747 13.2822 55.6667 -7.82666 14.6653 56.5670 -7.47546 15.6298 57.4820 -7.24516 16.5891 58.4117 -7.01197 17.6072 59.3564 -6.70400 18.6879 60.3165 -6.26379 19.7160 61.2921 -5.84568 20.7093 62.2834 -5.38508 21.7526 63.2908 -4.82824 22.8485 64.3145 -4.06262 23.9808 65.3547 -3.24069 24.8170 66.4118 -2.45145 25.6823 67.4859 -1.61431 26.5778 68.5775 -0.600281 27.4743 69.6867 0.421181 28.0817 70.8138 1.38149 28.7026 71.9591 2.33903 29.3372 73.1230 3.34521 29.9858 74.3057 4.46677 30.6042 75.5076 5.59524 31.1541 76.7289 6.76935 31.7138 77.9699 8.06059 32.2836 79.2310 9.61324 32.8636 80.5125 11.4548 32.9161 81.8147 12.9277 32.6485 83.1380 14.2299 32.3831 84.4827 15.4488 32.1155 85.8491 16.6209 31.8486 87.2377 17.7774 31.5839 88.6487 18.9640 31.3214 90.0825 20.3132 31.0611 91.5395 21.6748 30.3481 93.0201 22.7549 29.5469 94.5246 23.6896 28.7669 96.0535 24.5352 28.0075 97.6071 25.3221 27.2681 99.1858 26.0808 26.5483 100.790 26.8830 25.8200 102.420 27.5851 24.9127 104.077 28.1711 24.0372 105.760 28.6850 23.1926 107.471 29.1645 22.3776 109.209 29.6503 21.5912 110.975 30.2792 20.7333 112.770 30.6737 19.5574 114.594 30.8537 18.4482 116.448 30.8846 17.4020 118.331 30.7869 16.4151 120.245 30.4646 15.4841 122.190 30.1578 14.9842 124.166 29.9957 14.5113 126.175 29.8880 14.0533 128.215 29.8092 13.6097 130.289 29.7505 13.1802 132.397 29.7091 12.7642 134.538 29.6874 12.3613 136.714 29.6966 11.9712 138.925 29.7900 11.5933 141.172 29.8542 11.0062 143.456 29.8260 10.4415 145.776 29.7409 9.90586 148.134 29.6328 9.39767 150.530 29.5202 8.91553 152.964 29.4531 8.45814 155.439 29.3617 7.83226 157.953 29.1431 7.21498 160.507 28.8335 6.64635 163.103 28.4666 6.12251 165.742 28.0177 5.68111 168.422 27.6008 5.33105 171.146 27.2058 5.00258 173.915 26.8070 4.69433 176.727 26.4002 4.40277 179.586 25.9758 4.12749 182.491 25.5226 3.86942 185.442 24.9913 3.67032 188.442 24.5258 3.58621 191.489 24.0995 3.50403 194.587 23.6860 3.42373 197.734 23.2604 3.34891 200.932 22.8479 3.32075 204.182 22.4488 3.29282 207.485 22.0467 3.26513 210.840 21.6259 3.26093 214.251 21.2242 3.28454 217.716 20.8280 3.30833 221.237 20.4234 3.33229 224.816 19.9830 3.37397 228.452 19.5611 3.46177 232.147 19.1472 3.55186 235.902 18.7279 3.64429 239.717 18.2865 3.74271 243.595 17.8398 3.87411 247.535 17.3860 4.01013 251.538 16.9138 4.15092 255.607 16.4088 4.29666 259.741 15.8314 4.44751 263.942 15.1353 4.70722 268.211 14.5041 5.12724 272.549 13.9158 5.58476 276.957 13.3402 6.08308 281.437 12.7759 6.63591 285.989 12.2168 7.24017 290.615 11.6290 7.89948 295.315 11.0699 8.76865 300.092 10.6326 9.75296 304.945 10.4210 10.8477 309.878 10.4563 11.7921 314.890 10.4129 12.5719 319.983 10.3487 13.4032 325.158 10.3991 14.2617 330.418 10.4353 15.0265 335.762 10.4454 15.8322 341.192 10.4813 16.6812 346.711 10.5777 17.5683 352.319 10.7235 18.4748 358.017 10.9468 19.4282 363.808 11.3809 20.3708 369.692 11.7767 21.0935 375.672 12.1389 21.8418 381.748 12.5165 22.6166 387.922 12.9458 23.4189 394.197 13.5828 24.1665 400.573 14.1469 24.7236 407.052 14.6249 25.2936 413.635 15.0986 25.8767 420.326 15.5817 26.4732 427.124 16.0870 27.0834 434.032 16.7007 27.6758 441.052 17.2814 28.1657 448.186 17.8187 28.6644 455.435 18.3566 29.1718 462.802 18.9024 29.6883 470.287 19.4631 30.2138 477.894 20.0448 30.7487 485.623 20.6543 31.2926 493.478 21.2997 31.8462 501.459 21.9936 32.4096 509.570 22.7576 32.9830 517.812 23.6683 33.5665 526.187 24.6918 33.8865 534.698 25.6081 34.0714 543.346 26.4216 34.2573 552.134 27.2100 34.4426 561.065 27.9856 34.6279 570.139 28.7610 34.8141 579.361 29.5523 35.0014 588.732 30.4166 35.1655 598.254 31.2148 35.2113 607.930 31.9885 35.2934 617.763 32.7778 35.3744 627.755 33.6099 35.4487 637.908 34.4772 35.4480 648.226 35.3418 35.3458 658.711 36.1191 35.1771 669.365 36.8442 35.0094 680.191 37.5407 34.8310 691.193 38.2129 34.6426 702.372 38.8700 34.4358 713.733 39.4986 34.1792 725.277 40.0502 33.8896 737.008 40.5326 33.6024 748.928 40.9432 33.3174 761.042 41.2448 33.0433 773.351 41.3801 32.8619 785.859 41.4377 32.9725 798.570 41.7326 33.3278 811.486 42.2143 33.6869 824.611 42.8443 34.0497 837.949 43.6805 34.4165 851.502 44.7134 34.5665 865.274 45.8313 34.4416 879.269 46.7373 34.0727 893.491 47.5042 33.7077 907.943 48.2005 33.3466 922.628 48.8578 32.9893 937.551 49.4744 32.6073 952.715 50.0505 32.2220 968.124 50.5861 31.8346 983.783 51.0901 31.4522 999.695 51.5685 31.0722 1015.86 52.0270 30.6946 1032.29 52.4395 30.3008 1048.99 52.8107 29.9430 1065.96 53.1859 29.6232 1083.20 53.5632 29.3064 1100.72 53.9359 28.9925 1118.52 54.3027 28.6816 1136.61 54.6635 28.3735 1155. 55.0191 28.0685 1173.68 55.3710 27.7665 1192.66 55.7205 27.4668 1211.95 56.0711 27.1702 1231.55 56.4336 26.8765 1251.47 56.8078 26.5555 1271.72 57.1829 26.2038 1292.29 57.5158 25.8144 1313.19 57.8145 25.4303 1334.43 58.0911 25.0515 1356.01 58.3500 24.6777 1377.94 58.5936 24.3091 1400.23 58.8242 23.9455 1422.88 59.0437 23.5868 1445.89 59.2546 23.2329 1469.28 59.4614 22.8796 1493.04 59.6655 22.5248 1517.19 59.8514 22.1478 1541.73 60.0135 21.7731 1566.67 60.1556 21.4043 1592.01 60.2820 21.0410 1617.76 60.3944 20.6834 1643.92 60.4935 20.3312 1670.51 60.5802 19.9845 1697.53 60.6552 19.6434 1724.99 60.7277 19.3077 1752.89 60.7871 18.9605 1781.24 60.8260 18.6138 1810.05 60.8455 18.2689 1839.32 60.8453 17.9297 1869.07 60.8277 17.5963 1899.30 60.7931 17.2688 1930.02 60.7413 16.9469 1961.24 60.6718 16.6309 1992.96 60.5815 16.3207 2025.20 60.4858 16.0248 2057.95 60.3721 15.7138 2091.24 60.2280 15.4053 2125.06 60.0572 15.1003 2159.43 59.8574 14.7985 2194.36 59.6265 14.5003 2229.85 59.3603 14.2049 2265.92 59.0545 13.9133 2302.57 58.7040 13.6255 2339.81 58.3022 13.3412 2377.66 57.8406 13.0605 2416.11 57.3065 12.7822 2455.19 56.6838 12.5081 2494.90 55.9517 12.2379 2535.26 55.0777 11.9706 2576.26 54.0126 11.7071 2617.93 52.6751 11.4470 2660.27 50.9144 11.1906 2703.30 48.3944 10.9375 2747.03 44.0472 10.6879 2786.60 11.6247 10.4701 2786.80 11.6296 27.3828 2791.46 32.1753 27.3091 2836.61 43.6129 26.6110 2882.49 43.8762 25.9342 2908.60 24.9818 25.5614 2908.80 24.9946 37.1148 2929.11 45.5963 36.7255 2976.48 51.8626 35.8432 3024.63 55.2297 34.9824 3073.55 57.6117 34.1450 3123.26 59.4357 33.3279 3173.78 60.8715 32.5311 3225.11 61.9952 31.7540 3277.27 62.8277 30.9978 3330.28 63.3155 30.2600 3384.15 63.3226 29.5414 3425.90 55.5262 29.0037 3426.10 55.5393 33.6509 3438.88 62.3990 33.4646 3494.50 65.6704 32.6731 3551.02 67.2840 31.9004 3608.46 68.4765 31.1472 3666.82 69.4405 30.4138 3726.13 70.2425 29.6967 3786.40 70.9105 28.9985 3847.64 71.4515 28.3176 3909.87 71.8407 27.6540 3973.11 72.1859 27.0061 4007.90 69.6976 26.6604 4008.10 69.7062 28.1891 4037.38 72.3479 27.8875 4102.68 73.3463 27.2338 4169.03 73.9560 26.5970 4236.46 74.3595 25.9761 4304.98 74.2630 25.3693 4316.90 72.8024 25.2662 4317.10 72.8036 26.2751 4374.62 75.2216 25.8091 4445.37 75.9083 25.2551 4517.27 76.4509 24.7065 4590.33 76.9216 24.1678 4664.58 77.3433 23.6346 4740.03 77.7251 23.1104 4816.69 78.0747 22.5946 4894.60 78.3962 22.0867 4973.77 78.6920 21.5868 5054.21 78.9646 21.0954 5135.96 79.2161 20.6124 5219.03 79.4482 20.1379 5303.44 79.6621 19.6718 5389.22 79.8591 19.2143 5476.39 80.0403 18.7651 5564.97 80.2067 18.3245 5654.98 80.3591 17.8925 5746.44 80.4985 17.4689 5839.39 80.6255 17.0536 5933.83 80.7407 16.6467 6029.81 80.8449 16.2481 6127.33 80.9387 15.8578 6226.44 81.0225 15.4756 6327.15 81.0970 15.1015 6429.48 81.1625 14.7355 6533.48 81.2196 14.3775 6639.15 81.2687 14.0273 6746.54 81.3102 13.6849 6855.65 81.3445 13.3499 6966.54 81.3717 13.0228 7079.22 81.3927 12.7031 7193.72 81.4074 12.3904 7310.07 81.4159 12.0851 7428.31 81.4188 11.7870 7548.45 81.4163 11.4961 7670.54 81.4087 11.2119 7794.61 81.3961 10.9345 7920.68 81.3788 10.6635 8048.79 81.3566 10.3993 8178.98 81.3301 10.1414 8311.26 81.2994 9.88984 8445.69 81.2645 9.64442 8582.29 81.2255 9.40521 8721.11 81.1829 9.17201 8862.16 81.1366 8.94433 9005.50 81.0864 8.72233 9151.16 81.0327 8.50599 9299.17 80.9756 8.29518 9449.58 80.9152 8.08979 9602.42 80.8523 7.88976 9757.73 80.7874 7.69440 9915.55 80.7245 7.50457 10075.9 80.6591 7.29997 10238.9 80.5761 7.10111 10404.5 80.4845 6.90784 10572.8 80.3845 6.72005 10743.8 80.2763 6.53762 10917.6 80.1597 6.36045 11094.2 80.0344 6.18840 11273.6 79.8995 6.02136 11455.9 79.7543 5.85923 11641.2 79.5975 5.70188 11829.5 79.4275 5.54919 12020.8 79.2421 5.40107 12215.3 79.0385 5.25740 12412.8 78.8129 5.11807 12613.6 78.5598 4.98297 12817.6 78.2716 4.85201 13025.0 77.9362 4.72507 13235.6 77.5346 4.60206 13449.7 77.0323 4.48288 13667.2 76.3585 4.36742 13888.3 75.3248 4.25560 14112.9 72.9881 4.14730 14213.4 58.9552 4.10030 14213.6 58.9560 10.5209 14341.2 73.6127 10.3582 14573.1 75.7472 10.0723 14808.9 76.7353 9.79428 15048.4 77.3385 9.52394 15291.8 77.7295 9.26107 15539.1 77.9706 9.00546 15790.4 78.0824 8.75690 16045.8 78.0566 8.51522 16305.4 77.8385 8.28020 16569.1 77.2116 8.05168 16784.6 69.6774 7.87221 16784.8 69.6782 11.0740 16837.1 75.8949 11.0220 17109.4 77.7424 10.7576 17386.1 77.9924 10.4996 17492.9 74.9652 10.4027 17493.1 74.9656 11.8776 17667.4 78.8223 11.7076 17953.1 79.7395 11.4375 18243.5 80.3500 11.1718 18538.6 80.8299 10.9105 18838.4 81.2298 10.6537 19143.1 81.5733 10.4013 19452.7 81.8739 10.1534 19767.4 82.1402 9.91001 20087.1 82.3781 9.67113 20412.0 82.5921 9.43676 20742.1 82.7852 9.20691 21077.6 82.9604 8.98153 21418.5 83.1194 8.76064 21765.0 83.2642 8.54418 22117.0 83.3961 8.33216 22474.7 83.5164 8.12452 22838.2 83.6261 7.92122 23207.6 83.7262 7.72224 23583.0 83.8174 7.52752 23964.4 83.9004 7.33703 24352.0 83.9760 7.15070 24745.9 84.0446 6.96850 25146.2 84.1067 6.79036 25552.9 84.1629 6.61623 25966.2 84.2135 6.44606 26386.1 84.2590 6.27979 26812.9 84.2997 6.11735 27246.6 84.3359 5.95869 27687.3 84.3679 5.80375 28135.1 84.3961 5.65245 28590.2 84.4205 5.50476 29052.6 84.4416 5.36059 29522.5 84.4595 5.21988 30000.0 84.4744 5.08258 periodictable-1.5.0/periodictable/xsf/au.nff000066400000000000000000000314541310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.73645 10.1617 -9999. 1.81425 10.3261 -9999. 1.89553 10.4931 -9999. 1.98045 10.6628 -9999. 2.06919 10.8353 -9999. 2.16029 11.0106 -9999. 2.25522 11.1886 -9999. 2.35433 11.3696 -9999. 2.45698 11.5535 -9999. 2.56237 11.7404 -9999. 2.67227 11.9303 -9999. 2.78521 12.1232 -9999. 2.88817 12.3193 -9999. 2.99494 12.5186 -9999. 3.10132 12.7210 -9999. 3.19752 12.9268 -9999. 3.29669 13.1359 -9999. 3.39894 13.3483 -9999. 3.50437 13.5642 -9999. 3.61306 13.7836 -9999. 3.73152 14.0066 -9999. 3.85438 14.2331 -9999. 3.98129 14.4633 -9999. 4.11238 14.6973 -9999. 4.24778 14.9350 -9999. 4.38725 15.1765 -9999. 4.51173 15.4220 -9999. 4.63973 15.6714 -9999. 4.77138 15.9249 -9999. 4.90700 16.1825 -9999. 5.04723 16.4442 -9999. 5.19146 16.7102 -9999. 5.33982 16.9805 -9999. 5.49242 17.2551 -9999. 5.68629 17.5342 -9999. 5.92705 17.8178 -9999. 6.17800 18.1060 -9999. 6.43958 18.3989 -9999. 6.70137 18.6964 -9999. 6.96844 18.9988 -9999. 7.24614 19.3061 -9999. 7.53492 19.6184 -9999. 7.83520 19.9357 -9999. 8.12303 20.2582 -9999. 8.41958 20.5858 -9999. 8.72696 20.9188 -9999. 9.04555 21.2571 -9999. 9.37578 21.6009 -9999. 9.65639 21.9503 -9999. 9.85393 22.3053 -9999. 10.0555 22.6661 -9999. 10.1353 23.0327 -9999. 10.0079 23.4053 -9999. 9.88212 23.7838 -9999. 9.66742 24.1685 -9999. 9.44840 24.5594 -9999. 9.19934 24.9566 -9999. 8.91210 25.3603 -9999. 8.80138 25.7705 -9999. 8.83333 26.1873 -9999. 8.86539 26.6109 -9999. 8.89756 27.0413 -9999. 9.16016 27.4786 -9999. 9.45786 27.9231 -9999. 9.76523 28.3747 -9999. 10.2659 28.8337 -9999. 10.8106 29.3000 2.78186 11.3841 29.7739 3.12197 11.9461 30.2555 3.70915 12.3765 30.7449 4.20738 12.6184 31.2421 4.73090 12.8652 31.7475 5.46023 12.8839 32.2609 5.87616 12.6294 32.7827 6.08759 12.5189 33.3130 6.32748 12.4795 33.8518 6.56094 12.4401 34.3993 6.77999 12.4009 34.9557 6.98361 12.3612 35.5211 7.16960 12.3210 36.0956 7.33501 12.2809 36.6794 7.47047 12.2410 37.2727 7.56618 12.2520 37.8755 7.69660 12.2957 38.4882 7.83947 12.3395 39.1107 7.98680 12.3835 39.7432 8.13188 12.4276 40.3861 8.26647 12.4883 41.0393 8.42254 12.5633 41.7031 8.59265 12.6389 42.3776 8.77385 12.7149 43.0630 8.96787 12.7913 43.7595 9.18641 12.8683 44.4673 9.46044 12.9155 45.1865 9.69558 12.8825 45.9174 9.89174 12.8495 46.6600 10.0695 12.8166 47.4147 10.2373 12.7764 48.1816 10.3747 12.7253 48.9609 10.4803 12.6743 49.7528 10.5325 12.6236 50.5576 10.4820 12.6684 51.3753 10.5236 12.8041 52.2062 10.6116 12.9412 53.0506 10.7140 13.0799 53.9087 10.8153 13.2200 54.7806 10.8726 13.4192 55.6667 11.0212 13.6953 56.5670 11.2340 13.9771 57.4820 11.5042 14.2647 58.4117 11.8496 14.5582 59.3564 12.3324 14.7951 60.3165 12.7858 14.9282 61.2921 13.2429 15.0626 62.2834 13.7797 15.1981 63.2908 14.5113 15.1516 64.3145 15.0559 14.9190 65.3547 15.5212 14.6802 66.4118 15.9070 14.3628 67.4859 16.2049 14.0523 68.5775 16.4318 13.7485 69.6867 16.5634 13.4513 70.8138 16.6399 13.3031 71.9591 16.7793 13.2003 73.1230 16.9357 13.0984 74.3057 17.0724 13.0206 75.5076 17.2580 12.9864 76.7289 17.4936 12.9523 77.9699 17.8101 12.8622 79.2310 18.0550 12.6853 80.5125 18.2473 12.5107 81.8147 18.3659 12.3386 83.1380 18.2599 12.4097 84.4827 18.8505 12.9523 85.8491 19.5657 12.5874 87.2377 20.0820 12.2174 88.6487 20.4581 11.7345 90.0825 20.7202 11.2706 91.5395 20.9355 10.8251 93.0201 21.0795 10.3143 94.5246 21.1195 9.82493 96.0535 21.0563 9.43000 97.6071 21.0251 9.10771 99.1858 21.0098 8.79644 100.790 20.9978 8.49581 102.420 20.9828 8.16706 104.077 20.9254 7.83561 105.760 20.8316 7.51761 107.471 20.6981 7.21250 109.209 20.5315 6.97495 110.975 20.3879 6.76890 112.770 20.2552 6.56893 114.594 20.1193 6.37486 116.448 19.9745 6.18654 118.331 19.8219 6.01704 120.245 19.6733 5.85800 122.190 19.5238 5.70317 124.166 19.3717 5.55244 126.175 19.2194 5.40568 128.215 19.0962 5.24101 130.289 18.9163 5.02374 132.397 18.6716 4.81547 134.538 18.3368 4.65529 136.714 18.0408 4.59490 138.925 17.7643 4.53529 141.172 17.4858 4.47645 143.456 17.1848 4.41838 145.776 16.8355 4.41238 148.134 16.5220 4.45484 150.530 16.2294 4.49770 152.964 15.9331 4.54099 155.439 15.6201 4.58468 157.953 15.2536 4.64434 160.507 14.9046 4.79736 163.103 14.5783 4.95542 165.742 14.2575 5.11868 168.422 13.9229 5.28732 171.146 13.5181 5.50617 173.915 13.1645 5.81309 176.727 12.8542 6.13711 179.586 12.5629 6.47920 182.491 12.2870 6.84035 185.442 12.0260 7.22425 188.442 11.7828 7.63159 191.489 11.5587 8.06187 194.587 11.3549 8.51642 197.734 11.1765 8.99660 200.932 11.0418 9.49633 204.182 10.9248 9.99704 207.485 10.8286 10.5242 210.840 10.7719 11.0791 214.251 10.8188 11.6556 217.716 10.8711 12.1153 221.237 10.8959 12.5931 224.816 10.9268 13.0897 228.452 10.9771 13.6060 232.147 11.0689 14.1426 235.902 11.2035 14.6377 239.717 11.3288 15.1200 243.595 11.4535 15.6181 247.535 11.5993 16.1327 251.538 11.8006 16.6642 255.607 12.0193 17.1345 259.741 12.2277 17.6098 263.942 12.4476 18.0983 268.211 12.6922 18.6004 272.549 12.9864 19.1164 276.957 13.3576 19.5628 281.437 13.6892 19.9461 285.989 13.9869 20.3369 290.615 14.2836 20.7353 295.315 14.5851 21.1416 300.092 14.8975 21.5558 304.945 15.2276 21.9781 309.878 15.5942 22.4087 314.890 15.9831 22.7880 319.983 16.3610 23.1566 325.158 16.7341 23.5311 330.418 17.1169 23.9117 335.762 17.5147 24.2985 341.192 17.9349 24.6915 346.711 18.3896 25.0908 352.319 18.9274 25.4931 358.017 19.4563 25.7443 363.808 19.9485 25.9981 369.692 20.4207 26.2543 375.672 20.8904 26.5131 381.748 21.3637 26.7745 387.922 21.8467 27.0384 394.197 22.3477 27.3049 400.573 22.8913 27.5740 407.052 23.4689 27.7588 413.635 24.0088 27.9017 420.326 24.5150 28.0452 427.124 25.0126 28.1895 434.032 25.5070 28.3345 441.052 26.0028 28.4802 448.186 26.5151 28.6268 455.435 27.0441 28.7421 462.802 27.5482 28.8269 470.287 28.0361 28.9120 477.894 28.5159 28.9974 485.623 28.9911 29.0829 493.478 29.4640 29.1688 501.459 29.9364 29.2549 509.570 30.4139 29.3412 517.812 30.8927 29.4178 526.187 31.3674 29.4913 534.698 31.8415 29.5649 543.346 32.3172 29.6387 552.134 32.7965 29.7127 561.065 33.2820 29.7869 570.139 33.7827 29.8571 579.361 34.2806 29.9096 588.732 34.7773 29.9623 598.254 35.2774 30.0150 607.930 35.7840 30.0678 617.763 36.3004 30.1207 627.755 36.8307 30.1737 637.908 37.3825 30.2268 648.226 37.9798 30.2800 658.711 38.6353 30.2414 669.365 39.2385 30.1231 680.191 39.7825 30.0054 691.193 40.3066 29.8880 702.372 40.8159 29.7712 713.733 41.3141 29.6548 725.277 41.7984 29.5389 737.008 42.2802 29.4357 748.928 42.7658 29.3333 761.042 43.2546 29.2313 773.351 43.7488 29.1296 785.859 44.2504 29.0283 798.570 44.7971 28.9271 811.486 45.3349 28.7522 824.611 45.8436 28.5783 837.949 46.3465 28.4055 851.502 46.8517 28.2338 865.274 47.3632 28.0631 879.269 47.9574 27.8881 893.491 48.5208 27.5753 907.943 49.0146 27.2660 922.628 49.4847 26.9602 937.551 49.9423 26.6578 952.715 50.4046 26.3588 968.124 50.8667 26.0207 983.783 51.3012 25.6649 999.695 51.7118 25.3140 1015.86 52.1155 24.9678 1032.29 52.5732 24.6265 1048.99 53.0314 24.1729 1065.96 53.3975 23.6661 1083.20 53.7017 23.1699 1100.72 53.9644 22.6841 1118.52 54.1937 22.2085 1136.61 54.3940 21.7429 1155. 54.5679 21.2865 1173.68 54.7162 20.8396 1192.66 54.8395 20.4021 1211.95 54.9309 19.9738 1231.55 54.9750 19.5719 1251.47 55.0316 19.2376 1271.72 55.1057 18.9090 1292.29 55.1874 18.5860 1313.19 55.2905 18.2686 1334.43 55.3836 17.8978 1356.01 55.4438 17.5237 1377.94 55.4747 17.1576 1400.23 55.4872 16.7990 1422.88 55.4558 16.4480 1445.89 55.4250 16.1608 1469.28 55.4335 15.8860 1493.04 55.5196 15.6136 1517.19 55.5549 15.1441 1541.73 55.4733 14.6844 1566.67 55.2816 14.2743 1592.01 55.0795 13.9739 1617.76 54.9140 13.6880 1643.92 54.7664 13.4012 1670.51 54.5596 13.0479 1697.53 54.2812 12.7438 1724.99 54.0229 12.5024 1752.89 53.7265 12.2124 1781.24 53.3700 12.0078 1810.05 53.0811 11.8536 1839.32 52.7486 11.5811 1869.07 52.3208 11.3598 1899.30 51.9272 11.2040 1930.02 51.5156 10.9604 1961.24 50.9557 10.6709 1992.96 50.2863 10.4467 2025.20 49.5537 10.2451 2057.95 48.6938 10.0148 2091.24 47.6322 9.77178 2125.06 46.2727 9.52110 2159.43 44.4424 9.28256 2194.36 41.7216 9.02538 2229.85 35.6915 11.1037 2265.92 35.3992 20.1927 2302.57 35.5671 21.3357 2339.81 37.0803 28.3053 2377.66 41.8200 29.9292 2416.11 45.3451 30.3415 2455.19 47.4191 30.1195 2494.90 49.1365 30.0334 2535.26 50.6780 29.7928 2576.26 51.8730 29.3224 2617.93 52.4894 28.9273 2660.27 53.2607 29.0345 2703.30 52.9018 28.6207 2747.03 52.9705 30.9060 2791.46 55.2863 31.8683 2836.61 57.3598 31.4084 2882.49 58.6589 31.0756 2929.11 59.9227 30.6543 2976.48 60.9171 30.0478 3024.63 61.7019 29.5033 3073.55 62.3899 29.0031 3123.26 62.7192 28.4478 3173.78 63.1577 28.7221 3225.11 64.2194 28.8967 3277.27 65.2597 28.3262 3330.28 66.0183 27.8026 3384.15 66.5074 27.2710 3438.88 66.9385 27.1058 3494.50 67.9305 26.9648 3551.02 68.8464 26.2268 3608.46 69.3468 25.6241 3666.82 69.8352 25.0676 3726.13 70.2945 24.5340 3786.40 70.7409 24.0263 3847.64 71.1653 23.4825 3909.87 71.5408 22.9482 3973.11 71.8852 22.4317 4037.38 72.2193 21.9280 4102.68 72.5193 21.4029 4169.03 72.8465 20.9204 4236.46 72.9783 20.2638 4304.98 73.0919 19.9740 4374.62 73.3624 19.5013 4445.37 73.5614 19.0807 4517.27 73.7577 18.6347 4590.33 73.9253 18.2079 4664.58 74.0788 17.7819 4740.03 74.2121 17.3679 4816.69 74.3252 16.9656 4894.60 74.4302 16.5884 4973.77 74.5183 16.2132 5054.21 74.6031 15.8827 5135.96 74.7209 15.5418 5219.03 74.7789 15.1636 5303.44 74.9028 14.9574 5389.22 75.0765 14.5361 5476.39 75.1224 14.1854 5564.97 75.1809 13.8440 5654.98 75.2285 13.5168 5746.44 75.2638 13.2024 5839.39 75.3322 12.9222 5933.83 75.3935 12.5542 6029.81 75.4192 12.2989 6127.33 75.4657 11.9837 6226.44 75.4815 11.6782 6327.15 75.4910 11.3838 6429.48 75.4957 11.0963 6533.48 75.4938 10.8152 6639.15 75.4857 10.5407 6746.54 75.4719 10.2725 6855.65 75.4525 10.0108 6966.54 75.4279 9.75519 7079.22 75.3981 9.50568 7193.72 75.3633 9.26191 7310.07 75.3233 9.02427 7428.31 75.2786 8.79262 7548.45 75.2295 8.56658 7670.54 75.1756 8.34582 7794.61 75.1167 8.13073 7920.68 75.0532 7.92114 8048.79 74.9851 7.71688 8178.98 74.9122 7.51777 8311.26 74.8344 7.32368 8445.69 74.7514 7.13442 8582.29 74.6629 6.95007 8721.11 74.5687 6.77055 8862.16 74.4684 6.59582 9005.50 74.3618 6.42578 9151.16 74.2482 6.26015 9299.17 74.1271 6.09888 9449.58 73.9974 5.94179 9602.42 73.8580 5.78882 9757.73 73.7077 5.63995 9915.55 73.5448 5.49507 10075.9 73.3671 5.35422 10238.9 73.1719 5.21720 10404.5 72.9555 5.08390 10572.8 72.7124 4.95425 10743.8 72.4353 4.82815 10917.6 72.1127 4.70552 11094.2 71.7263 4.58628 11273.6 71.2436 4.47034 11455.9 70.5981 4.35762 11641.2 69.6151 4.24804 11829.5 67.4461 4.14153 11918.6 54.2731 4.09265 11918.8 54.2736 10.2075 12020.8 67.8226 10.0588 12215.3 69.8923 9.78487 12412.8 70.8160 9.51839 12613.6 71.3557 9.25916 12817.6 71.6745 9.00701 13025.0 71.8212 8.76171 13235.6 71.7884 8.52311 13449.7 71.4804 8.29101 13667.2 70.2234 8.06522 13733.5 63.7471 7.99837 13733.7 63.7474 11.1563 13888.3 71.2206 10.9501 14112.9 72.1012 10.6611 14341.2 71.3028 10.3797 14352.7 69.3284 10.3658 14352.9 69.3299 11.9146 14573.1 73.2440 11.6510 14808.9 74.0231 11.3795 15048.4 74.5877 11.1126 15291.8 75.0435 10.8502 15539.1 75.4285 10.5924 15790.4 75.7620 10.3391 16045.8 76.0552 10.0905 16305.4 76.3159 9.84646 16569.1 76.5494 9.60705 16837.1 76.7597 9.37224 17109.4 76.9499 9.14202 17386.1 77.1223 8.91638 17667.4 77.2791 8.69527 17953.1 77.4218 8.47869 18243.5 77.5519 8.26660 18538.6 77.6705 8.05895 18838.4 77.7786 7.85571 19143.1 77.8772 7.65684 19452.7 77.9670 7.46228 19767.4 78.0487 7.27198 20087.1 78.1230 7.08590 20412.0 78.1904 6.90398 20742.1 78.2514 6.72616 21077.6 78.3065 6.55238 21418.5 78.3561 6.38260 21765.0 78.4006 6.21673 22117.0 78.4403 6.05473 22474.7 78.4756 5.89654 22838.2 78.5067 5.74207 23207.6 78.5339 5.59129 23583.0 78.5576 5.44410 23964.4 78.5778 5.30047 24352.0 78.5949 5.16031 24745.9 78.6091 5.02357 25146.2 78.6204 4.89018 25552.9 78.6292 4.76008 25966.2 78.6356 4.63319 26386.1 78.6398 4.50946 26812.9 78.6418 4.38882 27246.6 78.6418 4.27121 27687.3 78.6401 4.15657 28135.1 78.6366 4.04482 28590.2 78.6317 3.93592 29052.6 78.6259 3.82980 29522.5 78.6286 3.72639 30000.0 78.5768 3.62565 periodictable-1.5.0/periodictable/xsf/b.nff000066400000000000000000000331421310514471200206460ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.48933 10.1617 -9999. 1.48084 10.3261 -9999. 1.47240 10.4931 -9999. 1.46401 10.6628 -9999. 1.45567 10.8353 -9999. 1.44738 11.0106 -9999. 1.43913 11.1886 -9999. 1.43093 11.3696 -9999. 1.42278 11.5535 -9999. 1.41467 11.7404 -9999. 1.40661 11.9303 -9999. 1.39860 12.1232 -9999. 1.39063 12.3193 -9999. 1.38271 12.5186 -9999. 1.37483 12.7210 -9999. 1.36700 12.9268 -9999. 1.35921 13.1359 -9999. 1.35146 13.3483 -9999. 1.34376 13.5642 -9999. 1.33611 13.7836 -9999. 1.32849 14.0066 -9999. 1.32092 14.2331 -9999. 1.31340 14.4633 -9999. 1.30592 14.6973 -9999. 1.29847 14.9350 -9999. 1.29108 15.1765 -9999. 1.28304 15.4220 -9999. 1.27123 15.6714 -9999. 1.25954 15.9249 -9999. 1.24795 16.1825 -9999. 1.23647 16.4442 -9999. 1.22509 16.7102 -9999. 1.21382 16.9805 -9999. 1.20265 17.2551 -9999. 1.19158 17.5342 -9999. 1.18062 17.8178 -9999. 1.16976 18.1060 -9999. 1.15899 18.3989 -9999. 1.14833 18.6964 -9999. 1.13777 18.9988 -9999. 1.12730 19.3061 -9999. 1.11692 19.6184 -9999. 1.10665 19.9357 -9999. 1.09647 20.2582 -9999. 1.08638 20.5858 -9999. 1.07638 20.9188 -9999. 1.06648 21.2571 -9999. 1.05666 21.6009 -9999. 1.04694 21.9503 -9999. 1.03731 22.3053 -9999. 1.02777 22.6661 -9999. 1.01831 23.0327 -9999. 1.00894 23.4053 -9999. 0.999657 23.7838 -9999. 0.990606 24.1685 -9999. 0.981763 24.5594 -9999. 0.973000 24.9566 -9999. 0.964313 25.3603 -9999. 0.955706 25.7705 -9999. 0.947175 26.1873 -9999. 0.938720 26.6109 -9999. 0.930340 27.0413 -9999. 0.922036 27.4786 -9999. 0.913805 27.9231 -9999. 0.905648 28.3747 -9999. 0.897563 28.8337 -9999. 0.889552 29.3000 2.70114 0.881611 29.7739 2.70924 0.873741 30.2555 2.71684 0.866681 30.7449 2.72467 0.860334 31.2421 2.73292 0.854029 31.7475 2.74123 0.847767 32.2609 2.74958 0.841550 32.7827 2.75795 0.835377 33.3130 2.76635 0.829250 33.8518 2.77479 0.823169 34.3993 2.78332 0.817131 34.9557 2.79220 0.811138 35.5211 2.80101 0.804267 36.0956 2.80936 0.797376 36.6794 2.81743 0.790543 37.2727 2.82532 0.783769 37.8755 2.83309 0.777052 38.4882 2.84076 0.770390 39.1107 2.84837 0.763785 39.7432 2.85607 0.757243 40.3861 2.86381 0.750307 41.0393 2.87121 0.743136 41.7031 2.87824 0.736032 42.3776 2.88508 0.728996 43.0630 2.89177 0.722028 43.7595 2.89833 0.715129 44.4673 2.90488 0.708294 45.1865 2.91145 0.701381 45.9174 2.91778 0.694129 46.6600 2.92380 0.686952 47.4147 2.92962 0.679852 48.1816 2.93531 0.672826 48.9609 2.94094 0.665869 49.7528 2.94670 0.658982 50.5576 2.95245 0.651457 51.3753 2.95768 0.643703 52.2062 2.96242 0.636041 53.0506 2.96687 0.628470 53.9087 2.97107 0.620981 54.7806 2.97504 0.613587 55.6667 2.97882 0.606281 56.5670 2.98242 0.599067 57.4820 2.98589 0.591940 58.4117 2.98929 0.584894 59.3564 2.99270 0.577734 60.3165 2.99591 0.570345 61.2921 2.99887 0.562897 62.2834 3.00149 0.555186 63.2908 3.00359 0.547583 64.3145 3.00540 0.540088 65.3547 3.00694 0.532694 66.4118 3.00824 0.525399 67.4859 3.00933 0.518204 68.5775 3.01030 0.511109 69.6867 3.01114 0.503853 70.8138 3.01173 0.496542 71.9591 3.01194 0.488988 73.1230 3.01167 0.481482 74.3057 3.01097 0.474092 75.5076 3.00995 0.466822 76.7289 3.00862 0.459657 77.9699 3.00704 0.452598 79.2310 3.00517 0.445455 80.5125 3.00296 0.438421 81.8147 3.00044 0.431260 83.1380 2.99744 0.424073 84.4827 2.99392 0.416993 85.8491 2.98998 0.410033 87.2377 2.98566 0.403193 88.6487 2.98095 0.396414 90.0825 2.97584 0.389685 91.5395 2.97030 0.382981 93.0201 2.96424 0.376240 94.5246 2.95761 0.369619 96.0535 2.95047 0.363116 97.6071 2.94283 0.356731 99.1858 2.93493 0.350464 100.790 2.92657 0.343808 102.420 2.91715 0.336799 104.077 2.90673 0.330006 105.760 2.89532 0.323331 107.471 2.88287 0.317003 109.209 2.86954 0.311354 110.975 2.85569 0.306228 112.770 2.84162 0.301331 114.594 2.82707 0.296255 116.448 2.81160 0.290579 118.331 2.79476 0.284822 120.245 2.77657 0.279180 122.190 2.75708 0.273649 124.166 2.73621 0.268226 126.175 2.71386 0.262912 128.215 2.68993 0.257703 130.289 2.66427 0.252595 132.397 2.63679 0.247574 134.538 2.60723 0.242496 136.714 2.57523 0.237462 138.925 2.54059 0.232530 141.172 2.50303 0.227702 143.456 2.46220 0.222974 145.776 2.41750 0.218344 148.134 2.36863 0.214205 150.530 2.31566 0.210328 152.964 2.25735 0.205697 155.439 2.19207 0.200712 157.953 2.11854 0.195525 160.507 2.03507 0.190474 163.103 1.93966 0.185553 165.742 1.82931 0.180757 168.422 1.69968 0.176085 171.146 1.54436 0.171826 173.915 1.35360 0.168067 176.727 1.11057 0.164874 179.586 0.782171 0.161758 182.491 0.290493 0.158617 185.442 -0.637089 0.155123 187.900 -4.78581 0.152313 188.100 -4.77338 4.25155 188.442 -2.81976 4.24286 191.489 -0.321484E-01 4.16670 194.587 0.859101 4.09191 197.734 1.41819 4.02128 200.932 1.83260 3.95414 204.182 2.16495 3.88815 207.485 2.44452 3.82327 210.840 2.68979 3.75945 214.251 2.90804 3.68555 217.716 3.09795 3.61074 221.237 3.26593 3.53565 224.816 3.41619 3.46212 228.452 3.55209 3.39013 232.147 3.67588 3.31961 235.902 3.78930 3.25058 239.717 3.89373 3.18300 243.595 3.99030 3.11683 247.535 4.07992 3.05201 251.538 4.16334 2.98855 255.607 4.24126 2.92641 259.741 4.31429 2.86554 263.942 4.38295 2.80593 268.211 4.44782 2.74757 272.549 4.50978 2.69044 276.957 4.56954 2.63274 281.437 4.62551 2.57409 285.989 4.67680 2.51536 290.615 4.72393 2.45779 295.315 4.76763 2.40154 300.092 4.80833 2.34657 304.945 4.84632 2.29285 309.878 4.88183 2.24035 314.890 4.91505 2.18908 319.983 4.94621 2.13898 325.158 4.97540 2.09001 330.418 5.00279 2.04220 335.762 5.02857 1.99548 341.192 5.05277 1.94978 346.711 5.07551 1.90518 352.319 5.09696 1.86160 358.017 5.11718 1.81899 363.808 5.13624 1.77735 369.692 5.15427 1.73667 375.672 5.17136 1.69691 381.748 5.18754 1.65808 387.922 5.20299 1.62030 394.197 5.21918 1.58371 400.573 5.23517 1.54540 407.052 5.24857 1.50702 413.635 5.26049 1.46951 420.326 5.27124 1.43298 427.124 5.28107 1.39737 434.032 5.29012 1.36262 441.052 5.29851 1.32873 448.186 5.30657 1.29556 455.435 5.31408 1.26256 462.802 5.32065 1.22991 470.287 5.32625 1.19786 477.894 5.33098 1.16667 485.623 5.33508 1.13629 493.478 5.33862 1.10670 501.459 5.34167 1.07788 509.570 5.34435 1.04981 517.812 5.34673 1.02238 526.187 5.34893 0.995385 534.698 5.35064 0.968563 543.346 5.35143 0.942202 552.134 5.35135 0.916550 561.065 5.35073 0.892625 570.139 5.35066 0.869687 579.361 5.35087 0.846550 588.732 5.35065 0.823799 598.254 5.35003 0.801516 607.930 5.34917 0.779833 617.763 5.34826 0.758739 627.755 5.34744 0.738149 637.908 5.34702 0.717286 648.226 5.34607 0.695804 658.711 5.34351 0.674188 669.365 5.33936 0.653250 680.191 5.33390 0.634968 691.193 5.32934 0.618719 702.372 5.32662 0.603267 713.733 5.32467 0.586951 725.277 5.32199 0.570232 737.008 5.31890 0.553984 748.928 5.31562 0.538204 761.042 5.31223 0.522872 773.351 5.30882 0.507937 785.859 5.30534 0.493312 798.570 5.30171 0.479013 811.486 5.29797 0.465121 824.611 5.29417 0.451634 837.949 5.29037 0.438538 851.502 5.28662 0.425697 865.274 5.28280 0.413094 879.269 5.27882 0.400743 893.491 5.27471 0.388746 907.943 5.27049 0.377113 922.628 5.26617 0.365835 937.551 5.26180 0.355111 952.715 5.25754 0.344749 968.124 5.25338 0.334727 983.783 5.24931 0.324999 999.695 5.24536 0.315525 1015.86 5.24154 0.306299 1032.29 5.23778 0.297006 1048.99 5.23388 0.287954 1065.96 5.22991 0.279137 1083.20 5.22591 0.270598 1100.72 5.22191 0.262319 1118.52 5.21792 0.254289 1136.61 5.21394 0.246507 1155. 5.20998 0.238961 1173.68 5.20605 0.231645 1192.66 5.20216 0.224555 1211.95 5.19831 0.217682 1231.55 5.19450 0.211021 1251.47 5.19075 0.204548 1271.72 5.18704 0.198261 1292.29 5.18336 0.192151 1313.19 5.17972 0.186228 1334.43 5.17612 0.180488 1356.01 5.17257 0.174925 1377.94 5.16907 0.169534 1400.23 5.16562 0.164310 1422.88 5.16223 0.159248 1445.89 5.15890 0.154338 1469.28 5.15563 0.149571 1493.04 5.15243 0.144939 1517.19 5.14929 0.140388 1541.73 5.14615 0.135973 1566.67 5.14305 0.131697 1592.01 5.13999 0.127556 1617.76 5.13698 0.123544 1643.92 5.13402 0.119658 1670.51 5.13110 0.115894 1697.53 5.12824 0.112248 1724.99 5.12544 0.108716 1752.89 5.12270 0.105266 1781.24 5.11999 0.101916 1810.05 5.11732 0.986663E-01 1839.32 5.11469 0.955176E-01 1869.07 5.11210 0.924686E-01 1899.30 5.10955 0.895166E-01 1930.02 5.10705 0.866612E-01 1961.24 5.10459 0.838971E-01 1992.96 5.10216 0.812206E-01 2025.20 5.09981 0.787027E-01 2057.95 5.09757 0.761739E-01 2091.24 5.09532 0.737227E-01 2125.06 5.09311 0.713481E-01 2159.43 5.09094 0.690489E-01 2194.36 5.08881 0.668140E-01 2229.85 5.08672 0.646543E-01 2265.92 5.08468 0.625607E-01 2302.57 5.08267 0.605286E-01 2339.81 5.08070 0.585635E-01 2377.66 5.07877 0.566582E-01 2416.11 5.07689 0.548123E-01 2455.19 5.07503 0.530246E-01 2494.90 5.07322 0.512928E-01 2535.26 5.07144 0.496148E-01 2576.26 5.06971 0.479897E-01 2617.93 5.06800 0.464157E-01 2660.27 5.06633 0.448913E-01 2703.30 5.06470 0.434149E-01 2747.03 5.06310 0.419853E-01 2791.46 5.06154 0.406005E-01 2836.61 5.06001 0.392606E-01 2882.49 5.05851 0.379625E-01 2929.11 5.05705 0.367055E-01 2976.48 5.05561 0.354884E-01 3024.63 5.05421 0.343104E-01 3073.55 5.05284 0.331697E-01 3123.26 5.05150 0.320658E-01 3173.78 5.05019 0.309971E-01 3225.11 5.04891 0.299625E-01 3277.27 5.04765 0.289616E-01 3330.28 5.04643 0.279922E-01 3384.15 5.04523 0.270543E-01 3438.88 5.04406 0.261471E-01 3494.50 5.04292 0.252687E-01 3551.02 5.04180 0.244190E-01 3608.46 5.04071 0.235963E-01 3666.82 5.03964 0.228007E-01 3726.13 5.03860 0.220309E-01 3786.40 5.03758 0.212856E-01 3847.64 5.03658 0.205649E-01 3909.87 5.03561 0.198682E-01 3973.11 5.03466 0.191937E-01 4037.38 5.03373 0.185476E-01 4102.68 5.03283 0.179165E-01 4169.03 5.03195 0.173072E-01 4236.46 5.03109 0.167181E-01 4304.98 5.03024 0.161487E-01 4374.62 5.02942 0.155980E-01 4445.37 5.02862 0.150659E-01 4517.27 5.02784 0.145518E-01 4590.33 5.02708 0.140547E-01 4664.58 5.02633 0.135741E-01 4740.03 5.02560 0.131094E-01 4816.69 5.02490 0.126607E-01 4894.60 5.02420 0.122266E-01 4973.77 5.02353 0.118072E-01 5054.21 5.02287 0.114019E-01 5135.96 5.02223 0.110101E-01 5219.03 5.02161 0.106315E-01 5303.44 5.02100 0.102655E-01 5389.22 5.02040 0.991185E-02 5476.39 5.01982 0.957001E-02 5564.97 5.01926 0.923971E-02 5654.98 5.01871 0.892048E-02 5746.44 5.01817 0.861194E-02 5839.39 5.01765 0.831380E-02 5933.83 5.01714 0.802574E-02 6029.81 5.01665 0.774736E-02 6127.33 5.01616 0.747830E-02 6226.44 5.01569 0.721834E-02 6327.15 5.01523 0.696712E-02 6429.48 5.01478 0.672443E-02 6533.48 5.01435 0.648984E-02 6639.15 5.01392 0.626329E-02 6746.54 5.01351 0.604440E-02 6855.65 5.01311 0.583287E-02 6966.54 5.01271 0.562839E-02 7079.22 5.01233 0.543100E-02 7193.72 5.01196 0.524026E-02 7310.07 5.01160 0.505601E-02 7428.31 5.01124 0.487800E-02 7548.45 5.01090 0.470595E-02 7670.54 5.01056 0.453990E-02 7794.61 5.01024 0.437949E-02 7920.68 5.00992 0.422456E-02 8048.79 5.00961 0.407489E-02 8178.98 5.00931 0.393020E-02 8311.26 5.00902 0.379062E-02 8445.69 5.00873 0.365578E-02 8582.29 5.00845 0.352547E-02 8721.11 5.00818 0.339979E-02 8862.16 5.00792 0.327838E-02 9005.50 5.00766 0.316109E-02 9151.16 5.00741 0.304783E-02 9299.17 5.00717 0.293857E-02 9449.58 5.00693 0.283291E-02 9602.42 5.00670 0.273103E-02 9757.73 5.00648 0.263256E-02 9915.55 5.00626 0.253775E-02 10075.9 5.00605 0.244607E-02 10238.9 5.00584 0.235757E-02 10404.5 5.00564 0.227215E-02 10572.8 5.00545 0.218970E-02 10743.8 5.00526 0.211014E-02 10917.6 5.00507 0.203335E-02 11094.2 5.00489 0.195925E-02 11273.6 5.00472 0.188774E-02 11455.9 5.00455 0.181875E-02 11641.2 5.00438 0.175219E-02 11829.5 5.00422 0.168796E-02 12020.8 5.00406 0.162601E-02 12215.3 5.00391 0.156625E-02 12412.8 5.00376 0.150860E-02 12613.6 5.00362 0.145300E-02 12817.6 5.00348 0.139938E-02 13025.0 5.00334 0.134766E-02 13235.6 5.00321 0.129780E-02 13449.7 5.00308 0.124972E-02 13667.2 5.00295 0.120336E-02 13888.3 5.00283 0.115867E-02 14112.9 5.00271 0.111559E-02 14341.2 5.00259 0.107406E-02 14573.1 5.00248 0.103404E-02 14808.9 5.00237 0.995465E-03 15048.4 5.00227 0.958296E-03 15291.8 5.00216 0.922482E-03 15539.1 5.00206 0.887977E-03 15790.4 5.00196 0.854736E-03 16045.8 5.00187 0.822718E-03 16305.4 5.00178 0.791879E-03 16569.1 5.00169 0.762180E-03 16837.1 5.00160 0.733582E-03 17109.4 5.00152 0.706047E-03 17386.1 5.00143 0.679540E-03 17667.4 5.00135 0.654024E-03 17953.1 5.00128 0.629466E-03 18243.5 5.00120 0.605832E-03 18538.6 5.00113 0.583093E-03 18838.4 5.00105 0.561215E-03 19143.1 5.00099 0.540171E-03 19452.7 5.00092 0.519930E-03 19767.4 5.00085 0.500466E-03 20087.1 5.00079 0.481560E-03 20412.0 5.00073 0.463572E-03 20742.1 5.00067 0.446275E-03 21077.6 5.00061 0.429641E-03 21418.5 5.00055 0.413645E-03 21765.0 5.00050 0.398260E-03 22117.0 5.00044 0.383463E-03 22474.7 5.00039 0.369231E-03 22838.2 5.00034 0.355541E-03 23207.6 5.00029 0.342372E-03 23583.0 5.00025 0.329702E-03 23964.4 5.00020 0.317515E-03 24352.0 5.00015 0.305788E-03 24745.9 5.00011 0.294506E-03 25146.2 5.00007 0.283650E-03 25552.9 5.00003 0.273204E-03 25966.2 4.99999 0.263151E-03 26386.1 4.99995 0.253477E-03 26812.9 4.99991 0.244167E-03 27246.6 4.99988 0.235206E-03 27687.3 4.99984 0.226582E-03 28135.1 4.99981 0.218281E-03 28590.2 4.99977 0.210290E-03 29052.6 4.99974 0.202598E-03 29522.5 4.99971 0.195192E-03 30000.0 4.99968 0.188063E-03 periodictable-1.5.0/periodictable/xsf/ba.nff000066400000000000000000000316321310514471200210110ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.102582 10.1617 -9999. 0.107605 10.3261 -9999. 0.112874 10.4931 -9999. 0.118401 10.6628 -9999. 0.124198 10.8353 -9999. 0.130280 11.0106 -9999. 0.136659 11.1886 -9999. 0.143350 11.3696 -9999. 0.150369 11.5535 -9999. 0.157732 11.7404 -9999. 0.165455 11.9303 -9999. 0.173557 12.1232 -9999. 0.183338 12.3193 -9999. 0.194288 12.5186 -9999. 0.205891 12.7210 -9999. 0.218187 12.9268 -9999. 0.231218 13.1359 -9999. 0.247615 13.3483 -9999. 0.265218 13.5642 -9999. 0.284072 13.7836 -9999. 0.304267 14.0066 -9999. 0.362677 14.2331 -9999. 0.420004 14.4633 -9999. 0.474092 14.6973 -9999. 0.533738 14.9350 -9999. 0.599553 15.1765 -9999. 0.666927 15.4220 -9999. 0.730960 15.6714 -9999. 0.693144 15.9249 -9999. 0.654676 16.1825 -9999. 0.627532 16.4442 -9999. 0.743404 16.7102 -9999. 1.51055 16.9805 -9999. 2.31632 17.2551 -9999. 5.82720 17.5342 -9999. 9.18758 17.8178 -9999. 11.0651 18.1060 -9999. 12.1706 18.3989 -9999. 13.3866 18.6964 -9999. 16.2715 18.9988 -9999. 20.8311 19.3061 -9999. 25.5391 19.6184 -9999. 26.1763 19.9357 -9999. 26.8294 20.2582 -9999. 26.9725 20.5858 -9999. 26.6972 20.9188 -9999. 26.1269 21.2571 -9999. 24.8556 21.6009 -9999. 23.6461 21.9503 -9999. 22.4955 22.3053 -9999. 21.4008 22.6661 -9999. 20.3594 23.0327 -9999. 19.3687 23.4053 -9999. 18.4262 23.7838 -9999. 17.5296 24.1685 -9999. 16.6625 24.5594 -9999. 15.8365 24.9566 -9999. 15.0515 25.3603 -9999. 14.3054 25.7705 -9999. 13.5963 26.1873 -9999. 12.9224 26.6109 -9999. 12.2818 27.0413 -9999. 11.6730 27.4786 -9999. 11.0944 27.9231 -9999. 10.5444 28.3747 -9999. 10.0018 28.8337 -9999. 9.47953 29.3000 16.4471 8.98449 29.7739 16.4118 8.51529 30.2555 16.3610 8.07059 30.7449 16.2972 7.64914 31.2421 16.2223 7.24967 31.7475 16.1385 6.87108 32.2609 16.0473 6.51225 32.7827 15.9507 6.17216 33.3130 15.8511 5.84984 33.8518 15.7525 5.54435 34.3993 15.6642 5.25481 34.9557 15.5952 4.93304 35.5211 15.4733 4.60153 36.0956 15.3260 4.29229 36.6794 15.1632 4.00384 37.2727 14.9892 3.73477 37.8755 14.8063 3.48379 38.4882 14.6162 3.24967 39.1107 14.4192 3.03129 39.7432 14.2124 2.82758 40.3861 13.9867 2.65078 41.0393 13.7788 2.50671 41.7031 13.5820 2.37048 42.3776 13.3893 2.24165 43.0630 13.1988 2.11982 43.7595 13.0094 2.00461 44.4673 12.8201 1.89566 45.1865 12.6304 1.79264 45.9174 12.4395 1.69521 46.6600 12.2468 1.60308 47.4147 12.0515 1.51596 48.1816 11.8526 1.43357 48.9609 11.6481 1.35565 49.7528 11.4328 1.28517 50.5576 11.2181 1.23309 51.3753 11.0025 1.18311 52.2062 10.7750 1.13822 53.0506 10.5511 1.11996 53.9087 10.3328 1.10248 54.7806 10.1173 1.09259 55.6667 9.90343 1.08279 56.5670 9.68751 1.07307 57.4820 9.46682 1.06344 58.4117 9.23752 1.05467 59.3564 9.00202 1.05299 60.3165 8.75803 1.05131 61.2921 8.49452 1.05807 62.2834 8.23364 1.08111 63.2908 7.97118 1.10465 64.3145 7.70083 1.12871 65.3547 7.41884 1.15329 66.4118 7.11976 1.18423 67.4859 6.81304 1.22252 68.5775 6.49324 1.26205 69.6867 6.15469 1.30286 70.8138 5.79502 1.35385 71.9591 5.41993 1.41089 73.1230 5.02291 1.47033 74.3057 4.59965 1.53540 75.5076 4.14695 1.60409 76.7289 3.65522 1.67585 77.9699 3.12021 1.76771 79.2310 2.55199 1.87205 80.5125 1.94112 1.98004 81.8147 1.26884 2.08822 83.1380 0.523413 2.20232 84.4827 -0.303533 2.32265 85.8491 -1.25651 2.40436 87.2377 -2.42703 2.47714 88.6487 -3.91150 2.62019 90.0825 -6.30092 2.67983 91.5395 -8.68491 4.95387 93.0201 -7.44126 9.15779 94.5246 -7.78417 3.46252 96.0535 -12.8572 4.27233 97.6071 -18.3425 5.81709 99.1858 -25.3014 9.46539 100.790 -32.3295 17.3378 102.420 -36.7988 35.0848 104.077 -31.1338 48.0307 105.760 -16.7618 57.2602 107.471 -4.90253 58.1327 109.209 2.58636 56.7582 110.975 7.60516 54.9013 112.770 11.1029 54.0482 114.594 14.0726 56.8675 116.448 24.3891 59.2316 118.331 33.0949 54.9399 120.245 38.4962 49.1254 122.190 41.6121 43.2060 124.166 43.2132 38.2524 126.175 44.2136 33.9584 128.215 44.9841 30.1464 130.289 45.2608 26.1964 132.397 44.9648 22.7133 134.538 44.2934 19.5972 136.714 43.2137 16.9951 138.925 42.2342 15.0150 141.172 41.5073 13.1863 143.456 40.6208 11.3566 145.776 39.6145 9.78092 148.134 38.5811 8.39900 150.530 37.5278 7.20139 152.964 36.4787 6.17454 155.439 35.4563 5.29133 157.953 34.4445 4.52320 160.507 33.4428 3.88064 163.103 32.4402 3.32555 165.742 31.5095 3.00542 168.422 30.6674 2.71610 171.146 29.8982 2.48691 173.915 29.1737 2.27878 176.727 28.4485 2.11933 179.586 27.7783 2.01565 182.491 27.1356 1.95126 185.442 26.5163 1.93172 188.442 25.9294 1.95618 191.489 25.4055 2.05346 194.587 24.9470 2.15559 197.734 24.5310 2.25890 200.932 24.1441 2.36442 204.182 23.7817 2.47486 207.485 23.4388 2.59047 210.840 23.1069 2.71217 214.251 22.7953 2.86120 217.716 22.5081 3.01842 221.237 22.2424 3.18428 224.816 21.9976 3.35926 228.452 21.7713 3.53807 232.147 21.5604 3.72516 235.902 21.3654 3.92214 239.717 21.1886 4.12954 243.595 21.0323 4.34790 247.535 20.9066 4.57454 251.538 20.7944 4.78890 255.607 20.6951 5.01330 259.741 20.6137 5.24822 263.942 20.5574 5.49414 268.211 20.5506 5.75159 272.549 20.5807 5.95964 276.957 20.5977 6.14489 281.437 20.6217 6.33590 285.989 20.6661 6.50912 290.615 20.7040 6.66816 295.315 20.7385 6.83109 300.092 20.7802 6.99799 304.945 20.8328 7.16898 309.878 20.9009 7.34414 314.890 21.0096 7.52358 319.983 21.1348 7.64774 325.158 21.2399 7.75537 330.418 21.3401 7.86453 335.762 21.4441 7.97523 341.192 21.5579 8.08748 346.711 21.7159 8.20132 352.319 21.8753 8.23661 358.017 21.9984 8.25766 363.808 22.1041 8.27877 369.692 22.2001 8.29992 375.672 22.2901 8.32114 381.748 22.3825 8.33827 387.922 22.4646 8.34540 394.197 22.5363 8.35254 400.573 22.6023 8.35969 407.052 22.6634 8.36685 413.635 22.7205 8.37400 420.326 22.7743 8.38117 427.124 22.8257 8.38835 434.032 22.8802 8.39552 441.052 22.9354 8.39010 448.186 22.9773 8.37524 455.435 23.0091 8.36041 462.802 23.0333 8.34559 470.287 23.0508 8.33081 477.894 23.0620 8.31606 485.623 23.0674 8.30132 493.478 23.0676 8.28662 501.459 23.0634 8.27194 509.570 23.0562 8.25728 517.812 23.0473 8.24266 526.187 23.0779 8.21598 534.698 23.0726 8.12164 543.346 23.0178 8.02838 552.134 22.9356 7.93619 561.065 22.8277 7.84506 570.139 22.6941 7.75498 579.361 22.5340 7.66593 588.732 22.3455 7.57790 598.254 22.1161 7.49307 607.930 21.8618 7.42815 617.763 21.5839 7.36380 627.755 21.2722 7.30001 637.908 20.9212 7.23676 648.226 20.5237 7.17406 658.711 20.0871 7.10649 669.365 19.5704 7.01580 680.191 18.9535 6.92626 691.193 18.2240 6.83786 702.372 17.3616 6.74705 713.733 16.3003 6.64215 725.277 14.9607 6.53888 737.008 13.2144 6.43722 748.928 10.7898 6.33714 761.042 6.99366 6.23862 773.351 -1.23942 6.14162 780.100 -36.0464 6.08973 780.300 -36.0387 32.0919 785.859 -2.48177 32.0024 798.570 7.54594 31.8010 811.486 12.2086 31.6009 824.611 15.3487 31.4021 837.949 17.7528 31.2046 851.502 19.7210 31.0083 865.274 21.4009 30.8132 879.269 22.8765 30.6193 893.491 24.2016 30.4267 907.943 25.4196 30.2353 922.628 26.5386 30.0149 937.551 27.5674 29.7930 952.715 28.5218 29.5728 968.124 29.4164 29.3541 983.783 30.2603 29.1371 999.695 31.0607 28.9217 1015.86 31.8235 28.7079 1032.29 32.5537 28.4957 1048.99 33.2555 28.2850 1065.96 33.9328 28.0759 1083.20 34.5928 27.8683 1100.72 35.2364 27.6539 1118.52 35.8555 27.4321 1136.61 36.4535 27.2122 1155. 37.0349 26.9940 1173.68 37.6023 26.7776 1192.66 38.1582 26.5629 1211.95 38.7048 26.3499 1231.55 39.2445 26.1386 1251.47 39.7803 25.9291 1271.72 40.3155 25.7211 1292.29 40.8552 25.5149 1313.19 41.4079 25.3103 1334.43 41.9972 25.1074 1356.01 42.6608 24.8140 1377.94 43.2544 24.3966 1400.23 43.7468 23.9862 1422.88 44.2015 23.5827 1445.89 44.6256 23.1860 1469.28 45.0252 22.7960 1493.04 45.4048 22.4125 1517.19 45.7683 22.0355 1541.73 46.1205 21.6648 1566.67 46.4742 21.3003 1592.01 46.8200 20.9032 1617.76 47.1331 20.4947 1643.92 47.4136 20.0941 1670.51 47.6743 19.7014 1697.53 47.9178 19.3164 1724.99 48.1461 18.9389 1752.89 48.3609 18.5687 1781.24 48.5636 18.2059 1810.05 48.7554 17.8500 1839.32 48.9372 17.5012 1869.07 49.1149 17.1580 1899.30 49.2814 16.8133 1930.02 49.4340 16.4754 1961.24 49.5778 16.1444 1992.96 49.7102 15.8199 2025.20 49.8429 15.5102 2057.95 49.9708 15.1902 2091.24 50.0873 14.8756 2125.06 50.1945 14.5658 2159.43 50.2937 14.2614 2194.36 50.3858 13.9618 2229.85 50.4707 13.6668 2265.92 50.5487 13.3770 2302.57 50.6202 13.0919 2339.81 50.6853 12.8117 2377.66 50.7445 12.5365 2416.11 50.7978 12.2656 2455.19 50.8451 11.9996 2494.90 50.8876 11.7387 2535.26 50.9246 11.4817 2576.26 50.9561 11.2295 2617.93 50.9825 10.9817 2660.27 51.0045 10.7388 2703.30 51.0214 10.4995 2747.03 51.0334 10.2650 2791.46 51.0407 10.0347 2836.61 51.0441 9.80897 2882.49 51.0426 9.58613 2929.11 51.0363 9.36838 2976.48 51.0258 9.15433 3024.63 51.0109 8.94429 3073.55 50.9914 8.73803 3123.26 50.9675 8.53562 3173.78 50.9390 8.33696 3225.11 50.9060 8.14208 3277.27 50.8684 7.95075 3330.28 50.8259 7.76298 3384.15 50.7786 7.57878 3438.88 50.7262 7.39806 3494.50 50.6686 7.22064 3551.02 50.6055 7.04664 3608.46 50.5367 6.87590 3666.82 50.4618 6.70833 3726.13 50.3805 6.54405 3786.40 50.2923 6.38282 3847.64 50.1967 6.22461 3909.87 50.0930 6.06941 3973.11 49.9805 5.91715 4037.38 49.8584 5.76780 4102.68 49.7255 5.62134 4169.03 49.5806 5.47759 4236.46 49.4221 5.33659 4304.98 49.2480 5.19832 4374.62 49.0559 5.06265 4445.37 48.8425 4.92952 4517.27 48.6038 4.79903 4590.33 48.3344 4.67103 4664.58 48.0266 4.54529 4740.03 47.6696 4.42211 4816.69 47.2473 4.30125 4894.60 46.7334 4.18269 4973.77 46.0814 4.06638 5054.21 45.1951 3.95224 5135.96 43.8132 3.84030 5219.03 40.4393 3.73058 5246.90 26.8164 3.69486 5247.10 26.8174 11.3018 5303.44 42.1310 11.0891 5389.22 44.1362 10.7771 5476.39 44.8272 10.4740 5564.97 44.6340 10.1793 5623.50 37.6496 9.99166 5623.70 37.6535 13.7185 5654.98 44.4926 13.5917 5746.44 46.5402 13.2315 5839.39 47.4390 12.8809 5933.83 47.7822 12.5394 5988.70 44.8521 12.3476 5988.90 44.8558 14.0776 6029.81 48.2474 13.9432 6127.33 49.4817 13.6314 6226.44 50.2716 13.3239 6327.15 50.8992 13.0205 6429.48 51.4293 12.7216 6533.48 51.8900 12.4269 6639.15 52.2971 12.1367 6746.54 52.6609 11.8513 6855.65 52.9885 11.5704 6966.54 53.2853 11.2943 7079.22 53.5550 11.0228 7193.72 53.8011 10.7562 7310.07 54.0262 10.4945 7428.31 54.2325 10.2375 7548.45 54.4216 9.98525 7670.54 54.5951 9.73791 7794.61 54.7545 9.49546 7920.68 54.9009 9.25799 8048.79 55.0356 9.02501 8178.98 55.1592 8.79689 8311.26 55.2725 8.57343 8445.69 55.3764 8.35485 8582.29 55.4717 8.14094 8721.11 55.5589 7.93140 8862.16 55.6383 7.72653 9005.50 55.7107 7.52636 9151.16 55.7766 7.33034 9299.17 55.8363 7.13886 9449.58 55.8901 6.95164 9602.42 55.9385 6.76883 9757.73 55.9819 6.59020 9915.55 56.0205 6.41580 10075.9 56.0548 6.24546 10238.9 56.0848 6.07915 10404.5 56.1110 5.91682 10572.8 56.1335 5.75838 10743.8 56.1526 5.60379 10917.6 56.1684 5.45295 11094.2 56.1813 5.30582 11273.6 56.1913 5.16231 11455.9 56.1986 5.02236 11641.2 56.2035 4.88591 11829.5 56.2060 4.75287 12020.8 56.2064 4.62320 12215.3 56.2047 4.49681 12412.8 56.2011 4.37364 12613.6 56.1957 4.25362 12817.6 56.1887 4.13669 13025.0 56.1800 4.02278 13235.6 56.1699 3.91182 13449.7 56.1585 3.80376 13667.2 56.1457 3.69851 13888.3 56.1318 3.59604 14112.9 56.1167 3.49626 14341.2 56.1007 3.39912 14573.1 56.0836 3.30456 14808.9 56.0656 3.21252 15048.4 56.0468 3.12293 15291.8 56.0273 3.03575 15539.1 56.0070 2.95091 15790.4 55.9860 2.86836 16045.8 55.9643 2.78805 16305.4 55.9421 2.70991 16569.1 55.9193 2.63389 16837.1 55.8961 2.55995 17109.4 55.8723 2.48804 17386.1 55.8481 2.41809 17667.4 55.8234 2.35006 17953.1 55.7984 2.28391 18243.5 55.7729 2.21959 18538.6 55.7471 2.15704 18838.4 55.7210 2.09623 19143.1 55.6945 2.03711 19452.7 55.6677 1.97964 19767.4 55.6406 1.92377 20087.1 55.6131 1.86946 20412.0 55.5853 1.81667 20742.1 55.5573 1.76536 21077.6 55.5288 1.71549 21418.5 55.5001 1.66703 21765.0 55.4710 1.61993 22117.0 55.4415 1.57417 22474.7 55.4117 1.52970 22838.2 55.3814 1.48648 23207.6 55.3507 1.44450 23583.0 55.3195 1.40371 23964.4 55.2877 1.36407 24352.0 55.2554 1.32557 24745.9 55.2224 1.28817 25146.2 55.1887 1.25183 25552.9 55.1543 1.21653 25966.2 55.1189 1.18224 26386.1 55.0826 1.14894 26812.9 55.0451 1.11659 27246.6 55.0064 1.08517 27687.3 54.9662 1.05465 28135.1 54.9244 1.02501 28590.2 54.8808 0.996231 29052.6 54.8351 0.968276 29522.5 54.7895 0.941128 30000.0 54.7272 0.914765 periodictable-1.5.0/periodictable/xsf/be.nff000066400000000000000000000470161310514471200210200ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.70333 10.1617 -9999. 1.71802 10.3261 -9999. 1.73284 10.4931 -9999. 1.74778 10.6628 -9999. 1.75737 10.8353 -9999. 1.76678 11.0105 -9999. 1.77624 11.1886 -9999. 1.78574 11.3696 -9999. 1.79530 11.5535 -9999. 1.80306 11.7404 -9999. 1.80629 11.9303 -9999. 1.80952 12.1232 -9999. 1.81276 12.3193 -9999. 1.81600 12.5186 -9999. 1.81871 12.7210 -9999. 1.81609 12.9268 -9999. 1.81347 13.1359 -9999. 1.80922 13.3483 -9999. 1.80410 13.5642 -9999. 1.79747 13.7836 -9999. 1.78729 14.0066 -9999. 1.77705 14.2331 -9999. 1.76267 14.4633 -9999. 1.74841 14.6972 -9999. 1.72956 14.9350 -9999. 1.71004 15.1765 -9999. 1.68541 15.4220 -9999. 1.65917 15.6714 -9999. 1.62778 15.9249 -9999. 1.59448 16.1825 -9999. 1.55788 16.4442 -9999. 1.52050 16.7102 -9999. 1.47675 16.9805 -9999. 1.43237 17.2551 -9999. 1.38176 17.5342 -9999. 1.33102 17.8178 -9999. 1.27265 18.1060 -9999. 1.22588 18.3988 -9999. 1.19605 18.6964 -9999. 1.16961 18.9988 -9999. 1.14509 19.3061 2.30967 1.10518 19.6184 2.31367 1.06950 19.9357 2.31537 1.03964 20.2581 2.31755 1.01722 20.5858 2.32374 0.999039 20.9187 2.34045 0.987135 21.2571 2.37239 0.952742 21.6009 2.38699 0.912693 21.9503 2.39600 0.874329 22.3053 2.40177 0.837576 22.6661 2.40538 0.802368 23.0327 2.40746 0.768641 23.4052 2.40846 0.736331 23.7838 2.40939 0.705380 24.1685 2.41248 0.675729 24.5594 2.41570 0.647325 24.9566 2.42027 0.609275 25.3602 2.41808 0.567900 25.7704 2.40985 0.529334 26.1872 2.39826 0.493388 26.6108 2.38435 0.459883 27.0412 2.36859 0.428653 27.4786 2.35116 0.399544 27.9230 2.33226 0.372411 28.3747 2.30996 0.347121 28.8336 2.28594 0.328404 29.3000 2.26312 0.315229 29.7739 2.24541 0.302582 30.2554 2.22901 0.290443 30.7448 2.21325 0.278791 31.2421 2.19800 0.267606 31.7474 2.18311 0.256870 32.2609 2.16844 0.246565 32.7827 2.15391 0.236673 33.3129 2.13952 0.227178 33.8517 2.12325 0.218064 34.3992 2.10677 0.211374 34.9556 2.09142 0.206573 35.5210 2.07852 0.201882 36.0955 2.06586 0.197297 36.6793 2.05353 0.192816 37.2726 2.04141 0.188437 37.8754 2.02931 0.184157 38.4880 2.01697 0.179975 38.9000 2.00799 0.177252 39.2000 2.00121 0.176713 39.5000 1.99567 0.176983 39.9000 1.98913 0.175827 40.0000 1.98733 0.175565 40.2760 1.98264 0.174663 40.5560 1.97786 0.174609 40.6970 1.97610 0.174013 41.1270 1.96960 0.173456 41.5660 1.96327 0.171435 42.1670 1.95400 0.170039 42.4730 1.94966 0.168799 42.9420 1.94280 0.168198 43.2600 1.93854 0.166905 43.7460 1.93138 0.165791 44.0760 1.92708 0.165390 44.4110 1.92291 0.164383 44.5810 1.92070 0.163618 44.9240 1.91607 0.162962 45.2720 1.91126 0.161326 45.4480 1.90903 0.161038 45.9850 1.90129 0.159149 46.7288 1.89036 0.157516 47.4846 1.87948 0.155990 47.6740 1.87667 0.155621 48.2650 1.86782 0.155028 48.8710 1.85943 0.155666 49.0760 1.85755 0.155951 49.2830 1.85503 0.154508 49.8930 1.84657 0.154198 50.7000 1.83364 0.155814 51.5200 1.82367 0.157447 51.9010 1.81956 0.158203 52.4010 1.81434 0.158683 53.2485 1.80585 0.158768 53.4010 1.80449 0.158784 53.9000 1.79914 0.157647 54.4010 1.79325 0.156933 54.9010 1.78748 0.157035 55.4000 1.78219 0.156125 55.9010 1.77644 0.155633 56.8052 1.76616 0.152967 56.9010 1.76491 0.152689 57.4010 1.75779 0.151560 57.9010 1.75138 0.151256 58.4000 1.74467 0.149795 59.3446 1.73066 0.148143 60.3044 1.71666 0.147555 60.9010 1.70803 0.147236 61.4010 1.70036 0.146656 62.3941 1.68542 0.147197 62.4010 1.68532 0.147201 63.4000 1.67044 0.146706 63.9020 1.66247 0.147388 64.4000 1.65492 0.147185 65.4010 1.63983 0.147806 65.9010 1.63182 0.147426 66.9669 1.61497 0.147801 68.0500 1.59766 0.147747 69.1507 1.57948 0.147404 69.4010 1.57524 0.147327 70.2340 1.56001 0.145950 71.3700 1.53888 0.145981 72.5243 1.51676 0.146011 72.5670 1.51586 0.146012 72.9000 1.50929 0.145632 73.5680 1.49567 0.146079 74.7579 1.47049 0.146106 74.9000 1.46741 0.146109 75.2350 1.46015 0.146426 75.5670 1.45305 0.146447 76.5680 1.43052 0.147310 77.2350 1.41539 0.147639 77.5670 1.40764 0.148124 77.9010 1.40006 0.148179 78.5670 1.38396 0.148938 78.9000 1.37631 0.148969 80.1761 1.34408 0.150222 80.9000 1.32524 0.150928 81.2340 1.31669 0.151099 81.5680 1.30817 0.151573 82.8873 1.27205 0.152380 83.5680 1.25273 0.152793 84.9010 1.21283 0.152919 86.2742 1.16875 0.153088 87.6696 1.12068 0.152944 89.0876 1.06780 0.152717 90.5285 1.00938 0.152457 91.9928 0.944630 0.152189 93.4807 0.872376 0.151920 94.9926 0.791324 0.151867 96.5291 0.699761 0.151828 97.5670 0.631310 0.151801 98.5680 0.560328 0.152508 98.7770 0.544993 0.152245 99.5260 0.486543 0.151861 99.9010 0.455599 0.151904 100.270 0.424344 0.151744 100.660 0.389731 0.152054 102.030 0.258588 0.151656 102.400 0.219148 0.151818 103.770 0.597848E-01 0.151969 104.030 0.260858E-01 0.152169 105.530 -0.191568 0.151371 106.530 -0.368308 0.151676 106.900 -0.441904 0.152246 107.770 -0.637412 0.154099 108.030 -0.702374 0.155662 108.280 -0.768299 0.156220 108.400 -0.802126 0.155741 108.530 -0.840651 0.156004 108.650 -0.876311 0.158215 108.770 -0.912731 0.158122 109.030 -0.997553 0.159793 109.150 -1.03849 0.161052 109.270 -1.08113 0.161306 109.400 -1.12894 0.163454 109.530 -1.17915 0.163557 109.770 -1.27829 0.165902 109.900 -1.33524 0.168057 110.030 -1.39580 0.168777 110.160 -1.45968 0.171253 110.270 -1.51640 0.172992 110.530 -1.66366 0.176080 110.660 -1.74613 0.179584 110.770 -1.81926 0.183052 110.900 -1.91441 0.183759 111.030 -2.01892 0.188659 111.150 -2.12502 0.191441 111.280 -2.25725 0.192239 111.400 -2.40087 0.199075 111.530 -2.58708 0.209517 111.600 -2.70637 0.223326 111.800 -3.21583 0.378238 112.000 -3.42252 1.03860 112.250 -3.41684 1.38190 112.500 -3.59292 1.57501 112.750 -3.95038 2.03965 113.000 -3.99197 3.05986 113.250 -3.32582 4.01793 113.500 -2.38510 4.15418 113.750 -1.77257 3.84564 114.000 -1.49267 3.56793 114.250 -1.40646 3.26353 114.500 -1.45558 3.11127 114.750 -1.51462 3.06546 115.000 -1.58085 3.03372 115.500 -1.68141 3.14487 115.750 -1.68766 3.23324 116.000 -1.67443 3.28469 116.250 -1.69668 3.30771 116.500 -1.74476 3.36223 116.750 -1.84100 3.42546 117.000 -1.91971 3.58866 117.250 -2.01798 3.75177 117.500 -2.09181 4.02099 117.750 -1.98599 4.48576 118.000 -1.69069 4.69519 118.250 -1.41511 4.80543 118.500 -1.17170 4.79021 118.750 -1.03307 4.76242 119.000 -0.919695 4.72326 119.250 -0.899806 4.70943 119.500 -0.833607 4.73952 120.500 -0.607801 5.01171 121.000 -0.546931 4.97342 121.500 -0.418154 5.37885 122.000 -0.951663E-01 5.50733 122.500 0.195563 5.47638 123.000 0.287270 5.41101 123.500 0.285511 5.46448 124.000 0.326778 5.80078 125.000 0.899833 6.30269 125.500 1.34102 6.64803 126.000 1.95659 6.68559 126.500 2.54905 6.64790 127.000 3.16414 6.40082 127.500 3.67151 6.01367 128.000 3.96394 5.39328 128.500 4.07172 5.00813 129.000 4.14772 4.55903 129.500 4.13409 4.20865 130.000 4.07072 3.82730 130.500 3.96867 3.59578 131.000 3.81583 3.26529 131.500 3.62226 3.15721 132.000 3.45638 3.02786 133.000 3.17671 2.92660 133.500 3.07605 2.93560 134.000 3.00843 2.93684 134.500 2.96221 2.94578 135.500 2.89396 2.93779 136.000 2.87584 2.94397 136.500 2.86874 2.93959 137.500 2.85627 2.89893 138.000 2.83336 2.87398 138.500 2.81506 2.87098 139.000 2.79734 2.84887 140.000 2.73715 2.83539 141.000 2.69982 2.87711 141.500 2.70638 2.90329 142.000 2.71550 2.90287 142.500 2.72019 2.91465 143.000 2.72987 2.91685 143.500 2.74333 2.92650 144.000 2.75592 2.91495 144.500 2.76383 2.91585 145.000 2.76841 2.90262 145.500 2.77007 2.90346 146.000 2.76964 2.89577 146.500 2.76561 2.89537 148.000 2.76343 2.93154 148.500 2.77483 2.94822 149.000 2.78740 2.95243 150.000 2.81919 2.98597 151.000 2.85322 2.98029 152.000 2.86818 2.98203 153.000 2.89266 3.01367 153.500 2.89847 3.01671 155.000 2.93623 3.06074 155.500 2.96092 3.08803 156.500 3.01251 3.12840 157.000 3.04430 3.14926 157.500 3.08675 3.17679 158.000 3.13492 3.18715 159.000 3.22830 3.19053 160.000 3.32359 3.19716 160.500 3.37652 3.19224 161.500 3.48313 3.16079 162.000 3.53440 3.15119 163.000 3.64004 3.07868 164.500 3.74596 2.93822 165.500 3.78278 2.85215 166.000 3.79484 2.81725 167.000 3.82135 2.73264 167.500 3.82362 2.69680 168.000 3.81959 2.65488 169.500 3.80124 2.57094 170.000 3.79268 2.55180 170.500 3.78838 2.54214 171.000 3.78748 2.52605 171.500 3.78804 2.51896 172.990 3.80814 2.47360 173.990 3.80347 2.43390 174.500 3.81339 2.43394 175.510 3.82900 2.40213 176.000 3.83339 2.38083 176.500 3.83871 2.36562 177.510 3.85216 2.32073 178.000 3.84430 2.28306 178.500 3.84361 2.27434 180.000 3.79942 2.22984 181.000 3.78489 2.22505 181.510 3.78464 2.22872 182.000 3.77923 2.21064 183.500 3.77455 2.19974 184.490 3.77588 2.18992 187.474 3.78737 2.16785 187.500 3.78737 2.16766 188.000 3.77910 2.15580 188.500 3.77675 2.16037 189.000 3.77711 2.15869 190.000 3.78555 2.16413 190.500 3.79166 2.15995 191.000 3.79603 2.16059 192.000 3.80715 2.14936 193.510 3.82898 2.14231 194.000 3.83942 2.13531 194.500 3.84007 2.11653 195.000 3.83469 2.11378 195.500 3.83653 2.11602 196.500 3.84812 2.10677 197.500 3.85281 2.09245 199.010 3.86036 2.09404 200.000 3.87172 2.08193 201.500 3.88191 2.07385 203.000 3.89450 2.07146 204.500 3.92105 2.06855 207.000 3.96780 2.04405 207.500 3.97172 2.03179 208.010 3.97628 2.03019 208.500 3.97935 2.02063 210.500 4.00635 2.00156 212.000 4.02425 1.97791 212.500 4.02760 1.97716 213.000 4.03863 1.96995 213.500 4.04264 1.95601 214.500 4.04244 1.94417 215.000 4.04818 1.94719 215.500 4.05146 1.93625 217.000 4.07177 1.91827 218.000 4.07937 1.90175 219.000 4.08572 1.89162 220.000 4.09161 1.87778 220.500 4.09066 1.87308 221.000 4.09659 1.87799 221.500 4.10445 1.86891 222.000 4.11052 1.86480 222.500 4.11500 1.85638 223.000 4.12075 1.85152 223.500 4.12176 1.84131 224.000 4.12134 1.83756 224.500 4.12348 1.84253 226.000 4.15704 1.82599 226.490 4.16101 1.81782 227.500 4.17850 1.80946 228.000 4.19190 1.79537 228.500 4.19439 1.77053 229.000 4.19072 1.76739 229.500 4.19374 1.75778 230.500 4.19691 1.74263 231.000 4.20734 1.73860 231.500 4.21071 1.72476 232.000 4.21210 1.70717 234.500 4.21500 1.66650 235.000 4.20480 1.65173 235.500 4.20096 1.64949 236.500 4.20132 1.65027 237.500 4.20371 1.63115 238.000 4.20288 1.62857 238.500 4.20322 1.62029 239.500 4.20097 1.61693 240.000 4.20624 1.61172 240.500 4.20812 1.60246 241.000 4.21110 1.59846 241.500 4.20782 1.58125 242.000 4.19755 1.57866 242.500 4.19930 1.58572 243.500 4.21118 1.57948 244.000 4.20763 1.56140 244.500 4.20246 1.56099 245.000 4.19678 1.55568 246.000 4.19512 1.55713 246.500 4.19511 1.55644 247.500 4.19613 1.55114 248.500 4.18859 1.55086 248.990 4.19626 1.56821 249.500 4.21213 1.56785 250.000 4.22653 1.55043 251.540 4.26661 1.54085 255.608 4.25156 1.50042 259.743 4.26764 1.46106 263.944 4.28045 1.42272 268.213 4.29117 1.38539 272.551 4.30032 1.34904 276.959 4.30821 1.31364 281.439 4.31501 1.27917 285.991 4.32087 1.24561 290.617 4.32588 1.21293 295.317 4.33013 1.18110 300.094 4.33368 1.15011 304.947 4.33653 1.11993 309.880 4.33874 1.09055 314.892 4.34029 1.06193 319.985 4.34126 1.03488 325.160 4.34227 1.00851 330.420 4.34307 0.982821 335.764 4.34364 0.957781 341.195 4.34399 0.933380 346.713 4.34413 0.909600 352.321 4.34408 0.886427 358.020 4.34387 0.863843 363.810 4.34352 0.841835 369.695 4.34307 0.820388 375.674 4.34247 0.799486 381.750 4.34234 0.779118 387.925 4.34238 0.759267 394.199 4.34228 0.738576 400.575 4.34177 0.718448 407.054 4.34059 0.697922 413.638 4.33897 0.677984 420.328 4.33688 0.658616 427.126 4.33438 0.639799 434.035 4.33165 0.621521 441.055 4.32870 0.603766 448.189 4.32557 0.586516 455.438 4.32228 0.569761 462.804 4.31886 0.553484 470.290 4.31532 0.537671 477.896 4.31169 0.522311 485.626 4.30798 0.507390 493.480 4.30421 0.492894 501.462 4.30038 0.478813 509.573 4.29651 0.465133 517.815 4.29262 0.451845 526.190 4.28871 0.438937 534.701 4.28480 0.426397 543.349 4.28091 0.414215 552.137 4.27707 0.402382 561.068 4.27342 0.390887 570.142 4.26964 0.379297 579.364 4.26575 0.368051 588.735 4.26181 0.357139 598.257 4.25782 0.346550 607.933 4.25382 0.336275 617.766 4.24986 0.326305 627.758 4.24601 0.316630 637.912 4.24229 0.307242 648.229 4.23849 0.297321 658.714 4.23444 0.287720 669.368 4.22972 0.278430 680.195 4.22459 0.270148 691.196 4.22029 0.262802 702.376 4.21661 0.255654 713.736 4.21310 0.247975 725.280 4.20947 0.240525 737.011 4.20574 0.233102 748.932 4.20199 0.225907 761.045 4.19823 0.218934 773.354 4.19446 0.212177 785.863 4.19072 0.205628 798.573 4.18700 0.199281 811.490 4.18331 0.193131 824.615 4.17967 0.187170 837.952 4.17606 0.181392 851.505 4.17249 0.175794 865.278 4.16897 0.170368 879.273 4.16547 0.165110 893.495 4.16203 0.160057 907.946 4.15866 0.155160 922.631 4.15540 0.150411 937.554 4.15220 0.145809 952.719 4.14905 0.141250 968.128 4.14591 0.136834 983.787 4.14280 0.132557 999.699 4.13974 0.128412 1015.87 4.13672 0.124398 1032.30 4.13375 0.120509 1049. 4.13082 0.116741 1065.96 4.12794 0.113091 1083.20 4.12511 0.109556 1100.72 4.12233 0.106131 1118.53 4.11960 0.102813 1136.62 4.11692 0.995984E-01 1155. 4.11429 0.964847E-01 1173.68 4.11170 0.934681E-01 1192.67 4.10917 0.905461E-01 1211.96 4.10668 0.877153E-01 1231.56 4.10424 0.849730E-01 1251.48 4.10185 0.823165E-01 1271.72 4.09951 0.797430E-01 1292.29 4.09722 0.772499E-01 1313.19 4.09497 0.748349E-01 1334.43 4.09277 0.724952E-01 1356.01 4.09061 0.702288E-01 1377.95 4.08851 0.680301E-01 1400.23 4.08644 0.659001E-01 1422.88 4.08442 0.638369E-01 1445.90 4.08245 0.618382E-01 1469.28 4.08052 0.599022E-01 1493.05 4.07864 0.580268E-01 1517.20 4.07683 0.562100E-01 1541.73 4.07504 0.543948E-01 1566.67 4.07327 0.526382E-01 1592.01 4.07153 0.509382E-01 1617.76 4.06982 0.492933E-01 1643.93 4.06814 0.477014E-01 1670.52 4.06650 0.461609E-01 1697.53 4.06489 0.446702E-01 1724.99 4.06331 0.432276E-01 1752.89 4.06176 0.418316E-01 1781.24 4.06025 0.404807E-01 1810.05 4.05877 0.391734E-01 1839.33 4.05733 0.379083E-01 1869.08 4.05592 0.366841E-01 1899.31 4.05453 0.354994E-01 1930.03 4.05319 0.343530E-01 1961.25 4.05187 0.332436E-01 1992.97 4.05059 0.321700E-01 2025.20 4.04935 0.311311E-01 2057.96 4.04813 0.300957E-01 2091.24 4.04693 0.290947E-01 2125.07 4.04575 0.281270E-01 2159.44 4.04460 0.271914E-01 2194.37 4.04346 0.262870E-01 2229.86 4.04236 0.254127E-01 2265.93 4.04127 0.245675E-01 2302.57 4.04021 0.237503E-01 2339.82 4.03918 0.229604E-01 2377.66 4.03817 0.221967E-01 2416.12 4.03718 0.214584E-01 2455.20 4.03621 0.207447E-01 2494.91 4.03527 0.200547E-01 2535.26 4.03435 0.193877E-01 2576.27 4.03345 0.187429E-01 2617.94 4.03257 0.181195E-01 2660.28 4.03171 0.175168E-01 2703.31 4.03088 0.169342E-01 2747.03 4.03006 0.163709E-01 2791.46 4.02926 0.158264E-01 2836.61 4.02849 0.153000E-01 2882.49 4.02773 0.147911E-01 2929.11 4.02700 0.142992E-01 2976.49 4.02628 0.138236E-01 3024.63 4.02559 0.133638E-01 3073.55 4.02491 0.129072E-01 3123.26 4.02424 0.124663E-01 3173.78 4.02359 0.120403E-01 3225.11 4.02295 0.116290E-01 3277.28 4.02233 0.112317E-01 3330.29 4.02172 0.108480E-01 3384.15 4.02113 0.104774E-01 3438.89 4.02055 0.101194E-01 3494.51 4.01998 0.977365E-02 3551.03 4.01943 0.943974E-02 3608.46 4.01890 0.911724E-02 3666.83 4.01837 0.880575E-02 3726.13 4.01786 0.850491E-02 3786.40 4.01736 0.821432E-02 3847.64 4.01688 0.793369E-02 3909.88 4.01641 0.766264E-02 3973.12 4.01595 0.740085E-02 4037.38 4.01550 0.714801E-02 4102.68 4.01506 0.690380E-02 4169.04 4.01464 0.666401E-02 4236.47 4.01423 0.643256E-02 4304.99 4.01382 0.620915E-02 4374.62 4.01343 0.599350E-02 4445.37 4.01304 0.578535E-02 4517.27 4.01267 0.558442E-02 4590.34 4.01230 0.539045E-02 4664.58 4.01195 0.520323E-02 4740.03 4.01160 0.502252E-02 4816.70 4.01126 0.484809E-02 4894.60 4.01093 0.467971E-02 4973.77 4.01061 0.451716E-02 5054.21 4.01030 0.436028E-02 5135.96 4.01000 0.420884E-02 5219.03 4.00970 0.406267E-02 5303.45 4.00941 0.391977E-02 5389.23 4.00913 0.378191E-02 5476.39 4.00886 0.364888E-02 5564.97 4.00860 0.352054E-02 5654.98 4.00834 0.339671E-02 5746.44 4.00808 0.327724E-02 5839.39 4.00784 0.316197E-02 5933.83 4.00760 0.305075E-02 6029.81 4.00737 0.294344E-02 6127.33 4.00714 0.283992E-02 6226.44 4.00692 0.274003E-02 6327.15 4.00671 0.264365E-02 6429.48 4.00650 0.254975E-02 6533.48 4.00630 0.245918E-02 6639.15 4.00610 0.237183E-02 6746.53 4.00591 0.228759E-02 6855.65 4.00572 0.220633E-02 6966.54 4.00554 0.212796E-02 7079.21 4.00536 0.205238E-02 7193.71 4.00519 0.197947E-02 7310.07 4.00502 0.190916E-02 7428.30 4.00485 0.184135E-02 7548.45 4.00469 0.177595E-02 7670.54 4.00454 0.171287E-02 7794.60 4.00439 0.165202E-02 7920.68 4.00424 0.159334E-02 8048.79 4.00410 0.153675E-02 8178.97 4.00396 0.148216E-02 8311.26 4.00383 0.142952E-02 8445.68 4.00370 0.137819E-02 8582.29 4.00357 0.132870E-02 8721.10 4.00345 0.128099E-02 8862.16 4.00333 0.123499E-02 9005.49 4.00321 0.119064E-02 9151.15 4.00310 0.114789E-02 9299.16 4.00299 0.110667E-02 9449.57 4.00288 0.106693E-02 9602.41 4.00277 0.102862E-02 9757.72 4.00267 0.991686E-03 9915.54 4.00257 0.956077E-03 10075.9 4.00248 0.921746E-03 10238.9 4.00238 0.888646E-03 10404.5 4.00229 0.856737E-03 10572.8 4.00221 0.825973E-03 10743.8 4.00212 0.796314E-03 10917.6 4.00204 0.767721E-03 11094.1 4.00196 0.740154E-03 11273.6 4.00188 0.713574E-03 11455.9 4.00180 0.687952E-03 11641.2 4.00173 0.663249E-03 11829.5 4.00165 0.639433E-03 12020.8 4.00158 0.616473E-03 12215.3 4.00152 0.594337E-03 12412.8 4.00145 0.572994E-03 12613.6 4.00139 0.552174E-03 12817.6 4.00132 0.532111E-03 13024.9 4.00126 0.512776E-03 13235.6 4.00120 0.494145E-03 13449.7 4.00115 0.476188E-03 13667.2 4.00109 0.458886E-03 13888.3 4.00104 0.442212E-03 14112.9 4.00098 0.426144E-03 14341.2 4.00093 0.410660E-03 14573.1 4.00088 0.395739E-03 14808.8 4.00083 0.381358E-03 15048.3 4.00079 0.367502E-03 15291.7 4.00074 0.354148E-03 15539.1 4.00070 0.341280E-03 15790.4 4.00065 0.328880E-03 16045.8 4.00061 0.316929E-03 16305.3 4.00057 0.305413E-03 16569.1 4.00053 0.294207E-03 16837.0 4.00049 0.283413E-03 17109.4 4.00046 0.273015E-03 17386.1 4.00042 0.262998E-03 17667.3 4.00039 0.253348E-03 17953.1 4.00035 0.244052E-03 18243.4 4.00032 0.235098E-03 18538.5 4.00029 0.226472E-03 18838.4 4.00026 0.218163E-03 19143.0 4.00023 0.210159E-03 19452.7 4.00020 0.202447E-03 19767.3 4.00017 0.195019E-03 20087.0 4.00014 0.187864E-03 20411.9 4.00011 0.180971E-03 20742.1 4.00009 0.174332E-03 21077.5 4.00006 0.167935E-03 21418.5 4.00004 0.161773E-03 21764.9 4.00001 0.155838E-03 22116.9 3.99999 0.150120E-03 22474.6 3.99997 0.144612E-03 22838.1 3.99995 0.139307E-03 23207.5 3.99992 0.134195E-03 23582.9 3.99990 0.129271E-03 23964.3 3.99988 0.124528E-03 24351.9 3.99986 0.119959E-03 24745.8 3.99985 0.115558E-03 25146.1 3.99983 0.111318E-03 25552.8 3.99981 0.107234E-03 25966.1 3.99979 0.103299E-03 26386.0 3.99978 0.995092E-04 26812.8 3.99976 0.958583E-04 27246.5 3.99974 0.923412E-04 27687.2 3.99973 0.889532E-04 28135.0 3.99971 0.856893E-04 28590.1 3.99970 0.825453E-04 29052.5 3.99969 0.795168E-04 29522.4 3.99967 0.765993E-04 29999.9 3.99966 0.737888E-04 30000.0 3.99966 0.737882E-04 periodictable-1.5.0/periodictable/xsf/bi.nff000066400000000000000000000321331310514471200210160ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 5.59475 10.1617 -9999. 5.63587 10.3261 -9999. 5.67729 10.4931 -9999. 5.71901 10.6628 -9999. 5.74574 10.8353 -9999. 5.75640 11.0106 -9999. 5.76707 11.1886 -9999. 5.77776 11.3696 -9999. 5.78847 11.5535 -9999. 5.78340 11.7404 -9999. 5.77387 11.9303 -9999. 5.76434 12.1232 -9999. 5.75484 12.3193 -9999. 5.74534 12.5186 -9999. 5.73586 12.7210 -9999. 5.72406 12.9268 -9999. 5.67153 13.1359 -9999. 5.61948 13.3483 -9999. 5.56792 13.5642 -9999. 5.51682 13.7836 -9999. 5.46620 14.0066 -9999. 5.41060 14.2331 -9999. 5.28850 14.4633 -9999. 5.16914 14.6973 -9999. 5.05248 14.9350 -9999. 4.93846 15.1765 -9999. 4.82700 15.4220 -9999. 4.68707 15.6714 -9999. 4.53829 15.9249 -9999. 4.39424 16.1825 -9999. 4.25475 16.4442 -9999. 4.07125 16.7102 -9999. 3.87241 16.9805 -9999. 3.68328 17.2551 -9999. 3.50388 17.5342 -9999. 3.33365 17.8178 -9999. 3.17167 18.1060 -9999. 3.01758 18.3989 -9999. 2.86324 18.6964 -9999. 2.71582 18.9988 -9999. 2.57599 19.3061 -9999. 2.43805 19.6184 -9999. 2.28909 19.9357 -9999. 2.14923 20.2582 -9999. 2.02042 20.5858 -9999. 1.90047 20.9188 -9999. 1.80769 21.2571 -9999. 1.75975 21.6009 -9999. 1.71309 21.9503 -9999. 1.66769 22.3053 -9999. 1.66217 22.6661 -9999. 1.65667 23.0327 -9999. 1.66869 23.4053 -9999. 1.70941 23.7838 -9999. 1.83603 24.1685 -9999. 3.17679 24.5594 -9999. 5.26044 24.9566 -9999. 5.65001 25.3603 -9999. 6.01014 25.7705 -9999. 6.20781 26.1873 -9999. 6.41200 26.6109 -9999. 6.59613 27.0413 -9999. 6.66920 27.4786 -9999. 6.74309 27.9231 -9999. 6.71156 28.3747 -9999. 6.48194 28.8337 -9999. 6.22131 29.3000 1.10812 5.95383 29.7739 1.19940 5.61307 30.2555 0.997764 5.11160 30.7449 0.643630 4.99396 31.2421 0.385943 4.92255 31.7475 0.136393 4.85011 32.2609 -0.159706 4.75922 32.7827 -0.573403 4.74686 33.3130 -0.938828 4.84900 33.8518 -1.30834 4.96323 34.3993 -1.67153 5.14702 34.9557 -2.04133 5.33761 35.5211 -2.45032 5.61053 36.0956 -2.80879 5.93962 36.6794 -3.15893 6.28799 37.2727 -3.54026 6.71997 37.8755 -3.84686 7.23537 38.4882 -4.09238 7.79031 39.1107 -4.25810 8.38453 39.7432 -4.38532 8.92134 40.3861 -4.50436 9.49251 41.0393 -4.58313 10.1003 41.7031 -4.58321 10.7469 42.3776 -4.50672 11.2982 43.0630 -4.47206 11.8304 43.7595 -4.43658 12.3877 44.4673 -4.37824 12.9713 45.1865 -4.26689 13.5588 45.9174 -4.15603 14.1222 46.6600 -4.03678 14.7091 47.4147 -3.89408 15.3203 48.1816 -3.70865 15.9570 48.9609 -3.44316 16.6201 49.7528 -3.14637 17.1727 50.5576 -2.87072 17.7383 51.3753 -2.58320 18.3224 52.2062 -2.26703 18.9258 53.0506 -1.89308 19.5491 53.9087 -1.43548 20.1059 54.7806 -1.01662 20.6226 55.6667 -0.603289 21.1526 56.5670 -0.167429 21.6961 57.4820 0.314131 22.2508 58.4117 0.813452 22.7585 59.3564 1.31789 23.2777 60.3165 1.84630 23.8087 61.2921 2.41282 24.3519 62.2834 3.04049 24.8796 63.2908 3.67879 25.3875 64.3145 4.34984 25.9057 65.3547 5.07097 26.4345 66.4118 5.87280 26.9741 67.4859 6.83904 27.5247 68.5775 7.83757 27.7893 69.6867 8.77022 28.0497 70.8138 9.71685 28.3124 71.9591 10.7503 28.5777 73.1230 11.8257 28.6580 74.3057 12.8413 28.7016 75.5076 13.8748 28.7452 76.7289 15.0291 28.7890 77.9699 16.2721 28.5065 79.2310 17.2923 28.0891 80.5125 18.2075 27.6778 81.8147 19.0627 27.2486 83.1380 19.8566 26.8172 84.4827 20.6099 26.3925 85.8491 21.3448 25.9746 87.2377 22.0742 25.5314 88.6487 22.7660 25.0774 90.0825 23.4398 24.6314 91.5395 24.1183 24.1934 93.0201 24.8288 23.7631 94.5246 25.6622 23.3405 96.0535 26.6134 22.5488 97.6071 27.2743 21.6101 99.1858 27.7446 20.7107 100.790 28.1233 19.8486 102.420 28.4341 19.0224 104.077 28.6957 18.2306 105.760 28.9276 17.4717 107.471 29.1749 16.7444 109.209 29.3953 15.8866 110.975 29.4902 15.0370 112.770 29.4978 14.2328 114.594 29.4539 13.4716 116.448 29.3717 12.7511 118.331 29.2688 12.0692 120.245 29.1271 11.3780 122.190 28.9363 10.7249 124.166 28.7068 10.1092 126.175 28.4459 9.52883 128.215 28.1550 8.98179 130.289 27.8310 8.46617 132.397 27.4613 7.98016 134.538 26.9804 7.58635 136.714 26.5968 7.35935 138.925 26.2764 7.13913 141.172 25.9899 6.92551 143.456 25.7252 6.71828 145.776 25.4798 6.51725 148.134 25.2663 6.32225 150.530 25.0556 6.06358 152.964 24.8090 5.80346 155.439 24.5354 5.55451 157.953 24.2446 5.31624 160.507 23.9365 5.08829 163.103 23.6106 4.87127 165.742 23.2641 4.66351 168.422 22.8888 4.46460 171.146 22.4382 4.28088 173.915 21.9971 4.22036 176.727 21.5792 4.16070 179.586 21.1385 4.13836 182.491 20.7351 4.16129 185.442 20.3458 4.18435 188.442 19.9362 4.21782 191.489 19.5378 4.28349 194.587 19.1282 4.35020 197.734 18.7200 4.46653 200.932 18.3185 4.58786 204.182 17.8843 4.72224 207.485 17.4668 4.93718 210.840 17.0713 5.16189 214.251 16.6743 5.40210 217.716 16.2889 5.67319 221.237 15.9097 5.95788 224.816 15.5149 6.25686 228.452 15.0854 6.63646 232.147 14.7159 7.09375 235.902 14.4218 7.56174 239.717 14.1425 8.03066 243.595 13.8802 8.52868 247.535 13.6524 9.05756 251.538 13.5101 9.61926 255.607 13.3842 10.0879 259.741 13.2343 10.5737 263.942 13.0861 11.0830 268.211 12.9484 11.6168 272.549 12.8282 12.1763 276.957 12.7321 12.7628 281.437 12.6801 13.3680 285.989 12.6404 13.9689 290.615 12.6197 14.5968 295.315 12.6284 15.2530 300.092 12.6791 15.9386 304.945 12.7897 16.6550 309.878 13.0255 17.4037 314.890 13.3084 17.9677 319.983 13.5510 18.5180 325.158 13.7720 19.0851 330.418 14.0083 19.6696 335.762 14.2750 20.2720 341.192 14.6115 20.8928 346.711 14.9897 21.4105 352.319 15.3421 21.9057 358.017 15.6803 22.4124 363.808 16.0345 22.9308 369.692 16.4353 23.4612 375.672 16.8986 23.9359 381.748 17.3179 24.3396 387.922 17.7114 24.7501 394.197 18.0973 25.1675 400.573 18.4826 25.5919 407.052 18.8630 26.0235 413.635 19.2563 26.4833 420.326 19.6729 26.9520 427.124 20.1128 27.4290 434.032 20.5800 27.9145 441.052 21.0809 28.4085 448.186 21.6619 28.9113 455.435 22.2816 29.3194 462.802 22.8700 29.6927 470.287 23.4535 30.0707 477.894 24.0485 30.4535 485.623 24.6663 30.8412 493.478 25.3211 31.2338 501.459 26.0639 31.6181 509.570 26.7985 31.8778 517.812 27.5174 32.1397 526.187 28.2460 32.4037 534.698 29.0050 32.6699 543.346 29.9153 32.9383 552.134 30.8341 32.9523 561.065 31.6373 32.9118 570.139 32.4095 32.8642 579.361 33.1353 32.7636 588.732 33.8173 32.6485 598.254 34.4572 32.5242 607.930 35.0647 32.3983 617.763 35.6477 32.2744 627.755 36.2197 32.1503 637.908 36.7777 32.0059 648.226 37.3103 31.8363 658.711 37.7937 31.6506 669.365 38.2328 31.4662 680.191 38.6227 31.2764 691.193 38.9316 31.0889 702.372 39.0790 30.9528 713.733 39.1629 31.0932 725.277 39.4522 31.4277 737.008 39.8959 31.7660 748.928 40.4608 32.1078 761.042 41.1751 32.4447 773.351 42.0989 32.6938 785.859 43.1424 32.6485 798.570 43.9905 32.3598 811.486 44.7087 32.0735 824.611 45.3623 31.7899 837.949 45.9784 31.5088 851.502 46.5668 31.2124 865.274 47.1247 30.8973 879.269 47.6319 30.5664 893.491 48.0938 30.2391 907.943 48.5095 29.9153 922.628 48.8364 29.5949 937.551 49.1540 29.4329 952.715 49.5087 29.3138 968.124 49.9373 29.2321 983.783 50.4325 29.1508 999.695 51.0058 29.0409 1015.86 51.7037 28.9006 1032.29 52.3369 28.4669 1048.99 52.8628 28.0364 1065.96 53.3168 27.6114 1083.20 53.7294 27.1925 1100.72 54.1093 26.7795 1118.52 54.4619 26.3723 1136.61 54.7906 25.9709 1155. 55.0983 25.5756 1173.68 55.3878 25.1862 1192.66 55.6599 24.8017 1211.95 55.9159 24.4228 1231.55 56.1570 24.0494 1251.47 56.3839 23.6812 1271.72 56.5976 23.3185 1292.29 56.7993 22.9612 1313.19 56.9891 22.6085 1334.43 57.1674 22.2610 1356.01 57.3354 21.9187 1377.94 57.4931 21.5806 1400.23 57.6413 21.2474 1422.88 57.7809 20.9192 1445.89 57.9138 20.5955 1469.28 58.0434 20.2726 1493.04 58.1707 19.9485 1517.19 58.2811 19.6048 1541.73 58.3695 19.2634 1566.67 58.4392 18.9277 1592.01 58.4936 18.5967 1617.76 58.5331 18.2711 1643.92 58.5589 17.9511 1670.51 58.5716 17.6363 1697.53 58.5714 17.3265 1724.99 58.5652 17.0214 1752.89 58.5439 16.7074 1781.24 58.5009 16.3939 1810.05 58.4357 16.0819 1839.32 58.3477 15.7758 1869.07 58.2387 15.4754 1899.30 58.1082 15.1805 1930.02 57.9548 14.8906 1961.24 57.7769 14.6058 1992.96 57.5695 14.3258 2025.20 57.3450 14.0599 2057.95 57.0898 13.7800 2091.24 56.7907 13.5035 2125.06 56.4472 13.2301 2159.43 56.0535 12.9601 2194.36 55.6001 12.6921 2229.85 55.0762 12.4287 2265.92 54.4678 12.1683 2302.57 53.7528 11.9106 2339.81 52.9020 11.6568 2377.66 51.8689 11.4055 2416.11 50.5794 11.1583 2455.19 48.8991 10.9141 2494.90 46.5395 10.6732 2535.26 42.6488 10.4354 2576.26 28.1189 10.2018 2579.50 9.13918 10.1838 2579.70 9.14246 27.1839 2617.93 40.3363 26.5725 2660.27 41.4670 25.9213 2687.50 23.2248 25.5164 2687.70 23.2489 37.0195 2703.30 42.2812 36.6982 2747.03 49.1143 35.8220 2791.46 52.6339 34.9676 2836.61 55.1051 34.1335 2882.49 56.9928 33.3201 2929.11 58.4818 32.5276 2976.48 59.6577 31.7549 3024.63 60.5490 31.0012 3073.55 61.1241 30.2668 3123.26 61.1824 29.5496 3173.78 57.8803 28.8501 3176.80 52.7624 28.8092 3177. 52.7669 33.5350 3225.11 62.8945 32.7897 3277.27 64.7491 32.0124 3330.28 66.0397 31.2547 3384.15 67.0599 30.5161 3438.88 67.8991 29.7951 3494.50 68.5932 29.0920 3551.02 69.1500 28.4073 3608.46 69.5418 27.7403 3666.82 69.5695 27.0886 3696.20 66.9359 26.7703 3696.40 66.9379 28.3750 3726.13 70.1110 28.0453 3786.40 71.1324 27.3966 3847.64 71.7773 26.7648 3909.87 72.2333 26.1474 3973.11 72.3902 25.5451 3999. 70.8760 25.3053 3999.20 70.8774 26.2702 4037.38 72.9817 25.9350 4102.68 73.7290 25.3787 4169.03 74.2927 24.8312 4236.46 74.7772 24.2907 4304.98 75.2085 23.7588 4374.62 75.6002 23.2360 4445.37 75.9584 22.7203 4517.27 76.2872 22.2137 4590.33 76.5910 21.7155 4664.58 76.8712 21.2252 4740.03 77.1296 20.7437 4816.69 77.3686 20.2709 4894.60 77.5896 19.8067 4973.77 77.7937 19.3506 5054.21 77.9818 18.9033 5135.96 78.1552 18.4643 5219.03 78.3146 18.0338 5303.44 78.4610 17.6115 5389.22 78.5948 17.1975 5476.39 78.7170 16.7919 5564.97 78.8282 16.3946 5654.98 78.9290 16.0053 5746.44 79.0199 15.6238 5839.39 79.1013 15.2503 5933.83 79.1738 14.8848 6029.81 79.2380 14.5272 6127.33 79.2940 14.1769 6226.44 79.3423 13.8345 6327.15 79.3834 13.4995 6429.48 79.4176 13.1719 6533.48 79.4452 12.8515 6639.15 79.4665 12.5383 6746.54 79.4818 12.2323 6855.65 79.4914 11.9329 6966.54 79.4953 11.6407 7079.22 79.4941 11.3551 7193.72 79.4878 11.0760 7310.07 79.4765 10.8033 7428.31 79.4605 10.5373 7548.45 79.4401 10.2774 7670.54 79.4151 10.0236 7794.61 79.3859 9.77602 7920.68 79.3527 9.53421 8048.79 79.3153 9.29804 8178.98 79.2737 9.06776 8311.26 79.2283 8.84305 8445.69 79.1792 8.62377 8582.29 79.1259 8.40951 8721.11 79.0686 8.20086 8862.16 79.0075 7.99743 9005.50 78.9424 7.79859 9151.16 78.8731 7.60504 9299.17 78.7998 7.41595 9449.58 78.7220 7.23172 9602.42 78.6397 7.05212 9757.73 78.5529 6.87721 9915.55 78.4638 6.70650 10075.9 78.3690 6.53426 10238.9 78.2629 6.36673 10404.5 78.1491 6.20381 10572.8 78.0268 6.04538 10743.8 77.8953 5.89136 10917.6 77.7535 5.74164 11094.2 77.6000 5.59611 11273.6 77.4329 5.45469 11455.9 77.2500 5.31727 11641.2 77.0479 5.18377 11829.5 76.8221 5.05407 12020.8 76.5665 4.92810 12215.3 76.2715 4.80576 12412.8 75.9224 4.68697 12613.6 75.4940 4.57162 12817.6 74.9378 4.45965 13025.0 74.1399 4.35095 13235.6 72.7017 4.24546 13418.5 58.2887 4.15727 13418.7 58.2892 10.2218 13449.7 69.4057 10.1806 13667.2 73.4755 9.89838 13888.3 74.6788 9.62401 14112.9 75.3581 9.35725 14341.2 75.7850 9.09789 14573.1 76.0453 8.84571 14808.9 76.1675 8.60054 15048.4 76.1447 8.36215 15291.8 75.9175 8.13039 15539.1 75.2196 7.90505 15711.0 68.0671 7.75415 15711.2 68.0679 10.8698 15790.4 74.5726 10.7894 16045.8 75.9945 10.5370 16305.4 76.1589 10.2906 16387.4 73.4280 10.2147 16387.6 73.4285 11.5832 16569.1 77.0720 11.4028 16837.1 77.9083 11.1451 17109.4 78.4815 10.8912 17386.1 78.9368 10.6412 17667.4 79.3186 10.3950 17953.1 79.6481 10.1528 18243.5 79.9373 9.91464 18538.6 80.1944 9.68053 18838.4 80.4245 9.45049 19143.1 80.6320 9.22457 19452.7 80.8196 9.00276 19767.4 80.9901 8.78506 20087.1 81.1452 8.57149 20412.0 81.2866 8.36203 20742.1 81.4156 8.15668 21077.6 81.5334 7.95540 21418.5 81.6411 7.75819 21765.0 81.7394 7.56501 22117.0 81.8291 7.37584 22474.7 81.9110 7.19065 22838.2 81.9855 7.00938 23207.6 82.0533 6.83202 23583.0 82.1148 6.65850 23964.4 82.1705 6.48879 24352.0 82.2208 6.32284 24745.9 82.2661 6.16061 25146.2 82.3066 6.00204 25552.9 82.3428 5.84708 25966.2 82.3748 5.69568 26386.1 82.4030 5.54777 26812.9 82.4277 5.40332 27246.6 82.4489 5.26226 27687.3 82.4671 5.12453 28135.1 82.4823 4.99008 28590.2 82.4947 4.85885 29052.6 82.5046 4.73079 29522.5 82.5120 4.60582 30000.0 82.5172 4.48391 periodictable-1.5.0/periodictable/xsf/br.nff000066400000000000000000000315371310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 5.16199 10.1617 -9999. 5.31855 10.3261 -9999. 5.47986 10.4931 -9999. 5.64606 10.6628 -9999. 5.81730 10.8353 -9999. 5.99373 11.0106 -9999. 6.17552 11.1886 -9999. 6.36281 11.3696 -9999. 6.55580 11.5535 -9999. 6.75463 11.7404 -9999. 6.95949 11.9303 -9999. 7.17057 12.1232 -9999. 7.38804 12.3193 -9999. 7.58343 12.5186 -9999. 7.77469 12.7210 -9999. 7.97079 12.9268 -9999. 8.15805 13.1359 -9999. 8.33656 13.3483 -9999. 8.51899 13.5642 -9999. 8.70540 13.7836 -9999. 8.85695 14.0066 -9999. 9.00806 14.2331 -9999. 9.16174 14.4633 -9999. 9.31805 14.6973 -9999. 9.47702 14.9350 -9999. 9.54582 15.1765 -9999. 9.60017 15.4220 -9999. 9.65483 15.6714 -9999. 9.70981 15.9249 -9999. 9.76508 16.1825 -9999. 9.82068 16.4442 -9999. 9.87659 16.7102 -9999. 9.93283 16.9805 -9999. 9.98937 17.2551 -9999. 9.99258 17.5342 -9999. 9.97751 17.8178 -9999. 9.96245 18.1060 -9999. 9.94743 18.3989 -9999. 9.93243 18.6964 -9999. 9.91745 18.9988 -9999. 9.90249 19.3061 -9999. 9.82616 19.6184 -9999. 9.72846 19.9357 -9999. 9.63175 20.2582 -9999. 9.53599 20.5858 -9999. 9.44119 20.9188 -9999. 9.34434 21.2571 -9999. 9.13918 21.6009 -9999. 8.93851 21.9503 -9999. 8.74225 22.3053 -9999. 8.55031 22.6661 -9999. 8.36258 23.0327 -9999. 8.17896 23.4053 -9999. 7.99939 23.7838 -9999. 7.82375 24.1685 -9999. 7.65197 24.5594 -9999. 7.48396 24.9566 -9999. 7.31964 25.3603 -9999. 7.15499 25.7705 -9999. 6.84731 26.1873 -9999. 6.55286 26.6109 -9999. 6.27107 27.0413 -9999. 6.00140 27.4786 -9999. 5.74332 27.9231 -9999. 5.49634 28.3747 -9999. 5.25999 28.8337 -9999. 5.03379 29.3000 10.3082 4.81733 29.7739 10.3170 4.61018 30.2555 10.3222 4.41193 30.7449 10.3268 4.22220 31.2421 10.3374 4.04064 31.7475 10.3725 3.84576 32.2609 10.3733 3.60661 32.7827 10.3417 3.38232 33.3130 10.2919 3.17199 33.8518 10.2304 2.97474 34.3993 10.1602 2.78975 34.9557 10.0832 2.61626 35.5211 10.0011 2.45357 36.0956 9.91476 2.30099 36.6794 9.82528 2.15790 37.2727 9.73335 2.02370 37.8755 9.63964 1.89786 38.4882 9.54522 1.77983 39.1107 9.45197 1.66750 39.7432 9.35472 1.55775 40.3861 9.25390 1.45522 41.0393 9.15104 1.35945 41.7031 9.04651 1.26997 42.3776 8.93986 1.18639 43.0630 8.82982 1.11133 43.7595 8.72291 1.04371 44.4673 8.61713 0.980199 45.1865 8.51107 0.920558 45.9174 8.40366 0.864544 46.6600 8.29610 0.815397 47.4147 8.18957 0.769296 48.1816 8.08253 0.725801 48.9609 7.97365 0.684766 49.7528 7.85998 0.647698 50.5576 7.74794 0.621275 51.3753 7.63802 0.595928 52.2062 7.52717 0.571616 53.0506 7.41120 0.549811 53.9087 7.29633 0.538688 54.7806 7.18307 0.527790 55.6667 7.06722 0.519232 56.5670 6.95124 0.513192 57.4820 6.83022 0.510186 58.4117 6.71055 0.512216 59.3564 6.58978 0.514254 60.3165 6.46503 0.516291 61.2921 6.33410 0.518279 62.2834 6.19362 0.520274 63.2908 6.03782 0.526423 64.3145 5.87086 0.537133 65.3547 5.68301 0.548060 66.4118 5.44005 0.558161 67.4859 5.01881 0.654814 68.5775 4.70397 1.05610 69.6867 4.78236 1.53791 70.8138 4.94458 1.80131 71.9591 5.10409 1.85264 73.1230 5.28662 1.90543 74.3057 5.17992 1.59532 75.5076 5.00758 1.62740 76.7289 4.87591 1.67037 77.9699 4.73650 1.71446 79.2310 4.58138 1.79608 80.5125 4.44235 1.89596 81.8147 4.31084 2.00140 83.1380 4.17885 2.11271 84.4827 4.04002 2.23270 85.8491 3.90447 2.37166 87.2377 3.77359 2.51927 88.6487 3.64515 2.67606 90.0825 3.51865 2.84262 91.5395 3.39434 3.01954 93.0201 3.27238 3.20747 94.5246 3.15339 3.40710 96.0535 3.03751 3.61915 97.6071 2.92520 3.84635 99.1858 2.82119 4.08996 100.790 2.72718 4.34901 102.420 2.64538 4.62445 104.077 2.58033 4.91735 105.760 2.53929 5.22879 107.471 2.54628 5.55997 109.209 2.60514 5.82589 110.975 2.63093 6.06508 112.770 2.63820 6.31409 114.594 2.64529 6.57333 116.448 2.65608 6.84321 118.331 2.67457 7.12417 120.245 2.70524 7.41667 122.190 2.75992 7.72117 124.166 2.83661 7.99945 126.175 2.90459 8.27373 128.215 2.97084 8.55742 130.289 3.04474 8.85084 132.397 3.12990 9.15431 134.538 3.23125 9.46820 136.714 3.35636 9.79285 138.925 3.53026 10.1286 141.172 3.73627 10.3839 143.456 3.91159 10.6203 145.776 4.06866 10.8620 148.134 4.22427 11.1093 150.530 4.38223 11.3621 152.964 4.54667 11.6208 155.439 4.72856 11.8853 157.953 4.91473 12.1279 160.507 5.09557 12.3736 163.103 5.27781 12.6242 165.742 5.46392 12.8799 168.422 5.65508 13.1408 171.146 5.84792 13.4070 173.915 6.04807 13.6943 176.727 6.27170 13.9949 179.586 6.51812 14.3021 182.491 6.78961 14.6161 185.442 7.09257 14.9370 188.442 7.44074 15.2649 191.489 7.88928 15.5943 194.587 8.33263 15.7401 197.734 8.73032 15.8873 200.932 9.10381 16.0359 204.182 9.47423 16.1858 207.485 9.84936 16.3371 210.840 10.2387 16.4899 214.251 10.6965 16.6195 217.716 11.1175 16.6621 221.237 11.4972 16.7047 224.816 11.8630 16.7475 228.452 12.2205 16.7904 232.147 12.5732 16.8334 235.902 12.9238 16.8765 239.717 13.2751 16.9197 243.595 13.6305 16.9630 247.535 13.9997 17.0041 251.538 14.3663 17.0202 255.607 14.7286 17.0363 259.741 15.0923 17.0523 263.942 15.4627 17.0685 268.211 15.8465 17.0848 272.549 16.2576 17.1008 276.957 16.7337 17.0615 281.437 17.1778 16.9530 285.989 17.5746 16.8014 290.615 17.9352 16.6453 295.315 18.2686 16.4908 300.092 18.5842 16.3374 304.945 18.8852 16.1853 309.878 19.1737 16.0347 314.890 19.4517 15.8857 319.983 19.7208 15.7381 325.158 19.9815 15.5915 330.418 20.2349 15.4466 335.762 20.4822 15.3030 341.192 20.7237 15.1606 346.711 20.9603 15.0198 352.319 21.1930 14.8803 358.017 21.4222 14.7419 363.808 21.6486 14.6046 369.692 21.8730 14.4687 375.672 22.0977 14.3345 381.748 22.3249 14.2009 387.922 22.5591 14.0653 394.197 22.8086 13.9238 400.573 23.0567 13.7416 407.052 23.2741 13.5455 413.635 23.4736 13.3527 420.326 23.6612 13.1620 427.124 23.8391 12.9740 434.032 24.0092 12.7887 441.052 24.1730 12.6061 448.186 24.3351 12.4250 455.435 24.4908 12.2407 462.802 24.6393 12.0545 470.287 24.7788 11.8687 477.894 24.9102 11.6857 485.623 25.0356 11.5059 493.478 25.1560 11.3289 501.459 25.2719 11.1544 509.570 25.3840 10.9830 517.812 25.4946 10.8134 526.187 25.6020 10.6437 534.698 25.7057 10.4730 543.346 25.8038 10.3033 552.134 25.9004 10.1366 561.065 25.9943 9.96328 570.139 26.0778 9.78887 579.361 26.1535 9.61983 588.732 26.2247 9.45455 598.254 26.2927 9.29263 607.930 26.3579 9.13351 617.763 26.4211 8.97713 627.755 26.4854 8.82280 637.908 26.5496 8.66345 648.226 26.6088 8.49574 658.711 26.6523 8.32399 669.365 26.6794 8.15581 680.191 26.6930 8.00884 691.193 26.7124 7.87810 702.372 26.7481 7.75250 713.733 26.7890 7.61430 725.277 26.8194 7.46864 737.008 26.8425 7.32583 748.928 26.8608 7.18574 761.042 26.8758 7.04823 773.351 26.8886 6.91233 785.859 26.8985 6.77544 798.570 26.9017 6.63833 811.486 26.8992 6.50390 824.611 26.8920 6.37222 837.949 26.8802 6.24321 851.502 26.8642 6.11717 865.274 26.8443 5.99398 879.269 26.8208 5.87352 893.491 26.7936 5.75539 907.943 26.7627 5.63967 922.628 26.7284 5.52634 937.551 26.6901 5.41402 952.715 26.6474 5.30367 968.124 26.6000 5.19529 983.783 26.5481 5.08921 999.695 26.4921 4.98481 1015.86 26.4323 4.88204 1032.29 26.3662 4.77730 1048.99 26.2927 4.67393 1065.96 26.2110 4.57191 1083.20 26.1212 4.47206 1100.72 26.0230 4.37440 1118.52 25.9160 4.27890 1136.61 25.7995 4.18557 1155. 25.6727 4.09423 1173.68 25.5345 4.00483 1192.66 25.3836 3.91747 1211.95 25.2186 3.83198 1231.55 25.0377 3.74829 1251.47 24.8383 3.66604 1271.72 24.6174 3.58518 1292.29 24.3707 3.50559 1313.19 24.0935 3.42786 1334.43 23.7797 3.35181 1356.01 23.4205 3.27736 1377.94 23.0039 3.20470 1400.23 22.5125 3.13364 1422.88 21.9194 3.06414 1445.89 21.1806 2.99614 1469.28 20.2158 2.93108 1493.04 18.8585 2.86962 1517.19 16.6528 2.81872 1541.73 10.8963 2.77001 1549.80 -8.00939 2.75434 1550. -8.00155 16.3564 1566.67 14.3906 16.1344 1592.01 18.5751 15.8069 1617.76 20.7653 15.4860 1643.92 22.2477 15.1717 1670.51 23.3454 14.8636 1697.53 24.1806 14.5619 1724.99 24.7915 14.2664 1752.89 25.1151 13.9766 1781.24 23.4156 13.6927 1781.90 22.0893 13.6862 1782.10 22.0949 15.7617 1810.05 26.4421 15.4199 1839.32 27.4629 15.0753 1869.07 28.2262 14.7383 1899.30 28.8609 14.4087 1930.02 29.4112 14.0865 1961.24 29.8997 13.7716 1992.96 30.3367 13.4637 2025.20 30.7417 13.1705 2057.95 31.1155 12.8665 2091.24 31.4551 12.5672 2125.06 31.7653 12.2728 2159.43 32.0507 11.9839 2194.36 32.3138 11.6995 2229.85 32.5565 11.4205 2265.92 32.7811 11.1469 2302.57 32.9891 10.8783 2339.81 33.1818 10.6147 2377.66 33.3601 10.3561 2416.11 33.5253 10.1027 2455.19 33.6783 9.85422 2494.90 33.8199 9.61099 2535.26 33.9512 9.37299 2576.26 34.0727 9.13942 2617.93 34.1848 8.91091 2660.27 34.2884 8.68762 2703.30 34.3844 8.46894 2747.03 34.4724 8.25470 2791.46 34.5536 8.04560 2836.61 34.6279 7.84066 2882.49 34.6961 7.64096 2929.11 34.7588 7.44520 2976.48 34.8156 7.25383 3024.63 34.8674 7.06723 3073.55 34.9143 6.88467 3123.26 34.9566 6.70639 3173.78 34.9945 6.53229 3225.11 35.0286 6.36274 3277.27 35.0590 6.19664 3330.28 35.0856 6.03460 3384.15 35.1088 5.87652 3438.88 35.1289 5.72225 3494.50 35.1461 5.57163 3551.02 35.1603 5.42476 3608.46 35.1720 5.28146 3666.82 35.1812 5.14165 3726.13 35.1880 5.00538 3786.40 35.1927 4.87240 3847.64 35.1953 4.74275 3909.87 35.1959 4.61636 3973.11 35.1948 4.49313 4037.38 35.1919 4.37301 4102.68 35.1874 4.25594 4169.03 35.1815 4.14184 4236.46 35.1741 4.03063 4304.98 35.1654 3.92231 4374.62 35.1555 3.81666 4445.37 35.1444 3.71380 4517.27 35.1323 3.61361 4590.33 35.1191 3.51593 4664.58 35.1049 3.42088 4740.03 35.0900 3.32825 4816.69 35.0742 3.23800 4894.60 35.0576 3.15011 4973.77 35.0402 3.06455 5054.21 35.0222 2.98128 5135.96 35.0037 2.90015 5219.03 34.9845 2.82110 5303.44 34.9647 2.74416 5389.22 34.9444 2.66931 5476.39 34.9237 2.59642 5564.97 34.9025 2.52550 5654.98 34.8809 2.45641 5746.44 34.8589 2.38918 5839.39 34.8366 2.32373 5933.83 34.8139 2.25999 6029.81 34.7908 2.19793 6127.33 34.7673 2.13764 6226.44 34.7437 2.07891 6327.15 34.7197 2.02176 6429.48 34.6954 1.96608 6533.48 34.6708 1.91204 6639.15 34.6460 1.85931 6746.54 34.6209 1.80808 6855.65 34.5955 1.75823 6966.54 34.5699 1.70968 7079.22 34.5439 1.66245 7193.72 34.5177 1.61655 7310.07 34.4911 1.57178 7428.31 34.4642 1.52832 7548.45 34.4370 1.48603 7670.54 34.4094 1.44482 7794.61 34.3815 1.40479 7920.68 34.3531 1.36582 8048.79 34.3243 1.32790 8178.98 34.2950 1.29101 8311.26 34.2652 1.25513 8445.69 34.2348 1.22022 8582.29 34.2037 1.18625 8721.11 34.1720 1.15322 8862.16 34.1395 1.12107 9005.50 34.1061 1.08980 9151.16 34.0718 1.05937 9299.17 34.0364 1.02978 9449.58 33.9998 1.00099 9602.42 33.9620 0.972971 9757.73 33.9226 0.945717 9915.55 33.8815 0.919210 10075.9 33.8385 0.893416 10238.9 33.7932 0.868322 10404.5 33.7455 0.843909 10572.8 33.6948 0.820157 10743.8 33.6408 0.797050 10917.6 33.5827 0.774568 11094.2 33.5200 0.752695 11273.6 33.4516 0.731414 11455.9 33.3763 0.710710 11641.2 33.2925 0.690565 11829.5 33.1981 0.670965 12020.8 33.0899 0.651895 12215.3 32.9635 0.633339 12412.8 32.8116 0.615284 12613.6 32.6225 0.597716 12817.6 32.3740 0.580621 13025.0 32.0171 0.563987 13235.6 31.4020 0.547800 13449.7 29.0525 0.532049 13473.6 23.2529 0.530333 13473.8 23.2532 3.86204 13667.2 31.3642 3.77868 13888.3 32.2279 3.68700 14112.9 32.7278 3.59694 14341.2 33.0826 3.50852 14573.1 33.3575 3.42173 14808.9 33.5811 3.33658 15048.4 33.7688 3.25306 15291.8 33.9297 3.17118 15539.1 34.0697 3.09092 15790.4 34.1929 3.01229 16045.8 34.3023 2.93528 16305.4 34.4001 2.85986 16569.1 34.4880 2.78604 16837.1 34.5672 2.71379 17109.4 34.6390 2.64311 17386.1 34.7042 2.57397 17667.4 34.7635 2.50636 17953.1 34.8175 2.44026 18243.5 34.8668 2.37565 18538.6 34.9118 2.31251 18838.4 34.9529 2.25083 19143.1 34.9905 2.19058 19452.7 35.0248 2.13174 19767.4 35.0562 2.07429 20087.1 35.0848 2.01820 20412.0 35.1109 1.96345 20742.1 35.1347 1.91003 21077.6 35.1563 1.85791 21418.5 35.1759 1.80706 21765.0 35.1937 1.75746 22117.0 35.2098 1.70909 22474.7 35.2243 1.66192 22838.2 35.2373 1.61594 23207.6 35.2489 1.57111 23583.0 35.2593 1.52742 23964.4 35.2684 1.48484 24352.0 35.2765 1.44335 24745.9 35.2835 1.40293 25146.2 35.2896 1.36355 25552.9 35.2947 1.32520 25966.2 35.2990 1.28784 26386.1 35.3026 1.25146 26812.9 35.3054 1.21604 27246.6 35.3075 1.18155 27687.3 35.3090 1.14797 28135.1 35.3100 1.11529 28590.2 35.3104 1.08348 29052.6 35.3105 1.05252 29522.5 35.3130 1.02239 30000.0 35.2999 0.993072 periodictable-1.5.0/periodictable/xsf/c.nff000066400000000000000000000327201310514471200206500ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.806885 10.1617 -9999. 0.851522 10.3261 -9999. 0.898628 10.4931 -9999. 0.948341 10.6628 -9999. 1.00080 10.8353 -9999. 1.05755 11.0106 -9999. 1.12167 11.1886 -9999. 1.18968 11.3696 -9999. 1.26181 11.5535 -9999. 1.33832 11.7404 -9999. 1.41946 11.9303 -9999. 1.50553 12.1232 -9999. 1.58971 12.3193 -9999. 1.67820 12.5186 -9999. 1.77161 12.7210 -9999. 1.87023 12.9268 -9999. 1.97433 13.1359 -9999. 2.08423 13.3483 -9999. 2.20025 13.5642 -9999. 2.29235 13.7836 -9999. 2.38287 14.0066 -9999. 2.47696 14.2331 -9999. 2.57477 14.4633 -9999. 2.67645 14.6973 -9999. 2.77114 14.9350 -9999. 2.84605 15.1765 -9999. 2.92298 15.4220 -9999. 3.00199 15.6714 -9999. 3.08313 15.9249 -9999. 3.16647 16.1825 -9999. 3.24213 16.4442 -9999. 3.28778 16.7102 -9999. 3.33408 16.9805 -9999. 3.38103 17.2551 -9999. 3.42863 17.5342 -9999. 3.47691 17.8178 -9999. 3.52041 18.1060 -9999. 3.54277 18.3989 -9999. 3.56528 18.6964 -9999. 3.58793 18.9988 -9999. 3.61072 19.3061 -9999. 3.63366 19.6184 -9999. 3.65674 19.9357 -9999. 3.67997 20.2582 -9999. 3.70335 20.5858 -9999. 3.69489 20.9188 -9999. 3.67204 21.2571 -9999. 3.64934 21.6009 -9999. 3.62677 21.9503 -9999. 3.60434 22.3053 -9999. 3.58205 22.6661 -9999. 3.55990 23.0327 -9999. 3.53320 23.4053 -9999. 3.47892 23.7838 -9999. 3.42547 24.1685 -9999. 3.37285 24.5594 -9999. 3.32103 24.9566 -9999. 3.27000 25.3603 -9999. 3.21977 25.7705 -9999. 3.17030 26.1873 -9999. 3.12096 26.6109 -9999. 3.06350 27.0413 -9999. 3.00708 27.4786 -9999. 2.95171 27.9231 -9999. 2.89736 28.3747 -9999. 2.84401 28.8337 -9999. 2.79164 29.3000 3.63318 2.74024 29.7739 3.67378 2.68978 30.2555 3.71270 2.63618 30.7449 3.74753 2.58360 31.2421 3.77973 2.53206 31.7475 3.80969 2.48155 32.2609 3.83764 2.43205 32.7827 3.86374 2.38354 33.3130 3.88807 2.33599 33.8518 3.91071 2.28940 34.3993 3.93156 2.24373 34.9557 3.95026 2.19898 35.5211 3.96709 2.15799 36.0956 3.98488 2.11827 36.6794 4.00253 2.07928 37.2727 4.01992 2.04101 37.8755 4.03712 2.00344 38.4882 4.05432 1.96657 39.1107 4.07360 1.93037 39.7432 4.09449 1.89011 40.3861 4.11010 1.84650 41.0393 4.12229 1.80390 41.7031 4.13211 1.76228 42.3776 4.13985 1.72163 43.0630 4.14559 1.68191 43.7595 4.14925 1.64310 44.4673 4.14955 1.60520 45.1865 4.14584 1.56917 45.9174 4.14175 1.54376 46.6600 4.14174 1.51876 47.4147 4.14300 1.49417 48.1816 4.14486 1.46998 48.9609 4.14698 1.44618 49.7528 4.14913 1.42276 50.5576 4.15113 1.39972 51.3753 4.15277 1.37705 52.2062 4.15371 1.35475 53.0506 4.15307 1.33282 53.9087 4.14960 1.31546 54.7806 4.14997 1.30168 55.6667 4.15270 1.28804 56.5670 4.15681 1.27454 57.4820 4.16209 1.26118 58.4117 4.16851 1.24797 59.3564 4.17625 1.23489 60.3165 4.18600 1.22195 61.2921 4.19949 1.20654 62.2834 4.21096 1.18498 63.2908 4.21910 1.16381 64.3145 4.22582 1.14301 65.3547 4.23161 1.12258 66.4118 4.23666 1.10252 67.4859 4.24111 1.08282 68.5775 4.24504 1.06347 69.6867 4.24852 1.04447 70.8138 4.25160 1.02580 71.9591 4.25430 1.00747 73.1230 4.25667 0.989470 74.3057 4.25872 0.971788 75.5076 4.26047 0.954423 76.7289 4.26194 0.937369 77.9699 4.26314 0.920617 79.2310 4.26408 0.904167 80.5125 4.26478 0.888009 81.8147 4.26524 0.872141 83.1380 4.26546 0.856556 84.4827 4.26547 0.841250 85.8491 4.26525 0.826217 87.2377 4.26481 0.811453 88.6487 4.26417 0.796952 90.0825 4.26332 0.782711 91.5395 4.26226 0.768724 93.0201 4.26100 0.754987 94.5246 4.25953 0.741496 96.0535 4.25787 0.728246 97.6071 4.25600 0.715232 99.1858 4.25393 0.702451 100.790 4.25166 0.689898 102.420 4.24919 0.677570 104.077 4.24651 0.665462 105.760 4.24363 0.653570 107.471 4.24054 0.641891 109.209 4.23724 0.630421 110.975 4.23373 0.619156 112.770 4.23000 0.608091 114.594 4.22606 0.597224 116.448 4.22189 0.586552 118.331 4.21751 0.576071 120.245 4.21289 0.565777 122.190 4.20806 0.555666 124.166 4.20299 0.545737 126.175 4.19772 0.535985 128.215 4.19225 0.526406 130.289 4.18666 0.517000 132.397 4.18122 0.507761 134.538 4.17533 0.497457 136.714 4.16860 0.487361 138.925 4.16122 0.477469 141.172 4.15329 0.467777 143.456 4.14484 0.458283 145.776 4.13587 0.448981 148.134 4.12638 0.439868 150.530 4.11636 0.430941 152.964 4.10578 0.422193 155.439 4.09464 0.413624 157.953 4.08290 0.405229 160.507 4.07054 0.397004 163.103 4.05754 0.388946 165.742 4.04385 0.381052 168.422 4.02945 0.373318 171.146 4.01429 0.365741 173.915 3.99834 0.358317 176.727 3.98158 0.351045 179.586 3.96398 0.343919 182.491 3.94558 0.336939 185.442 3.92716 0.330100 188.442 3.90705 0.320995 191.489 3.88443 0.312096 194.587 3.85977 0.303443 197.734 3.83308 0.295031 200.932 3.80428 0.286851 204.182 3.77323 0.278898 207.485 3.73972 0.271166 210.840 3.70351 0.263648 214.251 3.66428 0.256338 217.716 3.62164 0.249231 221.237 3.57499 0.242516 224.816 3.52435 0.236381 228.452 3.46902 0.230402 232.147 3.40812 0.224573 235.902 3.34061 0.218892 239.717 3.26522 0.213355 243.595 3.18027 0.207958 247.535 3.08474 0.202179 251.538 2.97293 0.194683 255.607 2.84002 0.187465 259.741 2.67985 0.180514 263.942 2.48138 0.173821 268.211 2.22505 0.167377 272.549 1.87159 0.161171 276.957 1.32192 0.155195 281.437 0.158573 0.149441 284.100 -4.04882 0.146163 284.300 -4.04031 4.18872 285.989 -0.283330 4.15857 290.615 1.43967 4.07798 295.315 2.20576 3.99896 300.092 2.71286 3.92146 304.945 3.09475 3.84546 309.878 3.40186 3.77095 314.890 3.65884 3.69787 319.983 3.87969 3.62620 325.158 4.07315 3.55593 330.418 4.24510 3.48703 335.762 4.39967 3.41945 341.192 4.53993 3.35318 346.711 4.66823 3.28820 352.319 4.78642 3.22448 358.017 4.89606 3.16200 363.808 4.99852 3.10072 369.692 5.09524 3.04063 375.672 5.18910 2.98170 381.748 5.27926 2.91649 387.922 5.36049 2.84817 394.197 5.43267 2.78144 400.573 5.49897 2.71628 407.052 5.56010 2.65264 413.635 5.61669 2.59050 420.326 5.66920 2.52981 427.124 5.71803 2.47054 434.032 5.76351 2.41266 441.052 5.80593 2.35614 448.186 5.84557 2.30094 455.435 5.88264 2.24703 462.802 5.91737 2.19439 470.287 5.94998 2.14298 477.894 5.98074 2.09278 485.623 6.01022 2.04367 493.478 6.03767 1.99418 501.459 6.06268 1.94589 509.570 6.08579 1.89876 517.812 6.10721 1.85278 526.187 6.12709 1.80791 534.698 6.14556 1.76412 543.346 6.16271 1.72140 552.134 6.17864 1.67971 561.065 6.19344 1.63903 570.139 6.20717 1.59933 579.361 6.21992 1.56060 588.732 6.23174 1.52281 598.254 6.24271 1.48593 607.930 6.25287 1.44994 617.763 6.26227 1.41483 627.755 6.27097 1.38056 637.908 6.27900 1.34713 648.226 6.28639 1.31450 658.711 6.29312 1.28267 669.365 6.29901 1.25160 680.191 6.30406 1.22249 691.193 6.30972 1.19523 702.372 6.31822 1.16897 713.733 6.32783 1.13958 725.277 6.33449 1.10844 737.008 6.33933 1.07816 748.928 6.34306 1.04871 761.042 6.34594 1.02006 773.351 6.34813 0.992182 785.859 6.34973 0.965046 798.570 6.35080 0.938635 811.486 6.35140 0.912939 824.611 6.35160 0.887954 837.949 6.35148 0.863661 851.502 6.35111 0.839923 865.274 6.35042 0.816714 879.269 6.34934 0.794041 893.491 6.34793 0.772006 907.943 6.34628 0.750584 922.628 6.34445 0.729761 937.551 6.34244 0.709358 952.715 6.34016 0.689500 968.124 6.33768 0.670177 983.783 6.33503 0.651378 999.695 6.33222 0.633116 1015.86 6.32930 0.615377 1032.29 6.32643 0.598194 1048.99 6.32362 0.581226 1065.96 6.32048 0.564459 1083.20 6.31710 0.548198 1100.72 6.31359 0.532391 1118.52 6.30996 0.517020 1136.61 6.30622 0.502116 1155. 6.30242 0.487640 1173.68 6.29857 0.473579 1192.66 6.29469 0.459933 1211.95 6.29081 0.446675 1231.55 6.28694 0.433794 1251.47 6.28313 0.421175 1271.72 6.27931 0.408804 1292.29 6.27534 0.396652 1313.19 6.27127 0.384872 1334.43 6.26716 0.373439 1356.01 6.26302 0.362342 1377.94 6.25886 0.351578 1400.23 6.25469 0.341132 1422.88 6.25054 0.330994 1445.89 6.24640 0.321159 1469.28 6.24230 0.311605 1493.04 6.23822 0.302316 1517.19 6.23418 0.293230 1541.73 6.23010 0.284407 1566.67 6.22604 0.275847 1592.01 6.22200 0.267545 1617.76 6.21798 0.259493 1643.92 6.21400 0.251684 1670.51 6.21005 0.244110 1697.53 6.20616 0.236764 1724.99 6.20233 0.229642 1752.89 6.19857 0.222665 1781.24 6.19480 0.215877 1810.05 6.19106 0.209279 1839.32 6.18734 0.202884 1869.07 6.18366 0.196685 1899.30 6.18003 0.190676 1930.02 6.17643 0.184850 1961.24 6.17288 0.179202 1992.96 6.16938 0.173726 2025.20 6.16594 0.168474 2057.95 6.16261 0.163292 2091.24 6.15928 0.158263 2125.06 6.15600 0.153384 2159.43 6.15276 0.148648 2194.36 6.14957 0.144053 2229.85 6.14643 0.139593 2265.92 6.14334 0.135267 2302.57 6.14028 0.131069 2339.81 6.13729 0.126998 2377.66 6.13433 0.123042 2416.11 6.13143 0.119210 2455.19 6.12857 0.115492 2494.90 6.12576 0.111882 2535.26 6.12300 0.108383 2576.26 6.12028 0.104990 2617.93 6.11762 0.101694 2660.27 6.11500 0.985042E-01 2703.30 6.11243 0.954028E-01 2747.03 6.10990 0.923971E-01 2791.46 6.10742 0.894832E-01 2836.61 6.10498 0.866617E-01 2882.49 6.10259 0.839148E-01 2929.11 6.10024 0.812599E-01 2976.48 6.09794 0.786821E-01 3024.63 6.09569 0.761825E-01 3073.55 6.09347 0.737584E-01 3123.26 6.09130 0.714080E-01 3173.78 6.08917 0.691288E-01 3225.11 6.08708 0.669194E-01 3277.27 6.08503 0.647767E-01 3330.28 6.08302 0.626991E-01 3384.15 6.08105 0.606853E-01 3438.88 6.07912 0.587327E-01 3494.50 6.07723 0.568396E-01 3551.02 6.07538 0.550042E-01 3608.46 6.07357 0.532244E-01 3666.82 6.07179 0.514997E-01 3726.13 6.07005 0.498278E-01 3786.40 6.06834 0.482071E-01 3847.64 6.06667 0.466352E-01 3909.87 6.06504 0.451127E-01 3973.11 6.06343 0.436367E-01 4037.38 6.06186 0.422212E-01 4102.68 6.06033 0.408351E-01 4169.03 6.05883 0.394919E-01 4236.46 6.05736 0.381921E-01 4304.98 6.05592 0.369324E-01 4374.62 6.05451 0.357130E-01 4445.37 6.05313 0.345329E-01 4517.27 6.05178 0.333896E-01 4590.33 6.05046 0.322825E-01 4664.58 6.04917 0.312100E-01 4740.03 6.04791 0.301723E-01 4816.69 6.04667 0.291678E-01 4894.60 6.04547 0.281953E-01 4973.77 6.04429 0.272539E-01 5054.21 6.04313 0.263428E-01 5135.96 6.04200 0.254606E-01 5219.03 6.04090 0.246074E-01 5303.44 6.03983 0.237810E-01 5389.22 6.03877 0.229809E-01 5476.39 6.03774 0.222063E-01 5564.97 6.03674 0.214569E-01 5654.98 6.03576 0.207329E-01 5746.44 6.03480 0.200314E-01 5839.39 6.03386 0.193522E-01 5933.83 6.03295 0.186948E-01 6029.81 6.03205 0.180595E-01 6127.33 6.03118 0.174453E-01 6226.44 6.03033 0.168501E-01 6327.15 6.02950 0.162746E-01 6429.48 6.02869 0.157180E-01 6533.48 6.02789 0.151795E-01 6639.15 6.02712 0.146587E-01 6746.54 6.02637 0.141549E-01 6855.65 6.02563 0.136678E-01 6966.54 6.02491 0.131966E-01 7079.22 6.02421 0.127407E-01 7193.72 6.02352 0.123000E-01 7310.07 6.02285 0.118738E-01 7428.31 6.02220 0.114619E-01 7548.45 6.02156 0.110634E-01 7670.54 6.02094 0.106782E-01 7794.61 6.02034 0.103059E-01 7920.68 6.01975 0.994583E-02 8048.79 6.01917 0.959775E-02 8178.98 6.01861 0.926134E-02 8311.26 6.01806 0.893624E-02 8445.69 6.01753 0.862190E-02 8582.29 6.01700 0.831820E-02 8721.11 6.01650 0.802475E-02 8862.16 6.01600 0.774104E-02 9005.50 6.01552 0.746686E-02 9151.16 6.01505 0.720204E-02 9299.17 6.01459 0.694614E-02 9449.58 6.01414 0.669902E-02 9602.42 6.01370 0.646026E-02 9757.73 6.01328 0.622938E-02 9915.55 6.01286 0.600659E-02 10075.9 6.01246 0.579136E-02 10238.9 6.01206 0.558350E-02 10404.5 6.01168 0.538276E-02 10572.8 6.01131 0.518891E-02 10743.8 6.01094 0.500173E-02 10917.6 6.01059 0.482101E-02 11094.2 6.01024 0.464654E-02 11273.6 6.00991 0.447810E-02 11455.9 6.00958 0.431552E-02 11641.2 6.00926 0.415859E-02 11829.5 6.00895 0.400712E-02 12020.8 6.00864 0.386096E-02 12215.3 6.00835 0.371991E-02 12412.8 6.00806 0.358382E-02 12613.6 6.00778 0.345251E-02 12817.6 6.00751 0.332584E-02 13025.0 6.00724 0.320365E-02 13235.6 6.00698 0.308580E-02 13449.7 6.00673 0.297213E-02 13667.2 6.00648 0.286252E-02 13888.3 6.00625 0.275683E-02 14112.9 6.00601 0.265492E-02 14341.2 6.00579 0.255668E-02 14573.1 6.00557 0.246198E-02 14808.9 6.00535 0.237071E-02 15048.4 6.00514 0.228275E-02 15291.8 6.00494 0.219799E-02 15539.1 6.00474 0.211632E-02 15790.4 6.00455 0.203764E-02 16045.8 6.00436 0.196186E-02 16305.4 6.00418 0.188887E-02 16569.1 6.00400 0.181858E-02 16837.1 6.00383 0.175089E-02 17109.4 6.00366 0.168574E-02 17386.1 6.00350 0.162301E-02 17667.4 6.00334 0.156265E-02 17953.1 6.00319 0.150455E-02 18243.5 6.00304 0.144866E-02 18538.6 6.00289 0.139489E-02 18838.4 6.00275 0.134317E-02 19143.1 6.00261 0.129343E-02 19452.7 6.00248 0.124561E-02 19767.4 6.00235 0.119964E-02 20087.1 6.00222 0.116295E-02 20412.0 6.00211 0.111818E-02 20742.1 6.00199 0.107519E-02 21077.6 6.00187 0.103391E-02 21418.5 6.00176 0.994268E-03 21765.0 6.00165 0.956195E-03 22117.0 6.00154 0.919629E-03 22474.7 6.00144 0.884508E-03 22838.2 6.00134 0.850771E-03 23207.6 6.00124 0.818364E-03 23583.0 6.00115 0.787230E-03 23964.4 6.00105 0.757320E-03 24352.0 6.00096 0.728582E-03 24745.9 6.00088 0.700971E-03 25146.2 6.00079 0.674438E-03 25552.9 6.00071 0.648942E-03 25966.2 6.00063 0.624439E-03 26386.1 6.00055 0.600890E-03 26812.9 6.00048 0.578257E-03 27246.6 6.00040 0.556501E-03 27687.3 6.00033 0.535590E-03 28135.1 6.00026 0.515487E-03 28590.2 6.00020 0.496161E-03 29052.6 6.00013 0.477581E-03 29522.5 6.00007 0.459716E-03 30000.0 6.00000 0.442540E-03 periodictable-1.5.0/periodictable/xsf/ca.nff000066400000000000000000000320051310514471200210050ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.428047E-01 10.1617 -9999. 0.452690E-01 10.3261 -9999. 0.478750E-01 10.4931 -9999. 0.506311E-01 10.6628 -9999. 0.535459E-01 10.8353 -9999. 0.566284E-01 11.0106 -9999. 0.598885E-01 11.1886 -9999. 0.633362E-01 11.3696 -9999. 0.663412E-01 11.5535 -9999. 0.692222E-01 11.7404 -9999. 0.722284E-01 11.9303 -9999. 0.753652E-01 12.1232 -9999. 0.786381E-01 12.3193 -9999. 0.812905E-01 12.5186 -9999. 0.837847E-01 12.7210 -9999. 0.863555E-01 12.9268 -9999. 0.890052E-01 13.1359 -9999. 0.915234E-01 13.3483 -9999. 0.937972E-01 13.5642 -9999. 0.961275E-01 13.7836 -9999. 0.985158E-01 14.0066 -9999. 0.100963 14.2331 -9999. 0.103551 14.4633 -9999. 0.106682 14.6973 -9999. 0.109908 14.9350 -9999. 0.113231 15.1765 -9999. 0.116655 15.4220 -9999. 0.120178 15.6714 -9999. 0.123377 15.9249 -9999. 0.126661 16.1825 -9999. 0.130033 16.4442 -9999. 0.133493 16.7102 -9999. 0.137047 16.9805 -9999. 0.140739 17.2551 -9999. 0.144546 17.5342 -9999. 0.148456 17.8178 -9999. 0.152472 18.1060 -9999. 0.156196 18.3989 -9999. 0.159707 18.6964 -9999. 0.163297 18.9988 -9999. 0.166967 19.3061 -9999. 0.170969 19.6184 -9999. 0.176222 19.9357 -9999. 0.181636 20.2582 -9999. 0.187217 20.5858 -9999. 0.192970 20.9188 -9999. 0.198638 21.2571 -9999. 0.204419 21.6009 -9999. 0.210369 21.9503 -9999. 0.216493 22.3053 -9999. 0.222794 22.6661 -9999. 0.229765 23.0327 -9999. 0.236992 23.4053 -9999. 0.244446 23.7838 -9999. 0.252134 24.1685 -9999. 0.260064 24.5594 -9999. 0.270130 24.9566 -9999. 0.281711 25.3603 -9999. 0.293788 25.7705 -9999. 0.306383 26.1873 -9999. 0.319519 26.6109 -9999. 0.331878 27.0413 -9999. 0.344558 27.4786 -9999. 0.370025 27.9231 -9999. 0.413990 28.3747 -9999. 0.482245 28.8337 -9999. 0.576340 29.3000 -9.81985 0.795476 29.7739 -13.0943 1.15137 30.2555 -19.4672 9.48002 30.7449 -16.1536 13.6832 31.2421 -13.2939 15.8974 31.7475 -10.9389 17.4478 32.2609 -9.11316 18.8180 32.7827 -7.05417 20.1634 33.3130 -5.09631 20.7429 33.8518 -3.39714 21.3391 34.3993 -1.71411 21.9524 34.9557 0.166864 22.3549 35.5211 1.86790 22.5540 36.0956 3.60786 22.7549 36.6794 5.61642 22.7044 37.2727 7.39788 22.3977 37.8755 9.20752 21.9303 38.4882 10.9363 21.3439 39.1107 12.9679 20.7272 39.7432 14.6370 18.8602 40.3861 15.5985 17.1613 41.0393 16.2190 15.6155 41.7031 16.6240 14.2089 42.3776 16.8847 12.9290 43.0630 17.0628 11.7644 43.7595 17.1584 10.5988 44.4673 17.1064 9.52074 45.1865 16.9704 8.55240 45.9174 16.7803 7.68253 46.6600 16.5539 6.90115 47.4147 16.3046 6.19922 48.1816 16.0429 5.56870 48.9609 15.7789 5.00232 49.7528 15.5360 4.49352 50.5576 15.3720 3.95561 51.3753 15.0786 3.38987 52.2062 14.7242 2.90505 53.0506 14.3556 2.48957 53.9087 13.9877 2.13310 54.7806 13.6194 1.81772 55.6667 13.2532 1.54896 56.5670 12.8928 1.31994 57.4820 12.5365 1.12478 58.4117 12.1858 0.979792 59.3564 11.8664 0.864375 60.3165 11.5595 0.762549 61.2921 11.2440 0.688384 62.2834 10.9612 0.651390 63.2908 10.6900 0.625921 64.3145 10.4391 0.622006 65.3547 10.2103 0.632067 66.4118 9.98744 0.646203 67.4859 9.78272 0.689684 68.5775 9.59673 0.736089 69.6867 9.42721 0.797350 70.8138 9.27910 0.865022 71.9591 9.15684 0.935019 73.1230 9.04395 0.992043 74.3057 8.93687 1.05255 75.5076 8.84042 1.11674 76.7289 8.76073 1.17782 77.9699 8.68187 1.23344 79.2310 8.60637 1.29168 80.5125 8.53698 1.35268 81.8147 8.47454 1.41655 83.1380 8.42135 1.48345 84.4827 8.38243 1.54587 85.8491 8.34265 1.60273 87.2377 8.30463 1.66167 88.6487 8.27133 1.72278 90.0825 8.24374 1.78614 91.5395 8.22330 1.85183 93.0201 8.21278 1.91994 94.5246 8.22206 1.98514 96.0535 8.22931 2.02511 97.6071 8.23148 2.06588 99.1858 8.23251 2.10748 100.790 8.23508 2.14991 102.420 8.24044 2.19320 104.077 8.25097 2.23736 105.760 8.26937 2.27478 107.471 8.28438 2.30697 109.209 8.29816 2.33960 110.975 8.31345 2.37270 112.770 8.33124 2.40627 114.594 8.35359 2.44032 116.448 8.38916 2.47286 118.331 8.42091 2.48265 120.245 8.44360 2.49246 122.190 8.46205 2.50232 124.166 8.47682 2.51222 126.175 8.48499 2.52570 128.215 8.49735 2.54638 130.289 8.51262 2.56723 132.397 8.52985 2.58825 134.538 8.54891 2.60945 136.714 8.56995 2.63081 138.925 8.59340 2.65235 141.172 8.61994 2.67407 143.456 8.65160 2.69597 145.776 8.69855 2.70908 148.134 8.73543 2.70734 150.530 8.76472 2.70561 152.964 8.79176 2.70387 155.439 8.81743 2.70214 157.953 8.84250 2.70041 160.507 8.86779 2.69868 163.103 8.89443 2.69695 165.742 8.92490 2.69523 168.422 8.96945 2.68714 171.146 9.00182 2.65286 173.915 9.02207 2.61901 176.727 9.03418 2.58560 179.586 9.04043 2.55261 182.491 9.04135 2.52004 185.442 9.03703 2.48860 188.442 9.02924 2.45854 191.489 9.01779 2.42885 194.587 9.00247 2.39951 197.734 8.98314 2.37052 200.932 8.95956 2.34189 204.182 8.93127 2.31360 207.485 8.89581 2.28566 210.840 8.85518 2.26502 214.251 8.81520 2.24761 217.716 8.77382 2.23033 221.237 8.72999 2.21318 224.816 8.68336 2.19616 228.452 8.63404 2.17928 232.147 8.58410 2.16253 235.902 8.52827 2.13639 239.717 8.46348 2.11017 243.595 8.39038 2.08427 247.535 8.30987 2.05869 251.538 8.22485 2.03343 255.607 8.13039 1.99907 259.741 8.01918 1.96241 263.942 7.89229 1.92642 268.211 7.74878 1.89110 272.549 7.58446 1.85642 276.957 7.40314 1.83340 281.437 7.20557 1.81133 285.989 6.98745 1.78953 290.615 6.74326 1.76799 295.315 6.46735 1.74670 300.092 6.15239 1.72565 304.945 5.78847 1.70485 309.878 5.36165 1.68430 314.890 4.85004 1.66427 319.983 4.22442 1.64761 325.158 3.43116 1.63111 330.418 2.36577 1.61477 335.762 0.788583 1.59860 341.192 -2.11054 1.58259 346.100 -18.3346 1.56848 346.300 -18.3167 14.7778 346.711 -11.4294 14.7630 352.319 -0.749394 14.5644 358.017 2.18437 14.3685 363.808 3.99194 14.1752 369.692 5.30882 13.9845 375.672 6.34355 13.7963 381.748 7.18918 13.6107 387.922 7.88686 13.4310 394.197 8.45186 13.2614 400.573 8.93036 13.2006 407.052 9.41020 13.1824 413.635 9.89672 13.1643 420.326 10.3730 13.1463 427.124 10.8436 13.1283 434.032 11.3148 13.1103 441.052 11.7985 13.0921 448.186 12.3388 13.0547 455.435 12.8690 12.9209 462.802 13.3660 12.7214 470.287 13.7886 12.4894 477.894 14.1630 12.2616 485.623 14.5041 12.0382 493.478 14.8192 11.8189 501.459 15.1124 11.6034 509.570 15.3869 11.3918 517.812 15.6464 11.1837 526.187 15.8915 10.9780 534.698 16.1236 10.7734 543.346 16.3426 10.5715 552.134 16.5539 10.3733 561.065 16.7552 10.1692 570.139 16.9376 9.96500 579.361 17.1080 9.76824 588.732 17.2695 9.57651 598.254 17.4232 9.38927 607.930 17.5705 9.20588 617.763 17.7120 9.02611 627.755 17.8530 8.84923 637.908 17.9895 8.66800 648.226 18.1185 8.47907 658.711 18.2318 8.28687 669.365 18.3214 8.09890 680.191 18.3985 7.93432 691.193 18.4838 7.78757 702.372 18.5811 7.64623 713.733 18.6864 7.48881 725.277 18.7798 7.32197 737.008 18.8601 7.15885 748.928 18.9342 6.99956 761.042 19.0043 6.84384 773.351 19.0708 6.69039 785.859 19.1339 6.53689 798.570 19.1905 6.38407 811.486 19.2408 6.23484 824.611 19.2865 6.08911 837.949 19.3280 5.94678 851.502 19.3658 5.80823 865.274 19.4004 5.67337 879.269 19.4324 5.54207 893.491 19.4622 5.41383 907.943 19.4897 5.28854 922.628 19.5152 5.16613 937.551 19.5387 5.04619 952.715 19.5602 4.92895 968.124 19.5800 4.81435 983.783 19.5985 4.70236 999.695 19.6156 4.59264 1015.86 19.6331 4.48513 1032.29 19.6485 4.37666 1048.99 19.6611 4.26994 1065.96 19.6710 4.16493 1083.20 19.6784 4.06252 1100.72 19.6839 3.96262 1118.52 19.6878 3.86515 1136.61 19.6902 3.77011 1155. 19.6912 3.67743 1173.68 19.6911 3.58707 1192.66 19.6899 3.49887 1211.95 19.6876 3.41282 1231.55 19.6844 3.32887 1251.47 19.6802 3.24704 1271.72 19.6753 3.16725 1292.29 19.6697 3.08942 1313.19 19.6635 3.01351 1334.43 19.6567 2.93946 1356.01 19.6495 2.86723 1377.94 19.6418 2.79677 1400.23 19.6338 2.72802 1422.88 19.6256 2.66095 1445.89 19.6176 2.59555 1469.28 19.6099 2.53114 1493.04 19.6036 2.46739 1517.19 19.5959 2.40126 1541.73 19.5853 2.33638 1566.67 19.5732 2.27327 1592.01 19.5599 2.21180 1617.76 19.5457 2.15203 1643.92 19.5307 2.09397 1670.51 19.5152 2.03740 1697.53 19.4991 1.98233 1724.99 19.4825 1.92870 1752.89 19.4654 1.87622 1781.24 19.4477 1.82508 1810.05 19.4294 1.77527 1839.32 19.4106 1.72680 1869.07 19.3913 1.67964 1899.30 19.3716 1.63377 1930.02 19.3514 1.58915 1961.24 19.3309 1.54576 1992.96 19.3098 1.50354 2025.20 19.2885 1.46286 2057.95 19.2670 1.42285 2091.24 19.2450 1.38393 2125.06 19.2226 1.34608 2159.43 19.1997 1.30926 2194.36 19.1764 1.27345 2229.85 19.1527 1.23863 2265.92 19.1285 1.20478 2302.57 19.1038 1.17188 2339.81 19.0786 1.13988 2377.66 19.0529 1.10878 2416.11 19.0266 1.07855 2455.19 18.9997 1.04917 2494.90 18.9721 1.02060 2535.26 18.9438 0.992854 2576.26 18.9148 0.965882 2617.93 18.8849 0.939678 2660.27 18.8540 0.914199 2703.30 18.8222 0.889467 2747.03 18.7892 0.865431 2791.46 18.7550 0.842065 2836.61 18.7194 0.819391 2882.49 18.6823 0.797340 2929.11 18.6435 0.775935 2976.48 18.6026 0.755129 3024.63 18.5596 0.734931 3073.55 18.5141 0.715317 3123.26 18.4657 0.696280 3173.78 18.4140 0.677776 3225.11 18.3585 0.659801 3277.27 18.2984 0.642368 3330.28 18.2330 0.625422 3384.15 18.1612 0.608977 3438.88 18.0817 0.593003 3494.50 17.9925 0.577487 3551.02 17.8914 0.562452 3608.46 17.7746 0.547825 3666.82 17.6369 0.533643 3726.13 17.4703 0.519879 3786.40 17.2609 0.506491 3847.64 16.9825 0.493516 3909.87 16.5760 0.480935 3973.11 15.8521 0.468705 4037.38 11.1907 0.456802 4038.40 8.35517 0.456616 4038.60 8.35607 4.14301 4102.68 16.0437 4.04411 4169.03 16.9411 3.94571 4236.46 17.4778 3.84925 4304.98 17.8639 3.75455 4374.62 18.1653 3.66168 4445.37 18.4118 3.57061 4517.27 18.6196 3.48133 4590.33 18.7983 3.39388 4664.58 18.9543 3.30818 4740.03 19.0920 3.22426 4816.69 19.2145 3.14211 4894.60 19.3243 3.06169 4973.77 19.4233 2.98298 5054.21 19.5127 2.90601 5135.96 19.5940 2.83071 5219.03 19.6680 2.75710 5303.44 19.7354 2.68509 5389.22 19.7971 2.61472 5476.39 19.8535 2.54597 5564.97 19.9052 2.47878 5654.98 19.9526 2.41316 5746.44 19.9961 2.34907 5839.39 20.0360 2.28651 5933.83 20.0726 2.22539 6029.81 20.1061 2.16573 6127.33 20.1369 2.10752 6226.44 20.1651 2.05070 6327.15 20.1908 1.99527 6429.48 20.2144 1.94124 6533.48 20.2360 1.88847 6639.15 20.2556 1.83703 6746.54 20.2734 1.78686 6855.65 20.2896 1.73794 6966.54 20.3042 1.69029 7079.22 20.3174 1.64379 7193.72 20.3293 1.59850 7310.07 20.3399 1.55433 7428.31 20.3494 1.51134 7548.45 20.3578 1.46942 7670.54 20.3651 1.42857 7794.61 20.3715 1.38881 7920.68 20.3771 1.35008 8048.79 20.3818 1.31232 8178.98 20.3857 1.27556 8311.26 20.3889 1.23981 8445.69 20.3915 1.20498 8582.29 20.3935 1.17103 8721.11 20.3948 1.13797 8862.16 20.3956 1.10581 9005.50 20.3959 1.07458 9151.16 20.3957 1.04409 9299.17 20.3951 1.01443 9449.58 20.3941 0.985622 9602.42 20.3927 0.957533 9757.73 20.3909 0.930181 9915.55 20.3888 0.903640 10075.9 20.3865 0.877781 10238.9 20.3839 0.852624 10404.5 20.3810 0.828151 10572.8 20.3778 0.804344 10743.8 20.3745 0.781188 10917.6 20.3709 0.758665 11094.2 20.3672 0.736760 11273.6 20.3633 0.715455 11455.9 20.3592 0.694737 11641.2 20.3551 0.674589 11829.5 20.3507 0.654996 12020.8 20.3463 0.635945 12215.3 20.3418 0.617421 12412.8 20.3372 0.599410 12613.6 20.3325 0.581898 12817.6 20.3278 0.564874 13025.0 20.3230 0.548322 13235.6 20.3181 0.532231 13449.7 20.3132 0.516589 13667.2 20.3083 0.501383 13888.3 20.3034 0.486602 14112.9 20.2984 0.472235 14341.2 20.2934 0.458269 14573.1 20.2884 0.444694 14808.9 20.2834 0.431501 15048.4 20.2784 0.418677 15291.8 20.2734 0.406214 15539.1 20.2684 0.394101 15790.4 20.2635 0.382329 16045.8 20.2585 0.370888 16305.4 20.2536 0.359769 16569.1 20.2487 0.348963 16837.1 20.2438 0.338462 17109.4 20.2390 0.328258 17386.1 20.2342 0.318341 17667.4 20.2294 0.308705 17953.1 20.2247 0.299340 18243.5 20.2200 0.290240 18538.6 20.2153 0.281398 18838.4 20.2107 0.272806 19143.1 20.2061 0.264456 19452.7 20.2016 0.256343 19767.4 20.1971 0.248460 20087.1 20.1926 0.240866 20412.0 20.1883 0.233426 20742.1 20.1840 0.226205 21077.6 20.1797 0.219196 21418.5 20.1754 0.212394 21765.0 20.1712 0.205792 22117.0 20.1671 0.199386 22474.7 20.1630 0.193171 22838.2 20.1590 0.187139 23207.6 20.1550 0.181288 23583.0 20.1511 0.175611 23964.4 20.1472 0.170104 24352.0 20.1434 0.164761 24745.9 20.1397 0.159580 25146.2 20.1360 0.154553 25552.9 20.1324 0.149679 25966.2 20.1288 0.144951 26386.1 20.1253 0.140366 26812.9 20.1218 0.135920 27246.6 20.1184 0.131609 27687.3 20.1150 0.127429 28135.1 20.1118 0.123376 28590.2 20.1085 0.119447 29052.6 20.1054 0.115638 29522.5 20.1026 0.111945 30000.0 20.0981 0.108365 periodictable-1.5.0/periodictable/xsf/cd.nff000066400000000000000000000316661310514471200210240ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.400039 10.1617 -9999. 0.418419 10.3261 -9999. 0.437644 10.4931 -9999. 0.457752 10.6628 -9999. 0.493615 10.8353 -9999. 0.536851 11.0106 -9999. 0.592578 11.1886 -9999. 0.663282 11.3696 -9999. 0.742420 11.5535 -9999. 0.861255 11.7404 -9999. 0.993746 11.9303 -9999. 1.04408 12.1232 -9999. 1.09696 12.3193 -9999. 1.15252 12.5186 -9999. 1.21090 12.7210 -9999. 1.27223 12.9268 -9999. 1.31700 13.1359 -9999. 1.35518 13.3483 -9999. 1.39447 13.5642 -9999. 1.43490 13.7836 -9999. 1.46675 14.0066 -9999. 1.49503 14.2331 -9999. 1.52386 14.4633 -9999. 1.55324 14.6973 -9999. 1.58319 14.9350 -9999. 1.61386 15.1765 -9999. 1.65189 15.4220 -9999. 1.69082 15.6714 -9999. 1.73068 15.9249 -9999. 1.77146 16.1825 -9999. 1.81322 16.4442 -9999. 1.85595 16.7102 -9999. 1.89969 16.9805 -9999. 1.94447 17.2551 -9999. 1.99030 17.5342 -9999. 2.03720 17.8178 -9999. 2.08522 18.1060 -9999. 2.13437 18.3989 -9999. 2.18467 18.6964 -9999. 2.23616 18.9988 -9999. 2.30335 19.3061 -9999. 2.38300 19.6184 -9999. 2.46541 19.9357 -9999. 2.55067 20.2582 -9999. 2.63888 20.5858 -9999. 2.73013 20.9188 -9999. 2.82455 21.2571 -9999. 2.93634 21.6009 -9999. 3.06457 21.9503 -9999. 3.19841 22.3053 -9999. 3.33808 22.6661 -9999. 3.48385 23.0327 -9999. 3.63599 23.4053 -9999. 3.79478 23.7838 -9999. 3.96050 24.1685 -9999. 4.10362 24.5594 -9999. 4.24965 24.9566 -9999. 4.40088 25.3603 -9999. 4.55749 25.7705 -9999. 4.71967 26.1873 -9999. 4.88762 26.6109 -9999. 5.06155 27.0413 -9999. 5.21645 27.4786 -9999. 5.37271 27.9231 -9999. 5.53366 28.3747 -9999. 5.69942 28.8337 -9999. 5.87016 29.3000 1.92132 6.04600 29.7739 1.95870 6.22712 30.2555 2.00347 6.41366 30.7449 2.05887 6.60579 31.2421 2.13188 6.80368 31.7475 2.22995 6.97608 32.2609 2.30955 7.13371 32.7827 2.38386 7.29491 33.3130 2.45750 7.45974 33.8518 2.53262 7.62830 34.3993 2.61077 7.80067 34.9557 2.69354 7.97693 35.5211 2.78329 8.15718 36.0956 2.88673 8.34150 36.6794 2.99810 8.50370 37.2727 3.10092 8.66572 37.8755 3.20155 8.83082 38.4882 3.30326 8.99907 39.1107 3.40710 9.17052 39.7432 3.51390 9.34524 40.3861 3.62436 9.52329 41.0393 3.73938 9.70474 41.7031 3.85954 9.88864 42.3776 3.98448 10.0757 43.0630 4.11523 10.2662 43.7595 4.25280 10.4604 44.4673 4.39831 10.6583 45.1865 4.55323 10.8599 45.9174 4.71968 11.0653 46.6600 4.90458 11.2746 47.4147 5.12536 11.4757 48.1816 5.33801 11.6323 48.9609 5.53753 11.7910 49.7528 5.73522 11.9518 50.5576 5.93432 12.1149 51.3753 6.13673 12.2802 52.2062 6.34396 12.4478 53.0506 6.55752 12.6176 53.9087 6.77962 12.7898 54.7806 7.01556 12.9599 55.6667 7.25391 13.1213 56.5670 7.49600 13.2847 57.4820 7.74478 13.4501 58.4117 8.00243 13.6176 59.3564 8.27088 13.7872 60.3165 8.55256 13.9589 61.2921 8.85083 14.1327 62.2834 9.17288 14.3087 63.2908 9.53797 14.4869 64.3145 9.95094 14.5893 65.3547 10.3170 14.6480 66.4118 10.6651 14.7069 67.4859 11.0074 14.7660 68.5775 11.3503 14.8254 69.6867 11.7005 14.8850 70.8138 12.0630 14.9281 71.9591 12.4157 14.9596 73.1230 12.7672 14.9911 74.3057 13.1222 15.0227 75.5076 13.4842 15.0544 76.7289 13.8580 15.0861 77.9699 14.2558 15.1179 79.2310 14.6616 15.1063 80.5125 15.0612 15.0932 81.8147 15.4642 15.0801 83.1380 15.8791 15.0671 84.4827 16.3126 15.0540 85.8491 16.7804 15.0410 87.2377 17.3388 14.9809 88.6487 17.8510 14.8342 90.0825 18.3398 14.6890 91.5395 18.8475 14.5451 93.0201 19.4316 14.4027 94.5246 20.0338 14.0815 96.0535 20.5494 13.7289 97.6071 21.0436 13.3852 99.1858 21.5688 13.0501 100.790 22.2626 12.6636 102.420 22.7938 11.8623 104.077 23.1195 11.1116 105.760 23.3209 10.4085 107.471 23.4530 9.74983 109.209 23.5384 9.13287 110.975 23.6002 8.55495 112.770 23.6927 8.01359 114.594 23.7887 7.33221 116.448 23.7072 6.62555 118.331 23.5298 5.98701 120.245 23.2935 5.40999 122.190 23.0109 4.88859 124.166 22.6816 4.41745 126.175 22.2585 4.05148 128.215 21.9290 3.82757 130.289 21.6526 3.61604 132.397 21.4053 3.41620 134.538 21.1833 3.22739 136.714 21.0226 3.04903 138.925 20.8329 2.74069 141.172 20.5504 2.45221 143.456 20.1828 2.22983 145.776 19.8503 2.09547 148.134 19.5098 1.97671 150.530 19.1967 1.93078 152.964 18.9087 1.88592 155.439 18.6126 1.85429 157.953 18.3385 1.85193 160.507 18.0729 1.84957 163.103 17.7711 1.87250 165.742 17.5124 1.96692 168.422 17.2849 2.07018 171.146 17.0891 2.18710 173.915 16.9210 2.31063 176.727 16.7910 2.44113 179.586 16.6867 2.53742 182.491 16.5750 2.62155 185.442 16.4641 2.70847 188.442 16.3579 2.79827 191.489 16.2576 2.89105 194.587 16.1642 2.98691 197.734 16.0787 3.08594 200.932 16.0030 3.18826 204.182 15.9445 3.29397 207.485 15.8913 3.37628 210.840 15.8354 3.45963 214.251 15.7794 3.54503 217.716 15.7269 3.63255 221.237 15.6790 3.72222 224.816 15.6375 3.81410 228.452 15.6054 3.90825 232.147 15.5936 4.00473 235.902 15.5913 4.06298 239.717 15.5744 4.11172 243.595 15.5467 4.16105 247.535 15.5156 4.21097 251.538 15.4826 4.26148 255.607 15.4491 4.31260 259.741 15.4169 4.36434 263.942 15.3884 4.41670 268.211 15.3902 4.45524 272.549 15.3677 4.45725 276.957 15.3205 4.45925 281.437 15.2616 4.46126 285.989 15.1920 4.46327 290.615 15.1123 4.46528 295.315 15.0227 4.46729 300.092 14.9234 4.46931 304.945 14.8146 4.47132 309.878 14.6990 4.47314 314.890 14.5684 4.46266 319.983 14.4194 4.45221 325.158 14.2517 4.44178 330.418 14.0649 4.43137 335.762 13.8570 4.42099 341.192 13.6247 4.41063 346.711 13.3650 4.40440 352.319 13.0786 4.40091 358.017 12.7606 4.39743 363.808 12.4025 4.39396 369.692 11.9930 4.39048 375.672 11.4980 4.39609 381.748 10.9667 4.47478 387.922 10.3913 4.55488 394.197 9.74172 4.63641 400.573 8.98721 4.71940 405.100 8.68686 4.77842 405.300 8.62236 4.32288 407.052 7.79045 4.52168 413.635 6.36909 5.34514 420.326 5.18791 6.31858 427.124 4.09315 7.46926 434.032 3.05345 8.82954 441.052 2.10524 10.4375 448.186 1.27547 12.3383 455.435 0.664412 14.5700 462.802 0.351553 17.1909 470.287 0.601950 20.2831 477.894 2.21338 23.6835 485.623 4.91570 26.0154 493.478 7.88153 26.9206 501.459 10.1460 27.0075 509.570 11.8344 27.0947 517.812 13.4846 27.1821 526.187 14.9340 26.8391 534.698 16.0908 26.4624 543.346 17.0042 26.0910 552.134 17.7134 25.7248 561.065 18.1179 25.5428 570.139 18.6004 25.6342 579.361 19.2047 25.7259 588.732 19.8241 25.8179 598.254 20.4560 25.9103 607.930 21.1062 26.0029 617.763 21.7794 26.0606 627.755 22.4329 26.0875 637.908 23.0654 26.1144 648.226 23.6940 26.1413 658.711 24.3233 26.1683 669.365 24.9584 26.1952 680.191 25.6242 26.2222 691.193 26.3133 26.2000 702.372 26.9713 26.1349 713.733 27.6117 26.0700 725.277 28.2499 26.0052 737.008 28.8935 25.9406 748.928 29.5995 25.8762 761.042 30.2999 25.7016 773.351 30.9503 25.5118 785.859 31.5858 25.3234 798.570 32.2274 25.1364 811.486 32.9195 24.9507 824.611 33.6579 24.6144 837.949 34.2929 24.1751 851.502 34.8168 23.7519 865.274 35.2937 23.3468 879.269 35.7447 22.9583 893.491 36.1738 22.5762 907.943 36.5842 22.2003 922.628 36.9847 21.8306 937.551 37.3674 21.4466 952.715 37.7296 21.0642 968.124 38.0705 20.6841 983.783 38.3970 20.3109 999.695 38.7153 19.9399 1015.86 39.0343 19.5709 1032.29 39.3302 19.1670 1048.99 39.5983 18.7666 1065.96 39.8394 18.3698 1083.20 40.0597 17.9813 1100.72 40.2627 17.6012 1118.52 40.4507 17.2292 1136.61 40.6249 16.8649 1155. 40.7866 16.5083 1173.68 40.9366 16.1592 1192.66 41.0758 15.8176 1211.95 41.2048 15.4831 1231.55 41.3242 15.1557 1251.47 41.4343 14.8357 1271.72 41.5360 14.5231 1292.29 41.6305 14.2179 1313.19 41.7180 13.9188 1334.43 41.7984 13.6260 1356.01 41.8720 13.3394 1377.94 41.9390 13.0589 1400.23 41.9995 12.7843 1422.88 42.0533 12.5155 1445.89 42.1000 12.2524 1469.28 42.1378 11.9969 1493.04 42.1666 11.7499 1517.19 42.1947 11.5219 1541.73 42.2253 11.3002 1566.67 42.2571 11.0828 1592.01 42.2882 10.8697 1617.76 42.3185 10.6606 1643.92 42.3476 10.4554 1670.51 42.3759 10.2544 1697.53 42.4036 10.0571 1724.99 42.4379 9.86351 1752.89 42.4701 9.66015 1781.24 42.4943 9.45640 1810.05 42.5113 9.25350 1839.32 42.5211 9.05474 1869.07 42.5262 8.86031 1899.30 42.5272 8.67031 1930.02 42.5247 8.48435 1961.24 42.5191 8.30235 1992.96 42.5084 8.12413 2025.20 42.5055 7.95651 2057.95 42.5010 7.77577 2091.24 42.4867 7.59693 2125.06 42.4672 7.42037 2159.43 42.4425 7.24551 2194.36 42.4127 7.07294 2229.85 42.3777 6.90212 2265.92 42.3374 6.73347 2302.57 42.2914 6.56637 2339.81 42.2393 6.40135 2377.66 42.1813 6.23853 2416.11 42.1168 6.07751 2455.19 42.0453 5.91851 2494.90 41.9667 5.76148 2535.26 41.8803 5.60617 2576.26 41.7852 5.45285 2617.93 41.6811 5.30151 2660.27 41.5670 5.15212 2703.30 41.4420 5.00438 2747.03 41.3048 4.85853 2791.46 41.1540 4.71465 2836.61 40.9880 4.57268 2882.49 40.8048 4.43238 2929.11 40.6017 4.29386 2976.48 40.3752 4.15725 3024.63 40.1214 4.02248 3073.55 39.8348 3.88941 3123.26 39.5076 3.75791 3173.78 39.1292 3.62831 3225.11 38.6842 3.50057 3277.27 38.1488 3.37448 3330.28 37.4821 3.24981 3384.15 36.6063 3.12696 3438.88 35.3409 3.00594 3494.50 33.0285 2.88655 3537.40 17.0228 2.79895 3537.60 17.0232 11.0389 3551.02 29.8592 10.9769 3608.46 33.8701 10.7176 3666.82 34.7193 10.4648 3726.13 30.6730 10.2180 3726.90 28.0714 10.2148 3727.10 28.0766 14.0187 3786.40 36.5710 13.6680 3847.64 37.9410 13.3205 3909.87 38.7346 12.9812 3973.11 39.2115 12.6508 4017.90 35.8107 12.4250 4018.10 35.8164 14.4626 4037.38 39.2057 14.3611 4102.68 40.7582 14.0258 4169.03 41.6577 13.6966 4236.46 42.3572 13.3730 4304.98 42.9426 13.0563 4374.62 43.4487 12.7442 4445.37 43.8935 12.4379 4517.27 44.2898 12.1378 4590.33 44.6459 11.8430 4664.58 44.9676 11.5539 4740.03 45.2595 11.2705 4816.69 45.5254 10.9927 4894.60 45.7682 10.7205 4973.77 45.9904 10.4537 5054.21 46.1939 10.1926 5135.96 46.3807 9.93705 5219.03 46.5522 9.68676 5303.44 46.7098 9.44205 5389.22 46.8545 9.20244 5476.39 46.9874 8.96818 5564.97 47.1097 8.73917 5654.98 47.2218 8.51506 5746.44 47.3246 8.29613 5839.39 47.4188 8.08211 5933.83 47.5049 7.87307 6029.81 47.5836 7.66898 6127.33 47.6555 7.46934 6226.44 47.7208 7.27449 6327.15 47.7800 7.08413 6429.48 47.8335 6.89861 6533.48 47.8819 6.71713 6639.15 47.9252 6.54022 6746.54 47.9640 6.36756 6855.65 47.9985 6.19912 6966.54 48.0288 6.03463 7079.22 48.0553 5.87430 7193.72 48.0783 5.71804 7310.07 48.0981 5.56564 7428.31 48.1148 5.41673 7548.45 48.1284 5.27177 7670.54 48.1392 5.13036 7794.61 48.1476 4.99278 7920.68 48.1536 4.85838 8048.79 48.1573 4.72739 8178.98 48.1589 4.59991 8311.26 48.1585 4.47548 8445.69 48.1561 4.35458 8582.29 48.1523 4.23661 8721.11 48.1468 4.12167 8862.16 48.1397 4.00959 9005.50 48.1310 3.90067 9151.16 48.1213 3.79455 9299.17 48.1104 3.69100 9449.58 48.0980 3.59015 9602.42 48.0847 3.49233 9757.73 48.0707 3.39687 9915.55 48.0555 3.30356 10075.9 48.0392 3.21306 10238.9 48.0222 3.12496 10404.5 48.0045 3.03921 10572.8 47.9861 2.95573 10743.8 47.9671 2.87448 10917.6 47.9474 2.79540 11094.2 47.9271 2.71844 11273.6 47.9063 2.64354 11455.9 47.8851 2.57066 11641.2 47.8633 2.49973 11829.5 47.8411 2.43072 12020.8 47.8185 2.36357 12215.3 47.7955 2.29823 12412.8 47.7721 2.23466 12613.6 47.7483 2.17281 12817.6 47.7242 2.11264 13025.0 47.6998 2.05410 13235.6 47.6751 1.99716 13449.7 47.6500 1.94176 13667.2 47.6247 1.88787 13888.3 47.5990 1.83545 14112.9 47.5731 1.78447 14341.2 47.5468 1.73487 14573.1 47.5202 1.68663 14808.9 47.4933 1.63971 15048.4 47.4661 1.59407 15291.8 47.4384 1.54968 15539.1 47.4105 1.50651 15790.4 47.3821 1.46452 16045.8 47.3533 1.42369 16305.4 47.3240 1.38397 16569.1 47.2942 1.34535 16837.1 47.2639 1.30778 17109.4 47.2330 1.27125 17386.1 47.2014 1.23572 17667.4 47.1691 1.20117 17953.1 47.1360 1.16757 18243.5 47.1020 1.13489 18538.6 47.0670 1.10311 18838.4 47.0308 1.07221 19143.1 46.9934 1.04216 19452.7 46.9546 1.01293 19767.4 46.9142 0.984506 20087.1 46.8720 0.956865 20412.0 46.8276 0.929983 20742.1 46.7808 0.903842 21077.6 46.7313 0.878419 21418.5 46.6784 0.853696 21765.0 46.6217 0.829651 22117.0 46.5604 0.806268 22474.7 46.4936 0.783528 22838.2 46.4200 0.761412 23207.6 46.3380 0.739903 23583.0 46.2453 0.718984 23964.4 46.1387 0.698640 24352.0 46.0133 0.678853 24745.9 45.8615 0.659610 25146.2 45.6697 0.640893 25552.9 45.4117 0.622689 25966.2 45.0240 0.604983 26386.1 44.2697 0.587761 26711.1 36.4239 0.574954 26711.3 36.4240 3.65393 26812.9 43.2295 3.63215 27246.6 44.9251 3.54155 27687.3 45.5586 3.45277 28135.1 45.9614 3.36578 28590.2 46.2575 3.28058 29052.6 46.4909 3.19715 29522.5 46.6827 3.11548 30000.0 46.8446 3.03556 periodictable-1.5.0/periodictable/xsf/ce.nff000066400000000000000000000316331310514471200210170ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.28369 10.1617 -9999. 1.26389 10.3261 -9999. 1.24441 10.4931 -9999. 1.22522 10.6628 -9999. 1.20632 10.8353 -9999. 1.18772 11.0106 -9999. 1.16941 11.1886 -9999. 1.15138 11.3696 -9999. 1.13362 11.5535 -9999. 1.11614 11.7404 -9999. 1.09893 11.9303 -9999. 1.08199 12.1232 -9999. 1.06530 12.3193 -9999. 1.04888 12.5186 -9999. 1.03270 12.7210 -9999. 1.01678 12.9268 -9999. 1.00676 13.1359 -9999. 1.00038 13.3483 -9999. 0.994040 13.5642 -9999. 0.987739 13.7836 -9999. 0.981479 14.0066 -9999. 0.956007 14.2331 -9999. 0.926295 14.4633 -9999. 0.897506 14.6973 -9999. 0.869612 14.9350 -9999. 0.847175 15.1765 -9999. 0.826038 15.4220 -9999. 0.805430 15.6714 -9999. 0.785336 15.9249 -9999. 0.768039 16.1825 -9999. 0.751660 16.4442 -9999. 0.743108 16.7102 -9999. 0.738426 16.9805 -9999. 0.733773 17.2551 -9999. 0.730488 17.5342 -9999. 0.732590 17.8178 -9999. 0.734698 18.1060 -9999. 0.738342 18.3989 -9999. 0.752939 18.6964 -9999. 0.767824 18.9988 -9999. 0.783004 19.3061 -9999. 0.802333 19.6184 -9999. 0.830937 19.9357 -9999. 0.860562 20.2582 -9999. 0.896253 20.5858 -9999. 0.947545 20.9188 -9999. 1.02453 21.2571 -9999. 1.16405 21.6009 -9999. 1.39197 21.9503 -9999. 1.74286 22.3053 -9999. 2.28855 22.6661 -9999. 4.30971 23.0327 -9999. 9.11122 23.4053 -9999. 14.5318 23.7838 -9999. 16.0458 24.1685 -9999. 16.5067 24.5594 -9999. 16.9807 24.9566 -9999. 17.2142 25.3603 -9999. 17.3637 25.7705 -9999. 17.3370 26.1873 -9999. 17.2087 26.6109 -9999. 17.0812 27.0413 -9999. 16.7834 27.4786 -9999. 16.3590 27.9231 -9999. 15.9484 28.3747 -9999. 15.6504 28.8337 -9999. 15.3579 29.3000 6.50335 14.8611 29.7739 7.10772 14.3580 30.2555 7.61895 13.8174 30.7449 8.02179 13.2928 31.2421 8.31620 12.8326 31.7475 8.63469 12.4573 32.2609 8.97915 12.0929 32.7827 9.38161 11.6884 33.3130 9.69364 11.1537 33.8518 9.91000 10.6435 34.3993 10.0639 10.1566 34.9557 10.1627 9.69192 35.5211 10.2173 9.28777 36.0956 10.2739 8.91349 36.6794 10.3212 8.55430 37.2727 10.3548 8.20959 37.8755 10.3763 7.88064 38.4882 10.3880 7.56485 39.1107 10.3923 7.26173 39.7432 10.3976 6.97075 40.3861 10.4049 6.65688 41.0393 10.3737 6.34253 41.7031 10.3210 6.04304 42.3776 10.2584 5.74055 43.0630 10.1567 5.44034 43.7595 10.0158 5.15583 44.4673 9.81063 4.92603 45.1865 9.64935 4.76665 45.9174 9.51254 4.61243 46.6600 9.38009 4.46320 47.4147 9.24814 4.32622 48.1816 9.12409 4.19684 48.9609 9.00556 4.07133 49.7528 8.89692 3.94432 50.5576 8.77542 3.79592 51.3753 8.63525 3.65311 52.2062 8.47691 3.51567 53.0506 8.28851 3.39671 53.9087 8.11200 3.32109 54.7806 7.94671 3.24716 55.6667 7.78404 3.17488 56.5670 7.61756 3.10420 57.4820 7.44291 3.04472 58.4117 7.27496 2.99326 59.3564 7.10899 2.94085 60.3165 6.93875 2.88830 61.2921 6.76334 2.83668 62.2834 6.58184 2.78599 63.2908 6.39292 2.73621 64.3145 6.19492 2.68731 65.3547 5.98497 2.63929 66.4118 5.75503 2.59902 67.4859 5.52492 2.57732 68.5775 5.29235 2.55580 69.6867 5.05292 2.53446 70.8138 4.80378 2.51330 71.9591 4.54302 2.49231 73.1230 4.26911 2.47150 74.3057 3.98183 2.44907 75.5076 3.67324 2.42325 76.7289 3.34083 2.39770 77.9699 2.98068 2.37242 79.2310 2.58111 2.34741 80.5125 2.15135 2.35757 81.8147 1.70930 2.37468 83.1380 1.24169 2.39192 84.4827 0.740091 2.40928 85.8491 0.196062 2.42677 87.2377 -0.403368 2.44439 88.6487 -1.07043 2.48602 90.0825 -1.78002 2.54704 91.5395 -2.55276 2.60955 93.0201 -3.40814 2.67360 94.5246 -4.36862 2.73922 96.0535 -5.46622 2.80645 97.6071 -6.76345 2.87533 99.1858 -8.30804 3.05961 100.790 -10.1154 3.30269 102.420 -12.6727 3.76703 104.077 -15.5564 4.90637 105.760 -15.5814 7.99694 107.471 -18.1102 6.24227 109.209 -22.3317 9.00118 110.975 -24.1257 11.5426 112.770 -28.6290 11.5388 114.594 -37.9832 13.7904 116.448 -49.6006 23.7825 118.331 -57.9189 43.3983 120.245 -53.9566 68.7867 122.190 -33.7369 93.1156 124.166 -9.00118 98.0932 126.175 12.2736 95.0335 128.215 29.4122 87.0895 130.289 39.1517 75.2961 132.397 43.9352 65.6724 134.538 46.9576 58.2625 136.714 49.4896 52.0451 138.925 52.2876 45.7895 141.172 53.2541 38.8770 143.456 53.1098 32.5996 145.776 51.4669 27.0090 148.134 49.3648 23.3210 150.530 47.7809 20.3879 152.964 46.2356 17.6445 155.439 44.5231 15.2704 157.953 42.7963 13.5541 160.507 41.4034 12.1804 163.103 40.2236 10.9459 165.742 39.0982 9.65548 168.422 37.9165 8.49304 171.146 36.5982 7.53994 173.915 35.4502 6.88520 176.727 34.4729 6.28735 179.586 33.5430 5.69091 182.491 32.6204 5.15087 185.442 31.7132 4.68219 188.442 30.7682 4.25721 191.489 29.8576 4.03762 194.587 29.0651 3.86686 197.734 28.3105 3.70334 200.932 27.5924 3.61478 204.182 26.8981 3.53602 207.485 26.2512 3.54711 210.840 25.6349 3.55900 214.251 25.0457 3.65161 217.716 24.5274 3.77563 221.237 24.0647 3.90386 224.816 23.6340 4.03644 228.452 23.2130 4.17353 232.147 22.8177 4.35787 235.902 22.4642 4.55720 239.717 22.1409 4.76566 243.595 21.8261 4.99190 247.535 21.5531 5.25598 251.538 21.3244 5.53405 255.607 21.1385 5.82681 259.741 20.9942 6.12237 263.942 20.8921 6.43040 268.211 20.8783 6.74348 272.549 20.8894 6.98933 276.957 20.9663 7.24415 281.437 21.0423 7.36660 285.989 21.0779 7.48640 290.615 21.1092 7.60815 295.315 21.1566 7.69196 300.092 21.1265 7.76522 304.945 21.1082 7.90299 309.878 21.1116 8.04320 314.890 21.1284 8.18591 319.983 21.1584 8.33114 325.158 21.2030 8.47894 330.418 21.2655 8.62938 335.762 21.3830 8.76771 341.192 21.4871 8.85153 346.711 21.5728 8.93616 352.319 21.6601 9.02160 358.017 21.7551 9.10785 363.808 21.8743 9.19492 369.692 22.0011 9.22717 375.672 22.1050 9.24453 381.748 22.1899 9.26192 387.922 22.2672 9.27934 394.197 22.3386 9.29679 400.573 22.4056 9.31428 407.052 22.4691 9.33179 413.635 22.5296 9.34934 420.326 22.5877 9.36788 427.124 22.6451 9.38702 434.032 22.7023 9.40618 441.052 22.7602 9.42539 448.186 22.8201 9.44464 455.435 22.8836 9.46393 462.802 22.9807 9.47220 470.287 23.0562 9.43558 477.894 23.1038 9.39909 485.623 23.1395 9.36275 493.478 23.1650 9.32654 501.459 23.1815 9.29048 509.570 23.1898 9.25455 517.812 23.1904 9.21877 526.187 23.1838 9.18312 534.698 23.1705 9.14762 543.346 23.1615 9.11163 552.134 23.1382 9.05222 561.065 23.0938 8.99318 570.139 23.0341 8.93453 579.361 22.9599 8.87626 588.732 22.8711 8.81838 598.254 22.7675 8.76087 607.930 22.6484 8.70373 617.763 22.5134 8.64697 627.755 22.3619 8.59058 637.908 22.1938 8.53456 648.226 22.0097 8.47890 658.711 21.8139 8.42361 669.365 21.6391 8.35664 680.191 21.3980 8.19468 691.193 21.0793 8.03585 702.372 20.6934 7.88010 713.733 20.2415 7.72738 725.277 19.7209 7.57761 737.008 19.1187 7.42369 748.928 18.4171 7.27026 761.042 17.5998 7.11999 773.351 16.6430 6.97282 785.859 15.5116 6.82871 798.570 14.1541 6.68756 811.486 12.4911 6.54934 824.611 10.3916 6.41397 837.949 7.61762 6.28140 851.502 3.66553 6.15157 865.274 -2.86705 6.02442 879.269 -20.2880 5.89991 883.700 -69.4070 5.86143 883.900 -69.3767 46.6439 893.491 -9.26426 46.0804 907.943 3.31586 45.2553 922.628 10.0534 44.4449 937.551 14.7446 43.6490 952.715 18.3661 42.8674 968.124 21.3225 42.0998 983.783 23.8217 41.3459 999.695 25.9859 40.6055 1015.86 27.8956 39.8784 1032.29 29.6384 39.1467 1048.99 31.0836 38.3723 1065.96 32.3957 37.7379 1083.20 33.6505 37.1140 1100.72 34.8152 36.5005 1118.52 35.9013 35.8970 1136.61 36.9177 35.3036 1155. 37.8726 34.7199 1173.68 38.7733 34.1459 1192.66 39.6264 33.5814 1211.95 40.4388 33.0262 1231.55 41.2175 32.4802 1251.47 41.9711 31.9433 1271.72 42.7116 31.4152 1292.29 43.3973 30.8958 1313.19 44.7145 30.3850 1334.43 44.9431 28.5651 1356.01 44.8518 28.2390 1377.94 45.1037 27.9164 1400.23 45.4502 27.5975 1422.88 45.8466 27.2824 1445.89 46.2903 26.9709 1469.28 46.7715 26.6401 1493.04 47.3242 26.2787 1517.19 47.8475 25.7796 1541.73 48.2809 25.2704 1566.67 48.6716 24.7714 1592.01 49.0318 24.2818 1617.76 49.3673 23.8020 1643.92 49.6827 23.3321 1670.51 49.9808 22.8710 1697.53 50.2645 22.4191 1724.99 50.5406 21.9761 1752.89 50.8036 21.5248 1781.24 51.0479 21.0769 1810.05 51.2715 20.6340 1839.32 51.4785 20.2003 1869.07 51.6713 19.7759 1899.30 51.8518 19.3605 1930.02 52.0210 18.9536 1961.24 52.1803 18.5552 1992.96 52.3270 18.1651 2025.20 52.4731 17.7917 2057.95 52.6139 17.4091 2091.24 52.7418 17.0331 2125.06 52.8594 16.6637 2159.43 52.9678 16.3004 2194.36 53.0677 15.9439 2229.85 53.1595 15.5937 2265.92 53.2435 15.2500 2302.57 53.3205 14.9130 2339.81 53.3899 14.5813 2377.66 53.4527 14.2569 2416.11 53.5094 13.9384 2455.19 53.5600 13.6259 2494.90 53.6042 13.3192 2535.26 53.6429 13.0191 2576.26 53.6764 12.7245 2617.93 53.7045 12.4357 2660.27 53.7275 12.1524 2703.30 53.7452 11.8746 2747.03 53.7583 11.6030 2791.46 53.7671 11.3365 2836.61 53.7709 11.0751 2882.49 53.7703 10.8196 2929.11 53.7658 10.5689 2976.48 53.7570 10.3233 3024.63 53.7440 10.0829 3073.55 53.7269 9.84732 3123.26 53.7060 9.61666 3173.78 53.6811 9.39077 3225.11 53.6523 9.16965 3277.27 53.6197 8.95317 3330.28 53.5833 8.74107 3384.15 53.5430 8.53343 3438.88 53.4987 8.33018 3494.50 53.4506 8.13124 3551.02 53.3985 7.93647 3608.46 53.3422 7.74576 3666.82 53.2818 7.55916 3726.13 53.2170 7.37646 3786.40 53.1476 7.19771 3847.64 53.0737 7.02272 3909.87 52.9947 6.85137 3973.11 52.9104 6.68377 4037.38 52.8207 6.51974 4102.68 52.7250 6.35914 4169.03 52.6227 6.20199 4236.46 52.5134 6.04830 4304.98 52.3966 5.89782 4374.62 52.2713 5.75045 4445.37 52.1364 5.60634 4517.27 51.9911 5.46530 4590.33 51.8338 5.32730 4664.58 51.6628 5.19224 4740.03 51.4761 5.06011 4816.69 51.2708 4.93075 4894.60 51.0434 4.80425 4973.77 50.7894 4.68043 5054.21 50.5022 4.55917 5135.96 50.1731 4.44062 5219.03 49.7890 4.32457 5303.44 49.3293 4.21090 5389.22 48.7590 4.09981 5476.39 48.0111 3.99101 5564.97 46.9260 3.88462 5654.98 44.9343 3.78047 5723.30 29.5430 3.70435 5723.50 29.5449 11.1538 5746.44 42.3851 11.0714 5839.39 46.1015 10.7472 5933.83 47.2177 10.4327 6029.81 47.5422 10.1274 6127.33 46.7219 9.83095 6164.10 40.0416 9.72267 6164.30 40.0430 13.3925 6226.44 47.8728 13.1669 6327.15 49.3360 12.8140 6429.48 50.0300 12.4702 6533.48 49.7640 12.1360 6548.70 47.3953 12.0882 6548.90 47.3980 13.6362 6639.15 51.2345 13.3773 6746.54 52.1353 13.0801 6855.65 52.8021 12.7868 6966.54 53.3514 12.4970 7079.22 53.8228 12.2113 7193.72 54.2364 11.9297 7310.07 54.6043 11.6524 7428.31 54.9346 11.3793 7548.45 55.2328 11.1106 7670.54 55.5036 10.8462 7794.61 55.7502 10.5863 7920.68 55.9755 10.3309 8048.79 56.1816 10.0801 8178.98 56.3706 9.83382 8311.26 56.5440 9.59208 8445.69 56.7032 9.35493 8582.29 56.8493 9.12244 8721.11 56.9836 8.89437 8862.16 57.1068 8.67092 9005.50 57.2199 8.45212 9151.16 57.3236 8.23760 9299.17 57.4185 8.02776 9449.58 57.5053 7.82223 9602.42 57.5847 7.62125 9757.73 57.6569 7.42436 9915.55 57.7225 7.23194 10075.9 57.7820 7.04378 10238.9 57.8357 6.85985 10404.5 57.8840 6.68007 10572.8 57.9273 6.50440 10743.8 57.9659 6.33278 10917.6 58.0001 6.16515 11094.2 58.0301 6.00146 11273.6 58.0562 5.84163 11455.9 58.0787 5.68562 11641.2 58.0977 5.53335 11829.5 58.1136 5.38476 12020.8 58.1265 5.23980 12215.3 58.1365 5.09838 12412.8 58.1439 4.96045 12613.6 58.1488 4.82594 12817.6 58.1514 4.69480 13025.0 58.1518 4.56694 13235.6 58.1501 4.44232 13449.7 58.1466 4.32086 13667.2 58.1413 4.20249 13888.3 58.1343 4.08717 14112.9 58.1258 3.97481 14341.2 58.1157 3.86536 14573.1 58.1044 3.75876 14808.9 58.0917 3.65494 15048.4 58.0779 3.55384 15291.8 58.0629 3.45541 15539.1 58.0469 3.35958 15790.4 58.0300 3.26629 16045.8 58.0121 3.17549 16305.4 57.9935 3.08711 16569.1 57.9740 3.00111 16837.1 57.9538 2.91742 17109.4 57.9329 2.83599 17386.1 57.9114 2.75676 17667.4 57.8893 2.67969 17953.1 57.8667 2.60472 18243.5 57.8435 2.53180 18538.6 57.8199 2.46088 18838.4 57.7958 2.39191 19143.1 57.7713 2.32484 19452.7 57.7464 2.25963 19767.4 57.7211 2.19622 20087.1 57.6955 2.13457 20412.0 57.6695 2.07464 20742.1 57.6432 2.01639 21077.6 57.6165 1.95976 21418.5 57.5896 1.90472 21765.0 57.5623 1.85122 22117.0 57.5347 1.79923 22474.7 57.5068 1.74871 22838.2 57.4785 1.69962 23207.6 57.4499 1.65191 23583.0 57.4210 1.60556 23964.4 57.3917 1.56053 24352.0 57.3621 1.51678 24745.9 57.3320 1.47428 25146.2 57.3014 1.43299 25552.9 57.2704 1.39289 25966.2 57.2388 1.35393 26386.1 57.2067 1.31609 26812.9 57.1739 1.27934 27246.6 57.1404 1.24365 27687.3 57.1061 1.20899 28135.1 57.0710 1.17533 28590.2 57.0349 1.14264 29052.6 56.9978 1.11090 29522.5 56.9624 1.08008 30000.0 56.9098 1.05015 periodictable-1.5.0/periodictable/xsf/cl.nff000066400000000000000000000317401310514471200210250ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.46938 10.1617 -9999. 1.69220 10.3261 -9999. 1.94880 10.4931 -9999. 2.24432 10.6628 -9999. 2.51303 10.8353 -9999. 2.73153 11.0106 -9999. 2.95549 11.1886 -9999. 3.19416 11.3696 -9999. 3.48881 11.5535 -9999. 3.87618 11.7404 -9999. 4.14416 11.9303 -9999. 4.41407 12.1232 -9999. 4.70156 12.3193 -9999. 4.91582 12.5186 -9999. 5.13087 12.7210 -9999. 5.35533 12.9268 -9999. 5.57204 13.1359 -9999. 5.78353 13.3483 -9999. 6.00304 13.5642 -9999. 6.22540 13.7836 -9999. 6.42563 14.0066 -9999. 6.63229 14.2331 -9999. 6.84561 14.4633 -9999. 7.06523 14.6973 -9999. 7.25268 14.9350 -9999. 7.44510 15.1765 -9999. 7.64264 15.4220 -9999. 7.82750 15.6714 -9999. 7.96238 15.9249 -9999. 8.09958 16.1825 -9999. 8.23914 16.4442 -9999. 8.37683 16.7102 -9999. 8.51461 16.9805 -9999. 8.65466 17.2551 -9999. 8.79701 17.5342 -9999. 8.94170 17.8178 -9999. 9.08877 18.1060 -9999. 9.23827 18.3989 -9999. 9.39023 18.6964 -9999. 9.54467 18.9988 -9999. 9.70167 19.3061 -9999. 9.86124 19.6184 -9999. 9.92421 19.9357 -9999. 9.89076 20.2582 -9999. 9.85742 20.5858 -9999. 9.82420 20.9188 -9999. 9.79108 21.2571 -9999. 9.75807 21.6009 -9999. 9.72518 21.9503 -9999. 9.69240 22.3053 -9999. 9.65973 22.6661 -9999. 9.62716 23.0327 -9999. 9.57623 23.4053 -9999. 9.33842 23.7838 -9999. 9.10653 24.1685 -9999. 8.88038 24.5594 -9999. 8.65986 24.9566 -9999. 8.44481 25.3603 -9999. 8.13178 25.7705 -9999. 7.76956 26.1873 -9999. 7.42345 26.6109 -9999. 7.09277 27.0413 -9999. 6.77682 27.4786 -9999. 6.47493 27.9231 -9999. 6.18650 28.3747 -9999. 5.91091 28.8337 -9999. 5.58156 29.3000 9.94411 5.20522 29.7739 9.99265 4.85425 30.2555 10.0178 4.52694 30.7449 10.0328 4.22171 31.2421 10.0544 3.93705 31.7475 10.1253 3.66007 32.2609 10.1438 3.22012 32.7827 10.0587 2.83305 33.3130 9.92498 2.49251 33.8518 9.76783 2.19290 34.3993 9.59654 1.92930 34.9557 9.41675 1.70061 35.5211 9.23839 1.50120 36.0956 9.06224 1.32517 36.6794 8.89042 1.16979 37.2727 8.72973 1.03262 37.8755 8.58277 0.882572 38.4882 8.40510 0.739600 39.1107 8.21396 0.619793 39.7432 8.01658 0.530227 40.3861 7.82891 0.460211 41.0393 7.63232 0.406707 41.7031 7.45700 0.403132 42.3776 7.30842 0.399590 43.0630 7.17379 0.394518 43.7595 7.04043 0.388766 44.4673 6.91370 0.403715 45.1865 6.80125 0.419899 45.9174 6.69754 0.436731 46.6600 6.59760 0.456765 47.4147 6.50635 0.482148 48.1816 6.42237 0.508941 48.9609 6.34452 0.537223 49.7528 6.27232 0.567077 50.5576 6.20586 0.598591 51.3753 6.14666 0.630882 52.2062 6.09073 0.659237 53.0506 6.03667 0.688866 53.9087 5.98520 0.719826 54.7806 5.93669 0.752177 55.6667 5.89126 0.785984 56.5670 5.84909 0.821309 57.4820 5.81041 0.858222 58.4117 5.77576 0.896794 59.3564 5.74638 0.937099 60.3165 5.72492 0.974146 61.2921 5.70206 1.00751 62.2834 5.68014 1.04202 63.2908 5.66026 1.07771 64.3145 5.64307 1.11463 65.3547 5.62920 1.15281 66.4118 5.61957 1.19229 67.4859 5.61600 1.23313 68.5775 5.62469 1.27537 69.6867 5.63561 1.29388 70.8138 5.64002 1.31261 71.9591 5.64157 1.33160 73.1230 5.64279 1.35088 74.3057 5.64451 1.37042 75.5076 5.64760 1.39026 76.7289 5.65370 1.41038 77.9699 5.66715 1.42454 79.2310 5.67395 1.43088 80.5125 5.67739 1.43726 81.8147 5.67907 1.44366 83.1380 5.67961 1.45009 84.4827 5.67939 1.45655 85.8491 5.67883 1.46304 87.2377 5.67884 1.46956 88.6487 5.67918 1.47311 90.0825 5.67685 1.47525 91.5395 5.67283 1.47739 93.0201 5.66756 1.47953 94.5246 5.66122 1.48168 96.0535 5.65393 1.48383 97.6071 5.64579 1.48598 99.1858 5.63692 1.48814 100.790 5.62752 1.49030 102.420 5.61796 1.49246 104.077 5.60976 1.49462 105.760 5.60269 1.49039 107.471 5.59010 1.48328 109.209 5.57321 1.47620 110.975 5.55340 1.46915 112.770 5.53084 1.46214 114.594 5.50558 1.45516 116.448 5.47760 1.44821 118.331 5.44686 1.44130 120.245 5.41327 1.43442 122.190 5.37671 1.42758 124.166 5.33706 1.42076 126.175 5.29416 1.41398 128.215 5.24787 1.40723 130.289 5.19815 1.40051 132.397 5.14586 1.39296 134.538 5.08787 1.38370 136.714 5.02406 1.37449 138.925 4.95459 1.36535 141.172 4.87907 1.35626 143.456 4.79704 1.34724 145.776 4.70792 1.33827 148.134 4.61105 1.32937 150.530 4.50569 1.32053 152.964 4.39108 1.31174 155.439 4.26771 1.30301 157.953 4.13122 1.28921 160.507 3.97786 1.27520 163.103 3.80660 1.26134 165.742 3.61506 1.24763 168.422 3.39989 1.23407 171.146 3.15662 1.22066 173.915 2.87929 1.20741 176.727 2.55971 1.19429 179.586 2.18624 1.18132 182.491 1.74165 1.16849 185.442 1.19875 1.15580 188.442 0.510952 1.14325 191.489 -0.412386 1.13083 194.587 -1.78902 1.11855 197.734 -4.44567 1.10640 199.900 -13.8452 1.09822 200.100 -13.8680 10.4682 200.932 -7.26444 10.5209 204.182 -2.86107 10.7273 207.485 -1.11739 10.9378 210.840 0.542504E-01 11.1524 214.251 1.01005 11.3712 217.716 1.91454 11.4950 221.237 2.65192 11.5179 224.816 3.26308 11.5409 228.452 3.80792 11.5639 232.147 4.30391 11.5868 235.902 4.76334 11.6099 239.717 5.19489 11.6330 243.595 5.60502 11.6563 247.535 5.99886 11.6795 251.538 6.38069 11.7027 255.607 6.75433 11.7260 259.741 7.12375 11.7494 263.942 7.49351 11.7728 268.211 7.86961 11.7962 272.549 8.27133 11.8197 276.957 8.71665 11.7925 281.437 9.12886 11.7015 285.989 9.50259 11.5712 290.615 9.83486 11.4367 295.315 10.1410 11.3038 300.092 10.4278 11.1726 304.945 10.6989 11.0428 309.878 10.9566 10.9145 314.890 11.2029 10.7877 319.983 11.4390 10.6624 325.158 11.6664 10.5385 330.418 11.8860 10.4162 335.762 12.0989 10.2952 341.192 12.3058 10.1756 346.711 12.5076 10.0574 352.319 12.7050 9.94051 358.017 12.8993 9.82514 363.808 13.0917 9.71102 369.692 13.2836 9.59816 375.672 13.4771 9.48652 381.748 13.6767 9.37632 387.922 13.9158 9.24352 394.197 14.1180 9.06027 400.573 14.2829 8.88851 407.052 14.4382 8.72306 413.635 14.5896 8.56070 420.326 14.7332 8.39399 427.124 14.8698 8.22747 434.032 14.9953 8.05822 441.052 15.1105 7.89234 448.186 15.2189 7.72948 455.435 15.3204 7.56838 462.802 15.4155 7.41007 470.287 15.5050 7.25479 477.894 15.5907 7.10271 485.623 15.6720 6.95011 493.478 15.7471 6.79940 501.459 15.8171 6.65193 509.570 15.8828 6.50656 517.812 15.9446 6.36357 526.187 16.0019 6.22270 534.698 16.0553 6.08451 543.346 16.1056 5.94889 552.134 16.1518 5.81481 561.065 16.1943 5.68384 570.139 16.2344 5.55569 579.361 16.2713 5.42920 588.732 16.3051 5.30562 598.254 16.3366 5.18474 607.930 16.3654 5.06583 617.763 16.3919 4.94954 627.755 16.4165 4.83576 637.908 16.4390 4.72373 648.226 16.4592 4.61412 658.711 16.4779 4.50688 669.365 16.4946 4.40115 680.191 16.5093 4.29780 691.193 16.5227 4.19667 702.372 16.5343 4.09694 713.733 16.5439 3.99951 725.277 16.5520 3.90435 737.008 16.5589 3.81139 748.928 16.5647 3.72021 761.042 16.5692 3.63085 773.351 16.5724 3.54315 785.859 16.5742 3.45748 798.570 16.5751 3.37378 811.486 16.5749 3.29172 824.611 16.5738 3.21132 837.949 16.5712 3.13255 851.502 16.5678 3.05628 865.274 16.5641 2.98154 879.269 16.5598 2.90833 893.491 16.5543 2.83610 907.943 16.5478 2.76591 922.628 16.5414 2.69771 937.551 16.5342 2.62978 952.715 16.5257 2.56347 968.124 16.5160 2.49876 983.783 16.5061 2.43663 999.695 16.4962 2.37544 1015.86 16.4853 2.31518 1032.29 16.4738 2.25657 1048.99 16.4618 2.19941 1065.96 16.4493 2.14367 1083.20 16.4365 2.08937 1100.72 16.4234 2.03624 1118.52 16.4098 1.98418 1136.61 16.3958 1.93325 1155. 16.3812 1.88364 1173.68 16.3662 1.83532 1192.66 16.3511 1.78817 1211.95 16.3357 1.74200 1231.55 16.3197 1.69670 1251.47 16.3032 1.65259 1271.72 16.2863 1.60964 1292.29 16.2692 1.56781 1313.19 16.2516 1.52683 1334.43 16.2336 1.48690 1356.01 16.2152 1.44802 1377.94 16.1964 1.41017 1400.23 16.1774 1.37324 1422.88 16.1578 1.33716 1445.89 16.1378 1.30207 1469.28 16.1173 1.26789 1493.04 16.0960 1.23458 1517.19 16.0743 1.20298 1541.73 16.0526 1.17234 1566.67 16.0307 1.14255 1592.01 16.0086 1.11352 1617.76 15.9862 1.08522 1643.92 15.9633 1.05765 1670.51 15.9401 1.03077 1697.53 15.9163 1.00458 1724.99 15.8922 0.979056 1752.89 15.8675 0.953791 1781.24 15.8420 0.929050 1810.05 15.8156 0.904856 1839.32 15.7883 0.881295 1869.07 15.7600 0.858348 1899.30 15.7307 0.836001 1930.02 15.7004 0.814232 1961.24 15.6688 0.793030 1992.96 15.6400 0.772376 2025.20 15.6045 0.742744 2057.95 15.5631 0.722827 2091.24 15.5215 0.703634 2125.06 15.4784 0.684894 2159.43 15.4329 0.666586 2194.36 15.3845 0.648702 2229.85 15.3326 0.631215 2265.92 15.2766 0.614141 2302.57 15.2157 0.597456 2339.81 15.1491 0.581146 2377.66 15.0756 0.565200 2416.11 14.9936 0.549622 2455.19 14.9010 0.534411 2494.90 14.7952 0.519541 2535.26 14.6719 0.505004 2576.26 14.5253 0.490797 2617.93 14.3455 0.476902 2660.27 14.1156 0.463341 2703.30 13.8020 0.450062 2747.03 13.3219 0.437092 2791.46 12.3484 0.424409 2822.30 5.68102 0.415937 2822.50 5.68236 4.11507 2836.61 11.5499 4.08546 2882.49 13.3286 3.99160 2929.11 14.0620 3.89901 2976.48 14.5387 3.80795 3024.63 14.8940 3.71842 3073.55 15.1772 3.63008 3123.26 15.4119 3.54327 3173.78 15.6117 3.45790 3225.11 15.7849 3.37405 3277.27 15.9371 3.29165 3330.28 16.0722 3.21065 3384.15 16.1930 3.13124 3438.88 16.3018 3.05337 3494.50 16.4002 2.97701 3551.02 16.4896 2.90215 3608.46 16.5711 2.82872 3666.82 16.6454 2.75678 3726.13 16.7135 2.68634 3786.40 16.7760 2.61735 3847.64 16.8333 2.54981 3909.87 16.8859 2.48372 3973.11 16.9343 2.41907 4037.38 16.9789 2.35580 4102.68 17.0199 2.29396 4169.03 17.0575 2.23348 4236.46 17.0922 2.17440 4304.98 17.1241 2.11664 4374.62 17.1534 2.06020 4445.37 17.1802 2.00508 4517.27 17.2048 1.95125 4590.33 17.2274 1.89871 4664.58 17.2481 1.84738 4740.03 17.2669 1.79729 4816.69 17.2840 1.74840 4894.60 17.2996 1.70074 4973.77 17.3137 1.65419 5054.21 17.3264 1.60881 5135.96 17.3378 1.56455 5219.03 17.3481 1.52142 5303.44 17.3572 1.47931 5389.22 17.3653 1.43831 5476.39 17.3724 1.39832 5564.97 17.3786 1.35936 5654.98 17.3839 1.32139 5746.44 17.3884 1.28442 5839.39 17.3922 1.24835 5933.83 17.3953 1.21326 6029.81 17.3977 1.17905 6127.33 17.3995 1.14578 6226.44 17.4007 1.11333 6327.15 17.4014 1.08177 6429.48 17.4016 1.05104 6533.48 17.4014 1.02114 6639.15 17.4007 0.991990 6746.54 17.3996 0.963658 6855.65 17.3981 0.936072 6966.54 17.3963 0.909242 7079.22 17.3942 0.883124 7193.72 17.3917 0.857693 7310.07 17.3890 0.832967 7428.31 17.3861 0.808936 7548.45 17.3829 0.785542 7670.54 17.3795 0.762805 7794.61 17.3759 0.740674 7920.68 17.3721 0.719133 8048.79 17.3682 0.698207 8178.98 17.3641 0.677863 8311.26 17.3598 0.658099 8445.69 17.3555 0.638867 8582.29 17.3510 0.620175 8721.11 17.3465 0.601998 8862.16 17.3419 0.584334 9005.50 17.3371 0.567166 9151.16 17.3324 0.550470 9299.17 17.3275 0.534254 9449.58 17.3226 0.518495 9602.42 17.3177 0.503175 9757.73 17.3128 0.488293 9915.55 17.3078 0.473831 10075.9 17.3028 0.459779 10238.9 17.2978 0.446128 10404.5 17.2928 0.432865 10572.8 17.2877 0.419979 10743.8 17.2827 0.407462 10917.6 17.2777 0.395303 11094.2 17.2727 0.383492 11273.6 17.2678 0.372020 11455.9 17.2628 0.360877 11641.2 17.2579 0.350055 11829.5 17.2530 0.339544 12020.8 17.2481 0.329336 12215.3 17.2433 0.319422 12412.8 17.2385 0.309795 12613.6 17.2338 0.300447 12817.6 17.2291 0.291369 13025.0 17.2244 0.282554 13235.6 17.2198 0.273995 13449.7 17.2152 0.265684 13667.2 17.2107 0.257615 13888.3 17.2062 0.249780 14112.9 17.2018 0.242174 14341.2 17.1975 0.234790 14573.1 17.1932 0.227620 14808.9 17.1889 0.220660 15048.4 17.1847 0.213904 15291.8 17.1806 0.207345 15539.1 17.1765 0.200977 15790.4 17.1724 0.194796 16045.8 17.1685 0.188797 16305.4 17.1646 0.182973 16569.1 17.1607 0.177320 16837.1 17.1569 0.171833 17109.4 17.1532 0.166507 17386.1 17.1495 0.161337 17667.4 17.1458 0.156320 17953.1 17.1423 0.151450 18243.5 17.1388 0.146723 18538.6 17.1353 0.142136 18838.4 17.1319 0.137683 19143.1 17.1286 0.133362 19452.7 17.1253 0.129168 19767.4 17.1221 0.125098 20087.1 17.1189 0.121156 20412.0 17.1157 0.117324 20742.1 17.1127 0.113609 21077.6 17.1097 0.110007 21418.5 17.1067 0.106515 21765.0 17.1038 0.103129 22117.0 17.1009 0.998466E-01 22474.7 17.0981 0.966649E-01 22838.2 17.0953 0.935805E-01 23207.6 17.0926 0.905909E-01 23583.0 17.0900 0.876930E-01 23964.4 17.0874 0.848845E-01 24352.0 17.0848 0.821624E-01 24745.9 17.0823 0.795244E-01 25146.2 17.0799 0.769679E-01 25552.9 17.0775 0.744905E-01 25966.2 17.0751 0.720900E-01 26386.1 17.0728 0.697638E-01 26812.9 17.0705 0.675100E-01 27246.6 17.0683 0.653262E-01 27687.3 17.0661 0.632106E-01 28135.1 17.0640 0.611608E-01 28590.2 17.0619 0.591751E-01 29052.6 17.0599 0.572516E-01 29522.5 17.0579 0.553882E-01 30000.0 17.0559 0.535833E-01 periodictable-1.5.0/periodictable/xsf/co.nff000066400000000000000000000314741310514471200210340ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.42071 10.1617 -9999. 1.45925 10.3261 -9999. 1.49884 10.4931 -9999. 1.53949 10.6628 -9999. 1.58125 10.8353 -9999. 1.62415 11.0106 -9999. 1.66820 11.1886 -9999. 1.71345 11.3696 -9999. 1.75993 11.5535 -9999. 1.80767 11.7404 -9999. 1.85671 11.9303 -9999. 1.90707 12.1232 -9999. 1.94682 12.3193 -9999. 1.98600 12.5186 -9999. 2.02596 12.7210 -9999. 2.06674 12.9268 -9999. 2.10833 13.1359 -9999. 2.15076 13.3483 -9999. 2.19404 13.5642 -9999. 2.23819 13.7836 -9999. 2.28323 14.0066 -9999. 2.32918 14.2331 -9999. 2.37605 14.4633 -9999. 2.42371 14.6973 -9999. 2.47199 14.9350 -9999. 2.52123 15.1765 -9999. 2.57146 15.4220 -9999. 2.62268 15.6714 -9999. 2.67492 15.9249 -9999. 2.72821 16.1825 -9999. 2.78255 16.4442 -9999. 2.83798 16.7102 -9999. 2.89452 16.9805 -9999. 2.95217 17.2551 -9999. 3.00203 17.5342 -9999. 3.04455 17.8178 -9999. 3.08768 18.1060 -9999. 3.13142 18.3989 -9999. 3.17578 18.6964 -9999. 3.22076 18.9988 -9999. 3.26639 19.3061 -9999. 3.31266 19.6184 -9999. 3.35958 19.9357 -9999. 3.40700 20.2582 -9999. 3.45166 20.5858 -9999. 3.49690 20.9188 -9999. 3.54274 21.2571 -9999. 3.58917 21.6009 -9999. 3.63622 21.9503 -9999. 3.68388 22.3053 -9999. 3.73217 22.6661 -9999. 3.78109 23.0327 -9999. 3.83065 23.4053 -9999. 3.88086 23.7838 -9999. 3.93173 24.1685 -9999. 3.98327 24.5594 -9999. 4.02721 24.9566 -9999. 4.06435 25.3603 -9999. 4.10183 25.7705 -9999. 4.13966 26.1873 -9999. 4.17784 26.6109 -9999. 4.21637 27.0413 -9999. 4.25526 27.4786 -9999. 4.29450 27.9231 -9999. 4.33411 28.3747 -9999. 4.36366 28.8337 -9999. 4.35857 29.3000 3.98251 4.35348 29.7739 4.05081 4.34840 30.2555 4.11438 4.34333 30.7449 4.17442 4.33826 31.2421 4.23178 4.33320 31.7475 4.28723 4.32814 32.2609 4.34162 4.32308 32.7827 4.39819 4.31804 33.3130 4.46159 4.30200 33.8518 4.51057 4.27710 34.3993 4.55107 4.25234 34.9557 4.58579 4.22773 35.5211 4.61516 4.20326 36.0956 4.63925 4.17893 36.6794 4.65765 4.15473 37.2727 4.66840 4.13069 37.8755 4.67446 4.11592 38.4882 4.68060 4.10181 39.1107 4.68468 4.08775 39.7432 4.68556 4.07374 40.3861 4.68276 4.05977 41.0393 4.67585 4.04586 41.7031 4.66434 4.03199 42.3776 4.64780 4.01853 43.0630 4.62611 4.00528 43.7595 4.59855 3.99206 44.4673 4.56440 3.97889 45.1865 4.52280 3.96576 45.9174 4.47271 3.95268 46.6600 4.41279 3.93968 47.4147 4.34177 3.92725 48.1816 4.25782 3.91487 48.9609 4.15820 3.90252 49.7528 4.03870 3.89021 50.5576 3.89204 3.87794 51.3753 3.71361 3.87930 52.2062 3.50455 3.88547 53.0506 3.23145 3.89869 53.9087 2.92456 3.99062 54.7806 2.57871 4.08473 55.6667 2.12007 4.21666 56.5670 1.50781 4.40344 57.4820 0.481044 5.04650 58.4117 -0.135500 6.26867 59.3564 -0.348010 7.78683 60.3165 0.174934 9.67273 61.2921 1.78564 10.6537 62.2834 3.05037 11.0491 63.2908 4.17887 10.9440 64.3145 4.94120 10.6950 65.3547 5.47262 10.4722 66.4118 5.92047 10.2757 67.4859 6.30138 10.0828 68.5775 6.62307 9.89349 69.6867 6.89114 9.70777 70.8138 7.09757 9.54202 71.9591 7.29107 9.40958 73.1230 7.46632 9.27899 74.3057 7.61756 9.15020 75.5076 7.73533 9.02321 76.7289 7.78707 8.89986 77.9699 7.84123 8.89839 79.2310 7.93430 8.89692 80.5125 8.04089 8.89545 81.8147 8.15364 8.89397 83.1380 8.26945 8.89251 84.4827 8.38656 8.89103 85.8491 8.50380 8.88957 87.2377 8.62013 8.88810 88.6487 8.73391 8.88663 90.0825 8.84008 8.88516 91.5395 8.94302 8.90185 93.0201 9.05732 8.92456 94.5246 9.17802 8.94731 96.0535 9.30336 8.97014 97.6071 9.43302 8.99301 99.1858 9.56727 9.01595 100.790 9.70715 9.03894 102.420 9.85558 9.06199 104.077 10.0244 9.07617 105.760 10.1821 9.05984 107.471 10.3289 9.04353 109.209 10.4696 9.02726 110.975 10.6070 9.01102 112.770 10.7419 8.99479 114.594 10.8751 8.97860 116.448 11.0068 8.96245 118.331 11.1375 8.94633 120.245 11.2674 8.93022 122.190 11.3967 8.91415 124.166 11.5256 8.89811 126.175 11.6533 8.88210 128.215 11.7689 8.87660 130.289 11.9243 8.88791 132.397 12.0791 8.85118 134.538 12.2209 8.81453 136.714 12.3553 8.77804 138.925 12.4862 8.74172 141.172 12.6147 8.70559 143.456 12.7416 8.66963 145.776 12.8674 8.63379 148.134 12.9926 8.59804 150.530 13.1175 8.56240 152.964 13.2430 8.52710 155.439 13.3705 8.49188 157.953 13.5036 8.45677 160.507 13.6377 8.40911 163.103 13.7723 8.35600 165.742 13.8973 8.29584 168.422 14.0167 8.23602 171.146 14.1323 8.17663 173.915 14.2453 8.11767 176.727 14.3562 8.05921 179.586 14.4657 8.00118 182.491 14.5745 7.94357 185.442 14.6835 7.88632 188.442 14.7947 7.82754 191.489 14.9086 7.76516 194.587 15.0162 7.69306 197.734 15.1183 7.62172 200.932 15.2170 7.55110 204.182 15.3136 7.48100 207.485 15.4098 7.41066 210.840 15.5060 7.33987 214.251 15.5988 7.26183 217.716 15.6864 7.18423 221.237 15.7700 7.10747 224.816 15.8510 7.03172 228.452 15.9300 6.95670 232.147 16.0073 6.88236 235.902 16.0840 6.80889 239.717 16.1614 6.73346 243.595 16.2354 6.65550 247.535 16.3059 6.57587 251.538 16.3725 6.49690 255.607 16.4364 6.41891 259.741 16.4982 6.34175 263.942 16.5584 6.26551 268.211 16.6191 6.19016 272.549 16.6779 6.11070 276.957 16.7327 6.03070 281.437 16.7839 5.95119 285.989 16.8323 5.87252 290.615 16.8782 5.79487 295.315 16.9227 5.71831 300.092 16.9655 5.64128 304.945 17.0068 5.56394 309.878 17.0446 5.48605 314.890 17.0793 5.40904 319.983 17.1115 5.33316 325.158 17.1425 5.25852 330.418 17.1715 5.18298 335.762 17.1982 5.10762 341.192 17.2218 5.03229 346.711 17.2424 4.95793 352.319 17.2606 4.88464 358.017 17.2774 4.81243 363.808 17.2919 4.73913 369.692 17.3031 4.66642 375.672 17.3113 4.59458 381.748 17.3170 4.52385 387.922 17.3207 4.45374 394.197 17.3215 4.38367 400.573 17.3194 4.31398 407.052 17.3140 4.24510 413.635 17.3059 4.17733 420.326 17.2949 4.10964 427.124 17.2809 4.04263 434.032 17.2631 3.97590 441.052 17.2417 3.91023 448.186 17.2172 3.84546 455.435 17.1889 3.78090 462.802 17.1565 3.71717 470.287 17.1200 3.65438 477.894 17.0800 3.59262 485.623 17.0355 3.53009 493.478 16.9852 3.46797 501.459 16.9291 3.40695 509.570 16.8673 3.34701 517.812 16.7990 3.28828 526.187 16.7243 3.23115 534.698 16.6431 3.17612 543.346 16.5558 3.12257 552.134 16.4622 3.06998 561.065 16.3607 3.01558 570.139 16.2478 2.96112 579.361 16.1236 2.90927 588.732 15.9881 2.85882 598.254 15.8401 2.80954 607.930 15.6779 2.76106 617.763 15.4994 2.71346 627.755 15.3028 2.66656 637.908 15.0847 2.61848 648.226 14.8396 2.56838 658.711 14.5596 2.51737 669.365 14.2376 2.46741 680.191 13.8651 2.42381 691.193 13.4352 2.38506 702.372 12.9326 2.34779 713.733 12.3259 2.30698 725.277 11.5647 2.26406 737.008 10.5677 2.22189 748.928 9.16323 2.18051 761.042 6.88403 2.13989 773.351 1.20092 2.10004 778.000 -16.6697 2.08534 778.200 -16.6574 16.7554 785.859 3.90051 16.5665 798.570 8.67726 16.2618 811.486 11.1424 15.9628 824.611 12.8290 15.6692 837.949 14.1115 15.3809 851.502 15.1447 15.0988 865.274 16.0019 14.7991 879.269 16.6975 14.4850 893.491 17.1236 14.1650 907.943 17.3570 14.1281 922.628 17.8034 14.3979 937.551 18.5118 14.6728 952.715 19.4683 14.6303 968.124 20.2571 14.2814 983.783 20.8180 13.9412 999.695 21.3022 13.6122 1015.86 21.7151 13.2943 1032.29 22.0920 13.0136 1048.99 22.4506 12.7340 1065.96 22.7802 12.4548 1083.20 23.0822 12.1819 1100.72 23.3617 11.9149 1118.52 23.6214 11.6539 1136.61 23.8631 11.3984 1155. 24.0885 11.1486 1173.68 24.2994 10.9043 1192.66 24.4972 10.6653 1211.95 24.6830 10.4315 1231.55 24.8598 10.2029 1251.47 25.0270 9.97641 1271.72 25.1851 9.75168 1292.29 25.3313 9.52808 1313.19 25.4657 9.30975 1334.43 25.5910 9.09640 1356.01 25.7080 8.88787 1377.94 25.8174 8.68415 1400.23 25.9200 8.48511 1422.88 26.0164 8.29065 1445.89 26.1075 8.10059 1469.28 26.1938 7.91422 1493.04 26.2768 7.73112 1517.19 26.3539 7.54775 1541.73 26.4236 7.36808 1566.67 26.4877 7.19261 1592.01 26.5469 7.02142 1617.76 26.6019 6.85430 1643.92 26.6530 6.69118 1670.51 26.7009 6.53201 1697.53 26.7462 6.37659 1724.99 26.7908 6.22480 1752.89 26.8324 6.07119 1781.24 26.8694 5.91959 1810.05 26.9010 5.77049 1839.32 26.9286 5.62517 1869.07 26.9528 5.48347 1899.30 26.9741 5.34528 1930.02 26.9926 5.21058 1961.24 27.0089 5.07932 1992.96 27.0223 4.95148 2025.20 27.0361 4.82906 2057.95 27.0488 4.70487 2091.24 27.0585 4.58352 2125.06 27.0657 4.46456 2159.43 27.0705 4.34837 2194.36 27.0737 4.23509 2229.85 27.0751 4.12425 2265.92 27.0748 4.01592 2302.57 27.0729 3.91018 2339.81 27.0695 3.80684 2377.66 27.0647 3.70609 2416.11 27.0586 3.60755 2455.19 27.0513 3.51169 2494.90 27.0429 3.41789 2535.26 27.0333 3.32645 2576.26 27.0227 3.23728 2617.93 27.0112 3.15031 2660.27 26.9987 3.06547 2703.30 26.9854 2.98278 2747.03 26.9713 2.90213 2791.46 26.9564 2.82354 2836.61 26.9409 2.74695 2882.49 26.9247 2.67229 2929.11 26.9078 2.59956 2976.48 26.8904 2.52868 3024.63 26.8724 2.45962 3073.55 26.8539 2.39238 3123.26 26.8349 2.32686 3173.78 26.8155 2.26306 3225.11 26.7956 2.20096 3277.27 26.7753 2.14049 3330.28 26.7546 2.08160 3384.15 26.7336 2.02426 3438.88 26.7122 1.96845 3494.50 26.6904 1.91417 3551.02 26.6684 1.86131 3608.46 26.6460 1.80987 3666.82 26.6233 1.75983 3726.13 26.6004 1.71112 3786.40 26.5771 1.66373 3847.64 26.5535 1.61763 3909.87 26.5297 1.57278 3973.11 26.5055 1.52914 4037.38 26.4810 1.48672 4102.68 26.4563 1.44546 4169.03 26.4312 1.40533 4236.46 26.4058 1.36631 4304.98 26.3800 1.32838 4374.62 26.3539 1.29145 4445.37 26.3273 1.25560 4517.27 26.3004 1.22069 4590.33 26.2730 1.18682 4664.58 26.2451 1.15383 4740.03 26.2166 1.12178 4816.69 26.1876 1.09064 4894.60 26.1580 1.06035 4973.77 26.1276 1.03091 5054.21 26.0965 1.00235 5135.96 26.0646 0.974532 5219.03 26.0317 0.947518 5303.44 25.9978 0.921275 5389.22 25.9627 0.895781 5476.39 25.9263 0.871002 5564.97 25.8884 0.846905 5654.98 25.8489 0.823513 5746.44 25.8075 0.800730 5839.39 25.7639 0.778663 5933.83 25.7179 0.757205 6029.81 25.6691 0.736352 6127.33 25.6170 0.716096 6226.44 25.5610 0.696420 6327.15 25.5005 0.677309 6429.48 25.4345 0.658738 6533.48 25.3619 0.640705 6639.15 25.2813 0.623185 6746.54 25.1905 0.606170 6855.65 25.0868 0.589643 6966.54 24.9658 0.573591 7079.22 24.8212 0.557998 7193.72 24.6425 0.542853 7310.07 24.4103 0.528143 7428.31 24.0838 0.513866 7548.45 23.5486 0.499994 7670.54 22.1136 0.486510 7708.80 15.8795 0.482403 7709. 15.8799 3.79398 7794.61 23.0649 3.73339 7920.68 24.0784 3.64708 8048.79 24.6213 3.56198 8178.98 24.9974 3.47810 8311.26 25.2857 3.39547 8445.69 25.5190 3.31428 8582.29 25.7143 3.23428 8721.11 25.8816 3.15569 8862.16 26.0272 3.07841 9005.50 26.1555 3.00255 9151.16 26.2696 2.92811 9299.17 26.3717 2.85496 9449.58 26.4637 2.78322 9602.42 26.5469 2.71287 9757.73 26.6223 2.64382 9915.55 26.6909 2.57631 10075.9 26.7536 2.51007 10238.9 26.8109 2.44521 10404.5 26.8633 2.38169 10572.8 26.9113 2.31952 10743.8 26.9553 2.25869 10917.6 26.9956 2.19918 11094.2 27.0326 2.14098 11273.6 27.0665 2.08407 11455.9 27.0976 2.02844 11641.2 27.1260 1.97408 11829.5 27.1520 1.92096 12020.8 27.1758 1.86907 12215.3 27.1975 1.81839 12412.8 27.2173 1.76891 12613.6 27.2353 1.72060 12817.6 27.2516 1.67345 13025.0 27.2664 1.62744 13235.6 27.2797 1.58255 13449.7 27.2916 1.53876 13667.2 27.3023 1.49604 13888.3 27.3118 1.45439 14112.9 27.3203 1.41378 14341.2 27.3276 1.37419 14573.1 27.3341 1.33560 14808.9 27.3396 1.29799 15048.4 27.3443 1.26134 15291.8 27.3482 1.22564 15539.1 27.3513 1.19085 15790.4 27.3538 1.15697 16045.8 27.3557 1.12398 16305.4 27.3569 1.09185 16569.1 27.3576 1.06056 16837.1 27.3578 1.03011 17109.4 27.3575 1.00046 17386.1 27.3568 0.971604 17667.4 27.3556 0.943521 17953.1 27.3541 0.916193 18243.5 27.3522 0.889602 18538.6 27.3500 0.863733 18838.4 27.3474 0.838566 19143.1 27.3446 0.814087 19452.7 27.3416 0.790277 19767.4 27.3382 0.767122 20087.1 27.3347 0.744605 20412.0 27.3310 0.722710 20742.1 27.3271 0.701422 21077.6 27.3230 0.680726 21418.5 27.3188 0.660608 21765.0 27.3144 0.641052 22117.0 27.3099 0.622045 22474.7 27.3053 0.603573 22838.2 27.3006 0.585621 23207.6 27.2958 0.568177 23583.0 27.2909 0.551227 23964.4 27.2860 0.534759 24352.0 27.2810 0.518759 24745.9 27.2760 0.503217 25146.2 27.2709 0.488119 25552.9 27.2658 0.473454 25966.2 27.2607 0.459210 26386.1 27.2555 0.445376 26812.9 27.2504 0.431942 27246.6 27.2452 0.418896 27687.3 27.2401 0.406228 28135.1 27.2349 0.393927 28590.2 27.2298 0.381985 29052.6 27.2248 0.370390 29522.5 27.2208 0.359134 30000.0 27.2113 0.348207 periodictable-1.5.0/periodictable/xsf/cr.nff000066400000000000000000000315141310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.05700 10.1617 -9999. 1.10362 10.3261 -9999. 1.15229 10.4931 -9999. 1.20311 10.6628 -9999. 1.25618 10.8353 -9999. 1.31158 11.0106 -9999. 1.36943 11.1886 -9999. 1.42916 11.3696 -9999. 1.48789 11.5535 -9999. 1.54903 11.7404 -9999. 1.61268 11.9303 -9999. 1.67895 12.1232 -9999. 1.74794 12.3193 -9999. 1.81977 12.5186 -9999. 1.89455 12.7210 -9999. 1.97240 12.9268 -9999. 2.05236 13.1359 -9999. 2.13557 13.3483 -9999. 2.22215 13.5642 -9999. 2.31224 13.7836 -9999. 2.40598 14.0066 -9999. 2.50733 14.2331 -9999. 2.62058 14.4633 -9999. 2.73896 14.6973 -9999. 2.86268 14.9350 -9999. 2.99199 15.1765 -9999. 3.08350 15.4220 -9999. 3.16751 15.6714 -9999. 3.25382 15.9249 -9999. 3.34248 16.1825 -9999. 3.43354 16.4442 -9999. 3.52710 16.7102 -9999. 3.59513 16.9805 -9999. 3.66139 17.2551 -9999. 3.72887 17.5342 -9999. 3.79760 17.8178 -9999. 3.86759 18.1060 -9999. 3.92324 18.3989 -9999. 3.95920 18.6964 -9999. 3.99549 18.9988 -9999. 4.03212 19.3061 -9999. 4.06908 19.6184 -9999. 4.09684 19.9357 -9999. 4.11996 20.2582 -9999. 4.14321 20.5858 -9999. 4.16660 20.9188 -9999. 4.19012 21.2571 -9999. 4.21377 21.6009 -9999. 4.22197 21.9503 -9999. 4.21016 22.3053 -9999. 4.19839 22.6661 -9999. 4.18665 23.0327 -9999. 4.17494 23.4053 -9999. 4.16326 23.7838 -9999. 4.09688 24.1685 -9999. 4.02779 24.5594 -9999. 3.95986 24.9566 -9999. 3.89307 25.3603 -9999. 3.82742 25.7705 -9999. 3.76287 26.1873 -9999. 3.69941 26.6109 -9999. 3.60958 27.0413 -9999. 3.49735 27.4786 -9999. 3.38860 27.9231 -9999. 3.28324 28.3747 -9999. 3.18115 28.8337 -9999. 3.08224 29.3000 5.94228 2.99004 29.7739 5.92909 2.90494 30.2555 5.91066 2.82226 30.7449 5.88584 2.74194 31.2421 5.85426 2.66391 31.7475 5.81498 2.58809 32.2609 5.76680 2.51723 32.7827 5.71465 2.45041 33.3130 5.65654 2.38537 33.8518 5.59119 2.32205 34.3993 5.51781 2.26041 34.9557 5.43535 2.19986 35.5211 5.34156 2.14059 36.0956 5.23454 2.08292 36.6794 5.11068 2.02681 37.2727 4.95964 1.97220 37.8755 4.78766 1.95578 38.4882 4.61222 1.94496 39.1107 4.41976 1.95116 39.7432 4.20694 1.96248 40.3861 3.97362 2.02151 41.0393 3.73477 2.08911 41.7031 3.45148 2.17520 42.3776 3.15242 2.32257 43.0630 2.79750 2.47993 43.7595 2.38498 2.84366 44.4673 2.08271 3.32968 45.1865 1.87212 3.89876 45.9174 1.78945 4.56510 46.6600 1.99022 5.31171 47.4147 2.28007 5.65963 48.1816 2.49180 6.03034 48.9609 2.71114 6.42532 49.7528 3.03331 6.79536 50.5576 3.33199 7.05016 51.3753 3.61502 7.31451 52.2062 3.92170 7.58878 53.0506 4.31249 7.82634 53.9087 4.66887 7.96298 54.7806 5.00459 8.10200 55.6667 5.34916 8.24346 56.5670 5.74622 8.38738 57.4820 6.19199 8.39766 58.4117 6.56095 8.36152 59.3564 6.89643 8.32554 60.3165 7.24600 8.28970 61.2921 7.57809 8.15699 62.2834 7.85549 8.02193 63.2908 8.09935 7.88911 64.3145 8.32623 7.75848 65.3547 8.55190 7.63002 66.4118 8.76200 7.45443 67.4859 8.92629 7.27327 68.5775 9.05755 7.09652 69.6867 9.15240 6.92522 70.8138 9.23368 6.79165 71.9591 9.31173 6.66065 73.1230 9.37710 6.53218 74.3057 9.41811 6.40618 75.5076 9.44981 6.32254 76.7289 9.49426 6.24629 77.9699 9.54040 6.17096 79.2310 9.58365 6.09654 80.5125 9.61905 6.02301 81.8147 9.63156 5.96361 83.1380 9.65991 5.92864 84.4827 9.69895 5.89387 85.8491 9.74104 5.85932 87.2377 9.78465 5.82496 88.6487 9.82892 5.79081 90.0825 9.87370 5.75585 91.5395 9.91600 5.71998 93.0201 9.95535 5.68432 94.5246 9.99094 5.64889 96.0535 10.0205 5.61369 97.6071 10.0356 5.57869 99.1858 10.0506 5.57753 100.790 10.0773 5.57754 102.420 10.1105 5.57756 104.077 10.1454 5.57757 105.760 10.1797 5.57758 107.471 10.2062 5.57760 109.209 10.2353 5.60496 110.975 10.2786 5.63469 112.770 10.3327 5.66458 114.594 10.3946 5.69462 116.448 10.4646 5.72483 118.331 10.5453 5.75519 120.245 10.6527 5.77467 122.190 10.7479 5.76624 124.166 10.8324 5.75783 126.175 10.9144 5.74942 128.215 10.9957 5.74103 130.289 11.0781 5.73265 132.397 11.1672 5.72428 134.538 11.2537 5.69934 136.714 11.3329 5.67447 138.925 11.4084 5.64972 141.172 11.4814 5.62507 143.456 11.5523 5.60052 145.776 11.6210 5.57609 148.134 11.6855 5.55414 150.530 11.7530 5.53664 152.964 11.8225 5.51919 155.439 11.8936 5.50180 157.953 11.9667 5.48446 160.507 12.0425 5.46718 163.103 12.1227 5.44995 165.742 12.2154 5.43278 168.422 12.3185 5.38959 171.146 12.4014 5.32982 173.915 12.4721 5.27070 176.727 12.5352 5.21224 179.586 12.5919 5.15443 182.491 12.6427 5.09727 185.442 12.6869 5.04073 188.442 12.7182 4.98483 191.489 12.7453 4.94959 194.587 12.7813 4.92015 197.734 12.8212 4.89088 200.932 12.8632 4.86178 204.182 12.9066 4.83286 207.485 12.9513 4.80412 210.840 12.9977 4.77554 214.251 13.0468 4.74713 217.716 13.1045 4.71436 221.237 13.1547 4.66923 224.816 13.1992 4.62453 228.452 13.2403 4.58026 232.147 13.2787 4.53640 235.902 13.3151 4.49297 239.717 13.3497 4.44996 243.595 13.3826 4.40736 247.535 13.4142 4.36517 251.538 13.4455 4.32337 255.607 13.4751 4.27973 259.741 13.5024 4.23643 263.942 13.5281 4.19356 268.211 13.5526 4.15114 272.549 13.5762 4.10913 276.957 13.5998 4.06757 281.437 13.6254 4.02641 285.989 13.6546 3.97627 290.615 13.6753 3.91967 295.315 13.6883 3.86388 300.092 13.6971 3.80888 304.945 13.7024 3.75467 309.878 13.7052 3.70108 314.890 13.7041 3.64593 319.983 13.6990 3.59160 325.158 13.6904 3.53808 330.418 13.6788 3.48536 335.762 13.6649 3.43342 341.192 13.6502 3.38225 346.711 13.6403 3.32358 352.319 13.6177 3.25457 358.017 13.5822 3.18699 363.808 13.5385 3.12082 369.692 13.4868 3.05602 375.672 13.4271 2.99257 381.748 13.3567 2.93128 387.922 13.2802 2.87576 394.197 13.1979 2.82130 400.573 13.1076 2.76786 407.052 13.0080 2.71544 413.635 12.8961 2.66401 420.326 12.7722 2.62216 427.124 12.6426 2.58535 434.032 12.5059 2.54906 441.052 12.3581 2.51328 448.186 12.1973 2.47800 455.435 12.0211 2.44321 462.802 11.8276 2.40891 470.287 11.6128 2.37331 477.894 11.3718 2.33783 485.623 11.0998 2.30288 493.478 10.7910 2.26845 501.459 10.4372 2.23369 509.570 10.0234 2.19700 517.812 9.53189 2.16092 526.187 8.93605 2.12543 534.698 8.19279 2.09052 543.346 7.22049 2.05073 552.134 5.84898 2.00951 561.065 3.63220 1.96911 570.139 -1.71588 1.92952 574.000 -19.0823 1.91311 574.200 -19.0554 16.9731 579.361 0.236457 16.6980 588.732 5.44090 16.2158 598.254 8.01928 15.7475 607.930 9.72452 15.2927 617.763 10.9633 14.8511 627.755 11.8856 14.4222 637.908 12.5022 14.0840 648.226 13.0405 13.8947 658.711 13.5209 13.7079 669.365 13.8513 13.6002 680.191 14.2408 13.6681 691.193 14.6876 13.7363 702.372 15.1652 13.8049 713.733 15.6739 13.8739 725.277 16.2705 13.9432 737.008 16.9638 13.8818 748.928 17.5409 13.6463 761.042 18.0269 13.4147 773.351 18.4647 13.1871 785.859 18.8693 12.9633 798.570 19.2504 12.7434 811.486 19.6154 12.5271 824.611 19.9809 12.3146 837.949 20.3728 12.0750 851.502 20.7046 11.7601 865.274 20.9807 11.4535 879.269 21.2197 11.1548 893.491 21.4210 10.8640 907.943 21.5985 10.6084 922.628 21.7721 10.3697 937.551 21.9447 10.1364 952.715 22.1159 9.90832 968.124 22.2784 9.66533 983.783 22.4209 9.42121 999.695 22.5383 9.18323 1015.86 22.6403 8.96464 1032.29 22.7442 8.76097 1048.99 22.8470 8.55910 1065.96 22.9426 8.35889 1083.20 23.0314 8.16331 1100.72 23.1142 7.97230 1118.52 23.1916 7.78577 1136.61 23.2639 7.60367 1155. 23.3314 7.42578 1173.68 23.3946 7.25203 1192.66 23.4538 7.08232 1211.95 23.5092 6.91659 1231.55 23.5617 6.75476 1251.47 23.6115 6.59544 1271.72 23.6583 6.43840 1292.29 23.7003 6.28328 1313.19 23.7383 6.13203 1334.43 23.7731 5.98442 1356.01 23.8049 5.84031 1377.94 23.8341 5.69960 1400.23 23.8609 5.56231 1422.88 23.8859 5.42842 1445.89 23.9094 5.29766 1469.28 23.9323 5.16918 1493.04 23.9549 5.04252 1517.19 23.9742 4.91365 1541.73 23.9892 4.78734 1566.67 24.0007 4.66424 1592.01 24.0097 4.54428 1617.76 24.0164 4.42741 1643.92 24.0213 4.31358 1670.51 24.0246 4.20273 1697.53 24.0266 4.09471 1724.99 24.0284 3.98944 1752.89 24.0289 3.88464 1781.24 24.0271 3.78189 1810.05 24.0233 3.68136 1839.32 24.0177 3.58346 1869.07 24.0108 3.48813 1899.30 24.0025 3.39529 1930.02 23.9931 3.30503 1961.24 23.9828 3.21715 1992.96 23.9712 3.13149 2025.20 23.9602 3.04953 2057.95 23.9489 2.96747 2091.24 23.9360 2.88736 2125.06 23.9221 2.80927 2159.43 23.9075 2.73328 2194.36 23.8922 2.65900 2229.85 23.8761 2.58670 2265.92 23.8594 2.51626 2302.57 23.8422 2.44764 2339.81 23.8244 2.38074 2377.66 23.8061 2.31562 2416.11 23.7873 2.25217 2455.19 23.7680 2.19040 2494.90 23.7484 2.13022 2535.26 23.7283 2.07164 2576.26 23.7078 2.01462 2617.93 23.6870 1.95910 2660.27 23.6658 1.90508 2703.30 23.6443 1.85248 2747.03 23.6225 1.80129 2791.46 23.6003 1.75148 2836.61 23.5779 1.70302 2882.49 23.5551 1.65585 2929.11 23.5321 1.60998 2976.48 23.5087 1.56538 3024.63 23.4851 1.52199 3073.55 23.4612 1.47977 3123.26 23.4370 1.43872 3173.78 23.4125 1.39879 3225.11 23.3876 1.35997 3277.27 23.3625 1.32222 3330.28 23.3369 1.28553 3384.15 23.3110 1.24984 3438.88 23.2848 1.21514 3494.50 23.2580 1.18141 3551.02 23.2309 1.14865 3608.46 23.2032 1.11679 3666.82 23.1750 1.08584 3726.13 23.1462 1.05572 3786.40 23.1168 1.02652 3847.64 23.0868 0.998083 3909.87 23.0559 0.970477 3973.11 23.0242 0.943626 4037.38 22.9916 0.917573 4102.68 22.9579 0.892240 4169.03 22.9230 0.867643 4236.46 22.8869 0.843758 4304.98 22.8493 0.820552 4374.62 22.8101 0.797991 4445.37 22.7690 0.776062 4517.27 22.7258 0.754774 4590.33 22.6802 0.734148 4664.58 22.6318 0.714069 4740.03 22.5801 0.694568 4816.69 22.5247 0.675635 4894.60 22.4649 0.657233 4973.77 22.3997 0.639384 5054.21 22.3282 0.622042 5135.96 22.2489 0.605222 5219.03 22.1598 0.588872 5303.44 22.0584 0.573005 5389.22 21.9407 0.557598 5476.39 21.8010 0.542637 5564.97 21.6299 0.528113 5654.98 21.4109 0.514006 5746.44 21.1106 0.500319 5839.39 20.6438 0.487031 5933.83 19.6430 0.474127 5989.10 12.9181 0.466827 5989.30 12.9188 3.84485 6029.81 19.4157 3.80769 6127.33 20.8006 3.72069 6226.44 21.4313 3.63494 6327.15 21.8497 3.55039 6429.48 22.1641 3.46704 6533.48 22.4157 3.38494 6639.15 22.6249 3.30411 6746.54 22.8033 3.22458 6855.65 22.9580 3.14646 6966.54 23.0941 3.06960 7079.22 23.2149 2.99403 7193.72 23.3229 2.91988 7310.07 23.4201 2.84713 7428.31 23.5080 2.77573 7548.45 23.5878 2.70561 7670.54 23.6604 2.63695 7794.61 23.7267 2.56957 7920.68 23.7872 2.50359 8048.79 23.8426 2.43897 8178.98 23.8935 2.37572 8311.26 23.9401 2.31377 8445.69 23.9829 2.25320 8582.29 24.0222 2.19383 8721.11 24.0582 2.13579 8862.16 24.0913 2.07909 9005.50 24.1217 2.02361 9151.16 24.1495 1.96941 9299.17 24.1750 1.91639 9449.58 24.1982 1.86463 9602.42 24.2194 1.81416 9757.73 24.2388 1.76483 9915.55 24.2564 1.71658 10075.9 24.2724 1.66954 10238.9 24.2868 1.62365 10404.5 24.2999 1.57886 10572.8 24.3116 1.53517 10743.8 24.3220 1.49256 10917.6 24.3313 1.45100 11094.2 24.3396 1.41047 11273.6 24.3468 1.37097 11455.9 24.3530 1.33246 11641.2 24.3584 1.29493 11829.5 24.3630 1.25835 12020.8 24.3668 1.22272 12215.3 24.3698 1.18800 12412.8 24.3722 1.15419 12613.6 24.3740 1.12126 12817.6 24.3751 1.08919 13025.0 24.3758 1.05796 13235.6 24.3759 1.02756 13449.7 24.3755 0.997965 13667.2 24.3748 0.969160 13888.3 24.3735 0.941126 14112.9 24.3720 0.913845 14341.2 24.3700 0.887300 14573.1 24.3678 0.861474 14808.9 24.3652 0.836350 15048.4 24.3623 0.811911 15291.8 24.3592 0.788142 15539.1 24.3559 0.765025 15790.4 24.3523 0.742545 16045.8 24.3486 0.720686 16305.4 24.3446 0.699433 16569.1 24.3405 0.678772 16837.1 24.3363 0.658686 17109.4 24.3319 0.639163 17386.1 24.3274 0.620187 17667.4 24.3228 0.601744 17953.1 24.3180 0.583822 18243.5 24.3132 0.566407 18538.6 24.3084 0.549485 18838.4 24.3034 0.533044 19143.1 24.2984 0.517072 19452.7 24.2934 0.501556 19767.4 24.2883 0.486483 20087.1 24.2832 0.471843 20412.0 24.2780 0.457624 20742.1 24.2729 0.443815 21077.6 24.2677 0.430403 21418.5 24.2626 0.417381 21765.0 24.2574 0.404735 22117.0 24.2522 0.392457 22474.7 24.2471 0.380537 22838.2 24.2419 0.368964 23207.6 24.2368 0.357729 23583.0 24.2318 0.346822 23964.4 24.2267 0.336236 24352.0 24.2217 0.325960 24745.9 24.2167 0.315987 25146.2 24.2117 0.306308 25552.9 24.2068 0.296914 25966.2 24.2020 0.287798 26386.1 24.1971 0.278952 26812.9 24.1924 0.270369 27246.6 24.1876 0.262040 27687.3 24.1830 0.253960 28135.1 24.1784 0.246119 28590.2 24.1738 0.238513 29052.6 24.1694 0.231135 29522.5 24.1656 0.223976 30000.0 24.1584 0.217033 periodictable-1.5.0/periodictable/xsf/cs.nff000066400000000000000000000316751310514471200210430ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.429437E-01 10.1617 -9999. 0.419900E-01 10.3261 -9999. 0.410574E-01 10.4931 -9999. 0.401456E-01 10.6628 -9999. 0.392540E-01 10.8353 -9999. 0.383822E-01 11.0106 -9999. 0.418579E-01 11.1886 -9999. 0.498688E-01 11.3696 -9999. 0.629069E-01 11.5535 -9999. 0.682259E-01 11.7404 -9999. 0.698775E-01 11.9303 -9999. 0.810036E-01 12.1232 -9999. 0.106648 12.3193 -9999. 0.151212 12.5186 -9999. 0.230476 12.7210 -9999. 0.366991 12.9268 -9999. 0.528355 13.1359 -9999. 0.818153 13.3483 -9999. 1.02400 13.5642 -9999. 1.26872 13.7836 -9999. 1.55155 14.0066 -9999. 1.87715 14.2331 -9999. 2.37324 14.4633 -9999. 2.92150 14.6973 -9999. 3.66589 14.9350 -9999. 4.75148 15.1765 -9999. 6.96885 15.4220 -9999. 8.91684 15.6714 -9999. 10.5004 15.9249 -9999. 11.2155 16.1825 -9999. 11.9793 16.4442 -9999. 12.6671 16.7102 -9999. 13.3472 16.9805 -9999. 13.9057 17.2551 -9999. 14.0264 17.5342 -9999. 14.1482 17.8178 -9999. 14.2710 18.1060 -9999. 14.3949 18.3989 -9999. 14.5199 18.6964 -9999. 14.3427 18.9988 -9999. 14.1328 19.3061 -9999. 13.9259 19.6184 -9999. 13.7221 19.9357 -9999. 13.4458 20.2582 -9999. 13.1638 20.5858 -9999. 12.8878 20.9188 -9999. 12.6141 21.2571 -9999. 12.2232 21.6009 -9999. 11.8445 21.9503 -9999. 11.4775 22.3053 -9999. 11.0553 22.6661 -9999. 10.6269 23.0327 -9999. 10.2151 23.4053 -9999. 9.81922 23.7838 -9999. 9.44774 24.1685 -9999. 9.11072 24.5594 -9999. 8.78571 24.9566 -9999. 8.47230 25.3603 -9999. 8.06786 25.7705 -9999. 7.56290 26.1873 -9999. 7.08954 26.6109 -9999. 6.74479 27.0413 -9999. 6.45590 27.4786 -9999. 6.17940 27.9231 -9999. 5.91473 28.3747 -9999. 5.65465 28.8337 -9999. 5.39884 29.3000 12.6617 5.15460 29.7739 12.6085 4.92141 30.2555 12.5481 4.70819 30.7449 12.4926 4.50744 31.2421 12.4400 4.31525 31.7475 12.3960 4.13125 32.2609 12.3757 3.95510 32.7827 12.3515 3.69912 33.3130 12.2583 3.44456 33.8518 12.1353 3.23730 34.3993 12.0145 3.04858 34.9557 11.8895 2.87087 35.5211 11.7594 2.70351 36.0956 11.6244 2.54592 36.6794 11.4846 2.39750 37.2727 11.3401 2.25774 37.8755 11.1910 2.12613 38.4882 11.0361 2.00219 39.1107 10.8723 1.88836 39.7432 10.7096 1.79032 40.3861 10.5479 1.69738 41.0393 10.3834 1.60926 41.7031 10.2132 1.52572 42.3776 10.0391 1.45651 43.0630 9.86795 1.39266 43.7595 9.69529 1.33162 44.4673 9.51862 1.27324 45.1865 9.33379 1.21743 45.9174 9.14415 1.17795 46.6600 8.95660 1.14149 47.4147 8.76513 1.10795 48.1816 8.57129 1.07846 48.9609 8.37109 1.04975 49.7528 8.16028 1.03140 50.5576 7.95248 1.02037 51.3753 7.74148 1.00945 52.2062 7.52514 1.00071 53.0506 7.30218 0.992083 53.9087 7.06993 0.983527 54.7806 6.82665 0.977322 55.6667 6.57189 0.971924 56.5670 6.29978 0.966556 57.4820 6.00707 0.975651 58.4117 5.70957 0.992222 59.3564 5.40057 1.00899 60.3165 5.07420 1.02599 61.2921 4.72660 1.04328 62.2834 4.35218 1.06087 63.2908 3.94035 1.08365 64.3145 3.50225 1.12115 65.3547 3.03170 1.15994 66.4118 2.51696 1.20007 67.4859 1.94558 1.24160 68.5775 1.29762 1.28456 69.6867 0.533614 1.34315 70.8138 -0.357045 1.42961 71.9591 -1.49468 1.53626 73.1230 -3.24563 1.89574 74.3057 -4.95726 4.03416 75.5076 -3.71900 5.53633 76.7289 -4.13781 5.32920 77.9699 -5.36837 5.60660 79.2310 -6.80368 6.49975 80.5125 -8.07423 7.81229 81.8147 -9.23883 9.38984 83.1380 -10.2860 11.2583 84.4827 -11.2161 13.4515 85.8491 -11.8243 16.0721 87.2377 -11.7699 18.7350 88.6487 -11.6737 21.3926 90.0825 -11.2789 24.4273 91.5395 -9.91843 27.8924 93.0201 -7.98196 29.9593 94.5246 -6.31012 31.9914 96.0535 -4.61550 34.1614 97.6071 -2.47873 36.4785 99.1858 0.546025 38.1738 100.790 3.14912 39.2258 102.420 5.57355 40.3068 104.077 8.15483 41.4176 105.760 11.2353 42.5591 107.471 14.5234 42.7886 109.209 17.5569 42.8428 110.975 20.7369 42.8970 112.770 24.2991 42.4777 114.594 28.2226 41.8125 116.448 31.7939 39.1374 118.331 34.2941 36.4271 120.245 36.1991 33.8804 122.190 37.7155 31.3247 124.166 39.0530 28.9619 126.175 40.3599 26.2516 128.215 40.9448 23.4092 130.289 41.1769 20.7702 132.397 41.0458 18.3249 134.538 40.7658 16.1611 136.714 40.2659 14.0101 138.925 39.5810 12.1454 141.172 38.7677 10.4602 143.456 37.8558 8.99985 145.776 36.8901 7.74341 148.134 35.9047 6.67657 150.530 34.8971 5.75697 152.964 33.8709 5.06500 155.439 32.9803 4.53271 157.953 32.1580 4.05932 160.507 31.3883 3.64909 163.103 30.6523 3.28031 165.742 29.9134 2.94880 168.422 29.2027 2.72906 171.146 28.5437 2.54023 173.915 27.8820 2.41181 176.727 27.3045 2.35284 179.586 26.7726 2.29531 182.491 26.2275 2.24818 185.442 25.7256 2.28677 188.442 25.2774 2.34777 191.489 24.8794 2.42120 194.587 24.5306 2.49692 197.734 24.1959 2.53716 200.932 23.8552 2.61356 204.182 23.5401 2.69082 207.485 23.2313 2.77954 210.840 22.9354 2.88360 214.251 22.6597 3.01518 217.716 22.4061 3.15657 221.237 22.1754 3.30736 224.816 21.9646 3.46563 228.452 21.7737 3.63057 232.147 21.6024 3.80168 235.902 21.4490 3.97494 239.717 21.3154 4.15147 243.595 21.1979 4.32988 247.535 21.0960 4.50746 251.538 21.0146 4.68555 255.607 20.9457 4.86103 259.741 20.8884 5.03213 263.942 20.8454 5.20297 268.211 20.8168 5.37346 272.549 20.7998 5.53261 276.957 20.7908 5.68956 281.437 20.7940 5.84707 285.989 20.8066 5.99112 290.615 20.8281 6.13181 295.315 20.8548 6.26754 300.092 20.8875 6.39575 304.945 20.9301 6.51839 309.878 20.9742 6.63359 314.890 21.0221 6.74434 319.983 21.0784 6.84843 325.158 21.1334 6.94355 330.418 21.1893 7.03462 335.762 21.2543 7.12044 341.192 21.3166 7.19610 346.711 21.3765 7.26781 352.319 21.4426 7.33591 358.017 21.5057 7.39315 363.808 21.5653 7.44458 369.692 21.6252 7.49296 375.672 21.6830 7.53641 381.748 21.7376 7.57213 387.922 21.7882 7.60520 394.197 21.8396 7.63714 400.573 21.8890 7.65692 407.052 21.9288 7.67186 413.635 21.9642 7.68692 420.326 21.9958 7.69656 427.124 22.0239 7.70399 434.032 22.0461 7.70723 441.052 22.0645 7.71053 448.186 22.1160 7.70170 455.435 22.1252 7.63186 462.802 22.0850 7.58868 470.287 22.0383 7.55972 477.894 21.9869 7.53078 485.623 21.9243 7.50204 493.478 21.8500 7.47342 501.459 21.7633 7.44489 509.570 21.6639 7.41643 517.812 21.5531 7.38681 526.187 21.4280 7.35286 534.698 21.2839 7.31054 543.346 21.1132 7.26427 552.134 20.9172 7.21831 561.065 20.6937 7.16823 570.139 20.4376 7.11603 579.361 20.1426 7.06148 588.732 19.8048 7.00682 598.254 19.4177 6.95222 607.930 18.9737 6.89799 617.763 18.4626 6.84424 627.755 17.8722 6.79051 637.908 17.1818 6.73162 648.226 16.3598 6.66508 658.711 15.3572 6.59388 669.365 14.1097 6.52347 680.191 12.5113 6.46370 691.193 10.3716 6.41210 702.372 7.25142 6.36288 713.733 1.78667 6.30731 725.277 -19.3132 6.24759 726.500 -44.1428 6.24135 726.700 -44.1051 36.6267 737.008 1.69243 35.8734 748.928 9.66949 35.0340 761.042 14.2840 34.2143 773.351 17.5447 33.4138 785.859 20.0496 32.6319 798.570 22.0606 31.8685 811.486 23.6900 31.1228 824.611 25.0563 30.4500 837.949 26.2365 29.8010 851.502 27.2476 29.1659 865.274 28.1037 28.5443 879.269 28.8116 27.9360 893.491 29.3411 27.3406 907.943 29.6849 26.8236 922.628 29.8885 26.3937 937.551 29.6445 25.9706 952.715 29.5170 26.5817 968.124 29.7900 27.2755 983.783 30.3994 27.9873 999.695 31.2384 28.7178 1015.86 32.9409 29.4672 1032.29 34.5490 28.9334 1048.99 35.5854 28.3585 1065.96 36.3974 27.7951 1083.20 36.9666 27.3143 1100.72 37.5261 27.0159 1118.52 38.1425 26.7207 1136.61 38.7507 26.4288 1155. 39.4146 26.1401 1173.68 40.0574 25.7310 1192.66 40.6102 25.2960 1211.95 41.1080 24.8684 1231.55 41.5644 24.4481 1251.47 41.9852 24.0348 1271.72 42.3545 23.6285 1292.29 42.6929 23.2687 1313.19 43.0382 22.9399 1334.43 43.3837 22.6158 1356.01 43.7236 22.2962 1377.94 44.0570 21.9812 1400.23 44.3847 21.6706 1422.88 44.7091 21.3644 1445.89 45.0289 21.0550 1469.28 45.3407 20.7468 1493.04 45.6459 20.4431 1517.19 45.9493 20.1439 1541.73 46.2556 19.8490 1566.67 46.5774 19.5585 1592.01 46.9337 19.2238 1617.76 47.2497 18.8266 1643.92 47.5078 18.4385 1670.51 47.7435 18.0585 1697.53 47.9613 17.6864 1724.99 48.1674 17.3218 1752.89 48.3598 16.9544 1781.24 48.5359 16.5912 1810.05 48.6952 16.2329 1839.32 48.8406 15.8826 1869.07 48.9744 15.5398 1899.30 49.0977 15.2042 1930.02 49.2112 14.8759 1961.24 49.3162 14.5548 1992.96 49.4112 14.2410 2025.20 49.5045 13.9396 2057.95 49.5930 13.6336 2091.24 49.6719 13.3331 2125.06 49.7422 13.0379 2159.43 49.8052 12.7488 2194.36 49.8617 12.4651 2229.85 49.9117 12.1869 2265.92 49.9558 11.9145 2302.57 49.9941 11.6470 2339.81 50.0264 11.3850 2377.66 50.0538 11.1288 2416.11 50.0761 10.8770 2455.19 50.0934 10.6306 2494.90 50.1056 10.3889 2535.26 50.1132 10.1526 2576.26 50.1164 9.92095 2617.93 50.1154 9.69413 2660.27 50.1097 9.47150 2703.30 50.0996 9.25397 2747.03 50.0856 9.04112 2791.46 50.0676 8.83255 2836.61 50.0454 8.62823 2882.49 50.0192 8.42832 2929.11 49.9889 8.23261 2976.48 49.9546 8.04107 3024.63 49.9162 7.85355 3073.55 49.8737 7.67011 3123.26 49.8270 7.49050 3173.78 49.7761 7.31476 3225.11 49.7208 7.14282 3277.27 49.6610 6.97451 3330.28 49.5964 6.80979 3384.15 49.5269 6.64868 3438.88 49.4522 6.49101 3494.50 49.3720 6.33676 3551.02 49.2860 6.18586 3608.46 49.1937 6.03824 3666.82 49.0946 5.89376 3726.13 48.9882 5.75255 3786.40 48.8738 5.61427 3847.64 48.7504 5.47904 3909.87 48.6171 5.34672 3973.11 48.4726 5.21726 4037.38 48.3154 5.09063 4102.68 48.1436 4.96680 4169.03 47.9550 4.84569 4236.46 47.7465 4.72718 4304.98 47.5142 4.61127 4374.62 47.2531 4.49790 4445.37 46.9559 4.38689 4517.27 46.6127 4.27843 4590.33 46.2084 4.17237 4664.58 45.7191 4.06846 4740.03 45.1028 3.96690 4816.69 44.2754 3.86754 4894.60 43.0196 3.77031 4973.77 40.3216 3.67525 5011.80 26.1858 3.63096 5012. 26.1877 11.1294 5054.21 40.5758 10.9592 5135.96 42.9330 10.6406 5219.03 43.7015 10.3315 5303.44 43.5450 10.0313 5359.30 36.6044 9.84000 5359.50 36.6083 13.5720 5389.22 43.3943 13.4535 5476.39 45.4612 13.1154 5564.97 46.3919 12.7860 5654.98 46.8301 12.4647 5714.20 44.0976 12.2605 5714.40 44.1015 13.9099 5746.44 47.1490 13.7992 5839.39 48.4385 13.4862 5933.83 49.2361 13.1777 6029.81 49.8667 12.8739 6127.33 50.3980 12.5747 6226.44 50.8590 12.2802 6327.15 51.2660 11.9907 6429.48 51.6294 11.7061 6533.48 51.9564 11.4262 6639.15 52.2522 11.1512 6746.54 52.5209 10.8813 6855.65 52.7660 10.6164 6966.54 52.9899 10.3565 7079.22 53.1950 10.1016 7193.72 53.3829 9.85157 7310.07 53.5554 9.60657 7428.31 53.7138 9.36658 7548.45 53.8593 9.13130 7670.54 53.9928 8.90105 7794.61 54.1155 8.67569 7920.68 54.2281 8.45495 8048.79 54.3313 8.23890 8178.98 54.4257 8.02767 8311.26 54.5122 7.82114 8445.69 54.5912 7.61911 8582.29 54.6632 7.42144 8721.11 54.7285 7.22849 8862.16 54.7878 7.03987 9005.50 54.8415 6.85567 9151.16 54.8899 6.67543 9299.17 54.9330 6.49972 9449.58 54.9717 6.32808 9602.42 55.0059 6.16049 9757.73 55.0361 5.99698 9915.55 55.0625 5.83732 10075.9 55.0853 5.68151 10238.9 55.1046 5.52950 10404.5 55.1208 5.38122 10572.8 55.1340 5.23658 10743.8 55.1445 5.09553 10917.6 55.1524 4.95799 11094.2 55.1578 4.82390 11273.6 55.1609 4.69317 11455.9 55.1619 4.56575 11641.2 55.1608 4.44157 11829.5 55.1579 4.32055 12020.8 55.1533 4.20263 12215.3 55.1469 4.08774 12412.8 55.1391 3.97582 12613.6 55.1298 3.86680 12817.6 55.1192 3.76061 13025.0 55.1073 3.65720 13235.6 55.0942 3.55649 13449.7 55.0801 3.45843 13667.2 55.0649 3.36296 13888.3 55.0487 3.27001 14112.9 55.0317 3.17953 14341.2 55.0139 3.09145 14573.1 54.9952 3.00572 14808.9 54.9759 2.92229 15048.4 54.9559 2.84110 15291.8 54.9352 2.76209 15539.1 54.9140 2.68521 15790.4 54.8922 2.61040 16045.8 54.8699 2.53763 16305.4 54.8472 2.46683 16569.1 54.8239 2.39795 16837.1 54.8003 2.33095 17109.4 54.7762 2.26579 17386.1 54.7518 2.20241 17667.4 54.7270 2.14076 17953.1 54.7018 2.08081 18243.5 54.6763 2.02251 18538.6 54.6505 1.96581 18838.4 54.6244 1.91068 19143.1 54.5979 1.85708 19452.7 54.5711 1.80496 19767.4 54.5440 1.75429 20087.1 54.5166 1.70502 20412.0 54.4888 1.65713 20742.1 54.4607 1.61057 21077.6 54.4322 1.56530 21418.5 54.4033 1.52131 21765.0 54.3740 1.47854 22117.0 54.3443 1.43697 22474.7 54.3141 1.39656 22838.2 54.2834 1.35729 23207.6 54.2520 1.31912 23583.0 54.2201 1.28202 23964.4 54.1875 1.24596 24352.0 54.1541 1.21092 24745.9 54.1198 1.17687 25146.2 54.0846 1.14378 25552.9 54.0483 1.11162 25966.2 54.0108 1.08038 26386.1 53.9719 1.05001 26812.9 53.9314 1.02050 27246.6 53.8892 0.991829 27687.3 53.8449 0.963968 28135.1 53.7983 0.936897 28590.2 53.7489 0.910593 29052.6 53.6962 0.885035 29522.5 53.6397 0.860201 30000.0 53.5787 0.836073 periodictable-1.5.0/periodictable/xsf/cu.nff000066400000000000000000000314531310514471200210370ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.30088 10.1617 -9999. 1.33374 10.3261 -9999. 1.36743 10.4931 -9999. 1.40197 10.6628 -9999. 1.43738 10.8353 -9999. 1.47369 11.0106 -9999. 1.51091 11.1886 -9999. 1.54908 11.3696 -9999. 1.58821 11.5535 -9999. 1.62833 11.7404 -9999. 1.66946 11.9303 -9999. 1.71163 12.1232 -9999. 1.75487 12.3193 -9999. 1.79920 12.5186 -9999. 1.84464 12.7210 -9999. 1.89124 12.9268 -9999. 1.93901 13.1359 -9999. 1.98799 13.3483 -9999. 2.03821 13.5642 -9999. 2.08970 13.7836 -9999. 2.14248 14.0066 -9999. 2.19660 14.2331 -9999. 2.25209 14.4633 -9999. 2.30779 14.6973 -9999. 2.36382 14.9350 -9999. 2.42121 15.1765 -9999. 2.47999 15.4220 -9999. 2.54019 15.6714 -9999. 2.59824 15.9249 -9999. 2.65520 16.1825 -9999. 2.71341 16.4442 -9999. 2.77289 16.7102 -9999. 2.83368 16.9805 -9999. 2.89580 17.2551 -9999. 2.93918 17.5342 -9999. 2.97486 17.8178 -9999. 3.01098 18.1060 -9999. 3.04754 18.3989 -9999. 3.08454 18.6964 -9999. 3.10571 18.9988 -9999. 3.12696 19.3061 -9999. 3.14835 19.6184 -9999. 3.16989 19.9357 -9999. 3.19158 20.2582 -9999. 3.20066 20.5858 -9999. 3.19641 20.9188 -9999. 3.19218 21.2571 -9999. 3.18794 21.6009 -9999. 3.18372 21.9503 -9999. 3.20429 22.3053 -9999. 3.23365 22.6661 -9999. 3.26327 23.0327 -9999. 3.29317 23.4053 -9999. 3.33041 23.7838 -9999. 3.39669 24.1685 -9999. 3.46428 24.5594 -9999. 3.53322 24.9566 -9999. 3.60353 25.3603 -9999. 3.67524 25.7705 -9999. 3.77578 26.1873 -9999. 3.89227 26.6109 -9999. 4.01236 27.0413 -9999. 4.13615 27.4786 -9999. 4.26376 27.9231 -9999. 4.39530 28.3747 -9999. 4.53091 28.8337 -9999. 4.62195 29.3000 1.55250 4.70800 29.7739 1.65095 4.79565 30.2555 1.75782 4.88494 30.7449 1.88491 4.97588 31.2421 2.05397 5.06606 31.7475 2.22143 5.05780 32.2609 2.35311 5.04955 32.7827 2.47607 5.04132 33.3130 2.60841 5.03052 33.8518 2.72325 4.96290 34.3993 2.80297 4.89618 34.9557 2.86036 4.83037 35.5211 2.89811 4.76544 36.0956 2.91457 4.70138 36.6794 2.90141 4.63818 37.2727 2.84272 4.62331 37.8755 2.82023 4.64620 38.4882 2.81008 4.66919 39.1107 2.80357 4.69231 39.7432 2.79650 4.71553 40.3861 2.78488 4.73888 41.0393 2.75809 4.76233 41.7031 2.71601 4.82518 42.3776 2.70061 4.90395 43.0630 2.69952 4.98400 43.7595 2.70614 5.06536 44.4673 2.71923 5.14805 45.1865 2.73822 5.23209 45.9174 2.76319 5.31749 46.6600 2.79640 5.40430 47.4147 2.84070 5.48239 48.1816 2.87937 5.55441 48.9609 2.91623 5.62737 49.7528 2.95358 5.70128 50.5576 2.99171 5.77617 51.3753 3.03082 5.85204 52.2062 3.07096 5.92891 53.0506 3.11182 6.00680 53.9087 3.15229 6.08718 54.7806 3.19626 6.17057 55.6667 3.24312 6.25510 56.5670 3.29248 6.34079 57.4820 3.34450 6.42765 58.4117 3.39947 6.51570 59.3564 3.45809 6.60496 60.3165 3.52267 6.69510 61.2921 3.58913 6.77770 62.2834 3.65483 6.86131 63.2908 3.72132 6.94594 64.3145 3.78974 7.03163 65.3547 3.86074 7.11837 66.4118 3.93519 7.20618 67.4859 4.01481 7.29507 68.5775 4.10554 7.38506 69.6867 4.19980 7.45157 70.8138 4.28440 7.51585 71.9591 4.36355 7.58068 73.1230 4.44021 7.64608 74.3057 4.51487 7.71204 75.5076 4.58764 7.77857 76.7289 4.65810 7.84568 77.9699 4.72419 7.91545 79.2310 4.79179 7.99051 80.5125 4.86006 8.06628 81.8147 4.92776 8.14276 83.1380 4.99337 8.21997 84.4827 5.05290 8.29791 85.8491 5.10538 8.39171 87.2377 5.16992 8.49627 88.6487 5.24128 8.60214 90.0825 5.31708 8.70932 91.5395 5.39635 8.81783 93.0201 5.47815 8.92770 94.5246 5.56026 9.03894 96.0535 5.64431 9.16033 97.6071 5.73687 9.28568 99.1858 5.83662 9.41273 100.790 5.94242 9.54153 102.420 6.05439 9.67210 104.077 6.17308 9.80444 105.760 6.29976 9.93860 107.471 6.43882 10.0698 109.209 6.57818 10.1951 110.975 6.72074 10.3219 112.770 6.86839 10.4503 114.594 7.02241 10.5803 116.448 7.18406 10.7120 118.331 7.35528 10.8452 120.245 7.53972 10.9802 122.190 7.75079 11.1146 124.166 7.96258 11.2038 126.175 8.16451 11.2938 128.215 8.36282 11.3845 130.289 8.56273 11.4759 132.397 8.76607 11.5681 134.538 8.97450 11.6609 136.714 9.18969 11.7546 138.925 9.41378 11.8490 141.172 9.64975 11.9441 143.456 9.90432 12.0400 145.776 10.2133 12.1294 148.134 10.5082 12.1290 150.530 10.7700 12.1285 152.964 11.0196 12.1281 155.439 11.2631 12.1277 157.953 11.5037 12.1273 160.507 11.7441 12.1269 163.103 11.9864 12.1264 165.742 12.2338 12.1260 168.422 12.4914 12.1256 171.146 12.7849 12.1252 173.915 13.0838 12.0498 176.727 13.3422 11.9562 179.586 13.5797 11.8633 182.491 13.8046 11.7711 185.442 14.0205 11.6797 188.442 14.2300 11.5890 191.489 14.4352 11.4989 194.587 14.6390 11.4096 197.734 14.8493 11.3210 200.932 15.0630 11.2039 204.182 15.2549 11.0754 207.485 15.4288 10.9484 210.840 15.5918 10.8229 214.251 15.7413 10.6988 217.716 15.8852 10.5875 221.237 16.0285 10.4783 224.816 16.1694 10.3702 228.452 16.3074 10.2632 232.147 16.4429 10.1573 235.902 16.5762 10.0525 239.717 16.7082 9.94883 243.595 16.8443 9.84619 247.535 16.9763 9.73053 251.538 17.0989 9.61505 255.607 17.2157 9.50095 259.741 17.3280 9.38819 263.942 17.4364 9.27677 268.211 17.5414 9.16669 272.549 17.6433 9.05790 276.957 17.7423 8.95041 281.437 17.8389 8.84419 285.989 17.9333 8.73923 290.615 18.0260 8.63551 295.315 18.1173 8.53304 300.092 18.2081 8.43177 304.945 18.3060 8.32868 309.878 18.3963 8.21445 314.890 18.4777 8.10177 319.983 18.5545 7.99065 325.158 18.6275 7.88105 330.418 18.6971 7.77296 335.762 18.7639 7.66634 341.192 18.8279 7.56119 346.711 18.8896 7.45749 352.319 18.9493 7.35519 358.017 19.0082 7.25432 363.808 19.0655 7.15219 369.692 19.1193 7.05012 375.672 19.1703 6.94953 381.748 19.2194 6.85037 387.922 19.2671 6.75262 394.197 19.3142 6.65627 400.573 19.3616 6.56129 407.052 19.4153 6.46767 413.635 19.4783 6.35980 420.326 19.5225 6.23335 427.124 19.5525 6.10942 434.032 19.5728 5.98794 441.052 19.5846 5.86890 448.186 19.5880 5.75221 455.435 19.5829 5.63784 462.802 19.5496 5.53428 470.287 19.5269 5.46085 477.894 19.5179 5.38839 485.623 19.5118 5.31688 493.478 19.5081 5.24633 501.459 19.5065 5.17672 509.570 19.5176 5.10273 517.812 19.5193 5.01342 526.187 19.5094 4.92566 534.698 19.4943 4.83945 543.346 19.4746 4.75473 552.134 19.4507 4.67152 561.065 19.4230 4.58974 570.139 19.3917 4.50941 579.361 19.3608 4.43048 588.732 19.3260 4.34393 598.254 19.2803 4.25521 607.930 19.2260 4.16831 617.763 19.1641 4.08318 627.755 19.0949 3.99979 637.908 19.0192 3.91810 648.226 18.9384 3.83581 658.711 18.8451 3.74932 669.365 18.7389 3.66477 680.191 18.6199 3.58213 691.193 18.4873 3.50135 702.372 18.3346 3.42240 713.733 18.1634 3.35770 725.277 17.9871 3.30516 737.008 17.8009 3.25344 748.928 17.5999 3.20253 761.042 17.3802 3.15242 773.351 17.1401 3.10310 785.859 16.8765 3.04912 798.570 16.5705 2.98532 811.486 16.2143 2.92286 824.611 15.7988 2.86170 837.949 15.3072 2.80183 851.502 14.7270 2.74321 865.274 13.9964 2.65809 879.269 13.0270 2.57208 893.491 11.6745 2.49603 907.943 9.63107 2.43609 922.628 5.28471 2.25909 932.400 -18.0747 2.14991 932.600 -18.0552 18.4786 937.551 2.42254 18.2953 952.715 9.96436 17.7508 968.124 13.1149 17.2224 983.783 15.1297 16.7102 999.695 16.5865 16.2132 1015.86 17.6966 15.7311 1032.29 18.4996 15.2631 1048.99 19.0803 14.9435 1065.96 19.6526 14.7764 1083.20 20.2159 14.6112 1100.72 20.7495 14.4479 1118.52 21.2540 14.2865 1136.61 21.7327 14.1267 1155. 22.1900 13.9688 1173.68 22.6303 13.8127 1192.66 23.0589 13.6583 1211.95 23.4828 13.5056 1231.55 23.9199 13.3547 1251.47 24.3712 13.1591 1271.72 24.8206 12.9133 1292.29 25.2016 12.6075 1313.19 25.5284 12.3091 1334.43 25.8205 12.0178 1356.01 26.0853 11.7333 1377.94 26.3272 11.4555 1400.23 26.5493 11.1844 1422.88 26.7542 10.9196 1445.89 26.9437 10.6611 1469.28 27.1195 10.4085 1493.04 27.2830 10.1616 1517.19 27.4346 9.91926 1541.73 27.5749 9.68255 1566.67 27.7052 9.45157 1592.01 27.8263 9.22606 1617.76 27.9391 9.00590 1643.92 28.0442 8.79103 1670.51 28.1425 8.58125 1697.53 28.2344 8.37649 1724.99 28.3230 8.17659 1752.89 28.4058 7.97676 1781.24 28.4810 7.78017 1810.05 28.5492 7.58711 1839.32 28.6108 7.39897 1869.07 28.6671 7.21555 1899.30 28.7187 7.03672 1930.02 28.7658 6.86213 1961.24 28.8086 6.69190 1992.96 28.8468 6.52606 2025.20 28.8850 6.36699 2057.95 28.9205 6.20664 2091.24 28.9508 6.05001 2125.06 28.9777 5.89702 2159.43 29.0016 5.74751 2194.36 29.0224 5.60115 2229.85 29.0402 5.45834 2265.92 29.0554 5.31903 2302.57 29.0685 5.18292 2339.81 29.0790 5.04977 2377.66 29.0874 4.92010 2416.11 29.0938 4.79321 2455.19 29.0982 4.66959 2494.90 29.1008 4.54872 2535.26 29.1016 4.43093 2576.26 29.1009 4.31615 2617.93 29.0987 4.20392 2660.27 29.0950 4.09434 2703.30 29.0900 3.98775 2747.03 29.0838 3.88362 2791.46 29.0763 3.78207 2836.61 29.0678 3.68302 2882.49 29.0582 3.58644 2929.11 29.0477 3.49224 2976.48 29.0362 3.40040 3024.63 29.0238 3.31086 3073.55 29.0107 3.22358 3123.26 28.9968 3.13847 3173.78 28.9822 3.05553 3225.11 28.9669 2.97464 3277.27 28.9510 2.89585 3330.28 28.9345 2.81902 3384.15 28.9174 2.74417 3438.88 28.8999 2.67122 3494.50 28.8818 2.60014 3551.02 28.8633 2.53085 3608.46 28.8444 2.46334 3666.82 28.8251 2.39757 3726.13 28.8053 2.33346 3786.40 28.7852 2.27105 3847.64 28.7648 2.21020 3909.87 28.7440 2.15092 3973.11 28.7230 2.09321 4037.38 28.7016 2.03696 4102.68 28.6799 1.98216 4169.03 28.6580 1.92878 4236.46 28.6357 1.87677 4304.98 28.6132 1.82613 4374.62 28.5903 1.77679 4445.37 28.5673 1.72877 4517.27 28.5440 1.68197 4590.33 28.5203 1.63632 4664.58 28.4963 1.59195 4740.03 28.4721 1.54870 4816.69 28.4476 1.50655 4894.60 28.4227 1.46552 4973.77 28.3975 1.42555 5054.21 28.3718 1.38663 5135.96 28.3459 1.34873 5219.03 28.3195 1.31182 5303.44 28.2926 1.27581 5389.22 28.2652 1.24083 5476.39 28.2374 1.20670 5564.97 28.2089 1.17344 5654.98 28.1798 1.14113 5746.44 28.1500 1.10956 5839.39 28.1194 1.07891 5933.83 28.0880 1.04895 6029.81 28.0556 1.01985 6127.33 28.0223 0.991530 6226.44 27.9878 0.963866 6327.15 27.9520 0.936946 6429.48 27.9147 0.910741 6533.48 27.8759 0.885194 6639.15 27.8352 0.860322 6746.54 27.7924 0.836094 6855.65 27.7473 0.812505 6966.54 27.6995 0.789511 7079.22 27.6485 0.767114 7193.72 27.5939 0.745298 7310.07 27.5350 0.724043 7428.31 27.4710 0.703338 7548.45 27.4009 0.683167 7670.54 27.3233 0.663518 7794.61 27.2366 0.644376 7920.68 27.1381 0.625722 8048.79 27.0246 0.607548 8178.98 26.8906 0.589836 8311.26 26.7281 0.572588 8445.69 26.5227 0.555773 8582.29 26.2467 0.539391 8721.11 25.8345 0.523425 8862.16 25.0487 0.507876 8978.80 17.5735 0.495545 8979. 17.5739 3.85305 9005.50 23.5690 3.83652 9151.16 25.6405 3.74771 9299.17 26.3539 3.66034 9449.58 26.8037 3.57419 9602.42 27.1340 3.48938 9757.73 27.3949 3.40592 9915.55 27.6099 3.32398 10075.9 27.7922 3.24324 10238.9 27.9495 3.16389 10404.5 28.0873 3.08595 10572.8 28.2092 3.00942 10743.8 28.3179 2.93430 10917.6 28.4155 2.86061 11094.2 28.5035 2.78833 11273.6 28.5832 2.71747 11455.9 28.6557 2.64802 11641.2 28.7216 2.57999 11829.5 28.7818 2.51335 12020.8 28.8368 2.44811 12215.3 28.8872 2.38424 12412.8 28.9333 2.32175 12613.6 28.9756 2.26061 12817.6 29.0143 2.20082 13025.0 29.0497 2.14236 13235.6 29.0822 2.08521 13449.7 29.1120 2.02936 13667.2 29.1392 1.97479 13888.3 29.1641 1.92148 14112.9 29.1868 1.86942 14341.2 29.2074 1.81858 14573.1 29.2262 1.76895 14808.9 29.2433 1.72051 15048.4 29.2587 1.67324 15291.8 29.2726 1.62712 15539.1 29.2851 1.58213 15790.4 29.2963 1.53824 16045.8 29.3063 1.49545 16305.4 29.3151 1.45372 16569.1 29.3229 1.41304 16837.1 29.3296 1.37339 17109.4 29.3354 1.33475 17386.1 29.3404 1.29710 17667.4 29.3445 1.26041 17953.1 29.3479 1.22467 18243.5 29.3505 1.18985 18538.6 29.3526 1.15595 18838.4 29.3539 1.12294 19143.1 29.3547 1.09079 19452.7 29.3550 1.05949 19767.4 29.3548 1.02903 20087.1 29.3541 0.999375 20412.0 29.3530 0.970516 20742.1 29.3515 0.942433 21077.6 29.3496 0.915106 21418.5 29.3474 0.888521 21765.0 29.3449 0.862657 22117.0 29.3420 0.837500 22474.7 29.3389 0.813031 22838.2 29.3356 0.789233 23207.6 29.3320 0.766091 23583.0 29.3282 0.743588 23964.4 29.3242 0.721709 24352.0 29.3201 0.700438 24745.9 29.3157 0.679760 25146.2 29.3113 0.659660 25552.9 29.3067 0.640123 25966.2 29.3020 0.621136 26386.1 29.2972 0.602683 26812.9 29.2923 0.584752 27246.6 29.2873 0.567329 27687.3 29.2823 0.550400 28135.1 29.2772 0.533953 28590.2 29.2721 0.517976 29052.6 29.2669 0.502455 29522.5 29.2617 0.487378 30000.0 29.2564 0.472735 periodictable-1.5.0/periodictable/xsf/dy.nff000066400000000000000000000320761310514471200210460ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.156345 10.1617 -9999. 0.162099 10.3261 -9999. 0.168065 10.4931 -9999. 0.174250 10.6628 -9999. 0.180663 10.8353 -9999. 0.187312 11.0106 -9999. 0.194206 11.1886 -9999. 0.201353 11.3696 -9999. 0.208763 11.5535 -9999. 0.216541 11.7404 -9999. 0.225052 11.9303 -9999. 0.233897 12.1232 -9999. 0.243090 12.3193 -9999. 0.252644 12.5186 -9999. 0.262574 12.7210 -9999. 0.272830 12.9268 -9999. 0.282908 13.1359 -9999. 0.293358 13.3483 -9999. 0.304194 13.5642 -9999. 0.315431 13.7836 -9999. 0.327082 14.0066 -9999. 0.338746 14.2331 -9999. 0.350598 14.4633 -9999. 0.362864 14.6973 -9999. 0.375560 14.9350 -9999. 0.388700 15.1765 -9999. 0.402300 15.4220 -9999. 0.415498 15.6714 -9999. 0.425747 15.9249 -9999. 0.436249 16.1825 -9999. 0.447010 16.4442 -9999. 0.458036 16.7102 -9999. 0.469334 16.9805 -9999. 0.480911 17.2551 -9999. 0.497649 17.5342 -9999. 0.515360 17.8178 -9999. 0.533703 18.1060 -9999. 0.549374 18.3989 -9999. 0.564746 18.6964 -9999. 0.580548 18.9988 -9999. 0.596792 19.3061 -9999. 0.613491 19.6184 -9999. 0.630657 19.9357 -9999. 0.651601 20.2582 -9999. 0.674639 20.5858 -9999. 0.698491 20.9188 -9999. 0.728655 21.2571 -9999. 0.776166 21.6009 -9999. 0.826776 21.9503 -9999. 0.880685 22.3053 -9999. 0.938109 22.6661 -9999. 1.02212 23.0327 -9999. 1.14378 23.4053 -9999. 1.27993 23.7838 -9999. 1.43228 24.1685 -9999. 1.60276 24.5594 -9999. 1.79354 24.9566 -9999. 2.00703 25.3603 -9999. 2.25646 25.7705 -9999. 2.68871 26.1873 -9999. 3.20377 26.6109 -9999. 3.81749 27.0413 -9999. 4.54878 27.4786 -9999. 5.42016 27.9231 -9999. 6.36575 28.3747 -9999. 7.43996 28.8337 -9999. 8.69544 29.3000 -6.57672 10.1628 29.7739 -5.87270 11.6252 30.2555 -5.13610 12.5089 30.7449 -4.39984 13.4597 31.2421 -3.39838 14.2200 31.7475 -2.54856 14.7955 32.2609 -1.67540 15.2859 32.7827 -0.825969 15.7306 33.3130 0.123986 16.0512 33.8518 0.951176 16.2649 34.3993 1.75178 16.4792 34.9557 2.56563 16.6664 35.5211 3.43631 16.8557 36.0956 4.50730 16.9295 36.6794 5.43657 16.6234 37.2727 6.20595 16.3228 37.8755 6.92833 15.9806 38.4882 7.52113 15.5783 39.1107 8.02132 15.1861 39.7432 8.45802 14.8038 40.3861 8.84224 14.4310 41.0393 9.18139 14.0677 41.7031 9.48073 13.7136 42.3776 9.74408 13.3683 43.0630 9.97417 13.0317 43.7595 10.1729 12.7036 44.4673 10.3411 12.3838 45.1865 10.4783 12.0720 45.9174 10.5816 11.7681 46.6600 10.6338 11.4718 47.4147 10.6237 11.2592 48.1816 10.6623 11.0953 48.9609 10.7198 10.9338 49.7528 10.7781 10.7746 50.5576 10.8334 10.6178 51.3753 10.8833 10.4632 52.2062 10.9256 10.3109 53.0506 10.9587 10.1608 53.9087 10.9804 10.0129 54.7806 10.9878 9.86711 55.6667 10.9763 9.72346 56.5670 10.9279 9.58192 57.4820 10.8148 9.51264 58.4117 10.7639 9.50207 59.3564 10.7457 9.49152 60.3165 10.7388 9.48097 61.2921 10.7389 9.47043 62.2834 10.7428 9.45992 63.2908 10.7478 9.44940 64.3145 10.7497 9.43890 65.3547 10.7383 9.43421 66.4118 10.7358 9.45333 67.4859 10.7436 9.47248 68.5775 10.7549 9.49168 69.6867 10.7669 9.51092 70.8138 10.7753 9.53020 71.9591 10.7686 9.55419 73.1230 10.7715 9.60986 74.3057 10.7894 9.66586 75.5076 10.8149 9.72219 76.7289 10.8461 9.77884 77.9699 10.8827 9.83579 79.2310 10.9223 9.88975 80.5125 10.9634 9.94401 81.8147 11.0062 9.99856 83.1380 11.0506 10.0534 84.4827 11.0967 10.1085 85.8491 11.1440 10.1636 87.2377 11.1923 10.2189 88.6487 11.2418 10.2745 90.0825 11.2926 10.3305 91.5395 11.3455 10.3862 93.0201 11.3984 10.4394 94.5246 11.4508 10.4929 96.0535 11.5031 10.5467 97.6071 11.5553 10.6007 99.1858 11.6036 10.6551 100.790 11.6601 10.7273 102.420 11.7453 10.8012 104.077 11.8403 10.8313 105.760 11.9188 10.8520 107.471 11.9958 10.8727 109.209 12.0918 10.8934 110.975 12.2277 10.8472 112.770 12.2875 10.7360 114.594 12.2998 10.6260 116.448 12.2814 10.5172 118.331 12.2522 10.3963 120.245 12.1652 10.2341 122.190 12.0202 10.0744 124.166 11.8211 9.91722 126.175 11.5665 9.76248 128.215 11.2517 9.61015 130.289 10.8697 9.46021 132.397 10.4156 9.31261 134.538 9.91001 9.13024 136.714 9.21241 8.86574 138.925 8.35458 8.58595 141.172 7.27634 7.92982 143.456 5.15563 7.19569 145.776 2.08340 6.63203 148.134 -3.41601 6.36699 150.530 -24.0330 10.6109 152.964 -8.99081 43.0103 155.439 5.66997 42.3561 157.953 14.2604 38.6166 160.507 19.2231 34.1930 163.103 22.0495 30.0280 165.742 21.8588 25.1011 168.422 20.7116 24.0887 171.146 20.6063 23.5993 173.915 20.8282 23.1198 176.727 21.1427 22.6501 179.586 21.4764 22.1899 182.491 21.7965 21.7391 185.442 22.0818 21.2974 188.442 22.2931 20.8647 191.489 22.4148 20.5495 194.587 22.6124 20.3399 197.734 22.8459 20.1324 200.932 23.0913 19.9271 204.182 23.3406 19.7238 207.485 23.5904 19.5226 210.840 23.8402 19.3235 214.251 24.1031 19.1264 217.716 24.3587 18.8891 221.237 24.5805 18.6442 224.816 24.7780 18.4024 228.452 24.9547 18.1638 232.147 25.1108 17.9283 235.902 25.2449 17.6958 239.717 25.3544 17.4664 243.595 25.4341 17.2399 247.535 25.4732 17.0164 251.538 25.3686 16.8597 255.607 25.3449 16.8517 259.741 25.3976 16.8436 263.942 25.4719 16.8355 268.211 25.5610 16.8275 272.549 25.6599 16.8194 276.957 25.7650 16.8113 281.437 25.8727 16.8033 285.989 25.9774 16.7953 290.615 26.0620 16.8020 295.315 26.1719 16.8434 300.092 26.3010 16.8849 304.945 26.4420 16.9265 309.878 26.5926 16.9682 314.890 26.7516 17.0100 319.983 26.9182 17.0519 325.158 27.0920 17.0939 330.418 27.2730 17.1360 335.762 27.4614 17.1782 341.192 27.6576 17.2205 346.711 27.8625 17.2629 352.319 28.0778 17.3054 358.017 28.3169 17.3480 363.808 28.5684 17.3575 369.692 28.8049 17.3508 375.672 29.0348 17.3442 381.748 29.2632 17.3376 387.922 29.4925 17.3310 394.197 29.7244 17.3243 400.573 29.9607 17.3177 407.052 30.2036 17.3111 413.635 30.4565 17.3045 420.326 30.7360 17.2979 427.124 31.0525 17.2485 434.032 31.3288 17.1415 441.052 31.5763 17.0351 448.186 31.8083 16.9294 455.435 32.0291 16.8243 462.802 32.2411 16.7199 470.287 32.4458 16.6162 477.894 32.6442 16.5131 485.623 32.8373 16.4106 493.478 33.0255 16.3087 501.459 33.2095 16.2075 509.570 33.3898 16.1069 517.812 33.5669 16.0070 526.187 33.7414 15.9077 534.698 33.9147 15.8089 543.346 34.0854 15.7078 552.134 34.2537 15.6072 561.065 34.4207 15.5073 570.139 34.5880 15.4080 579.361 34.7583 15.3093 588.732 34.9379 15.2113 598.254 35.1425 15.0849 607.930 35.3201 14.9213 617.763 35.4665 14.7593 627.755 35.5992 14.5992 637.908 35.7201 14.4408 648.226 35.8307 14.2841 658.711 35.9320 14.1291 669.365 36.0245 13.9757 680.191 36.1087 13.8241 691.193 36.1848 13.6741 702.372 36.2533 13.5257 713.733 36.3142 13.3789 725.277 36.3677 13.2338 737.008 36.4140 13.0902 748.928 36.4535 12.9481 761.042 36.4868 12.8076 773.351 36.5153 12.6686 785.859 36.5488 12.5312 798.570 36.5619 12.3619 811.486 36.5553 12.2042 824.611 36.5355 12.0485 837.949 36.5034 11.8947 851.502 36.4586 11.7409 865.274 36.3999 11.5867 879.269 36.3243 11.4324 893.491 36.2318 11.2802 907.943 36.1226 11.1300 922.628 35.9973 10.9816 937.551 35.8517 10.8296 952.715 35.6829 10.6781 968.124 35.4879 10.5273 983.783 35.2654 10.3785 999.695 35.0135 10.2311 1015.86 34.7301 10.0850 1032.29 34.4069 9.93350 1048.99 34.0370 9.78211 1065.96 33.6114 9.63075 1083.20 33.1223 9.48189 1100.72 32.5588 9.33537 1118.52 31.9053 9.19114 1136.61 31.1405 9.04900 1155. 30.2339 8.90909 1173.68 29.1403 8.77139 1192.66 27.7890 8.63578 1211.95 26.0605 8.50233 1231.55 23.7284 8.37101 1251.47 20.2814 8.24241 1271.72 14.0795 8.11584 1292.29 -27.4577 7.99120 1292.50 -39.0629 7.98992 1292.70 -39.0403 39.8247 1313.19 15.8866 38.9272 1334.43 23.6486 38.0323 1356.01 28.2848 37.1579 1377.94 31.6049 36.3032 1400.23 34.1792 35.4682 1422.88 36.2638 34.6527 1445.89 37.9953 33.8557 1469.28 39.4545 33.0775 1493.04 40.6915 32.3179 1517.19 41.7397 31.5782 1541.73 42.6173 30.8559 1566.67 43.3278 30.1501 1592.01 43.8561 29.4603 1617.76 44.1493 28.7863 1643.92 44.0281 28.1277 1670.51 41.9749 27.4841 1675.50 36.5794 27.3661 1675.70 36.5970 31.9284 1697.53 44.8155 31.3940 1724.99 46.5352 30.7439 1752.89 47.6399 30.1069 1781.24 48.4403 29.4832 1810.05 48.9492 28.8729 1839.32 48.2011 28.2752 1841.70 46.4804 28.2277 1841.90 46.4965 30.0747 1869.07 50.4083 29.4647 1899.30 51.4658 28.8106 1930.02 52.2505 28.1710 1961.24 52.8789 27.5456 1992.96 53.3658 26.9339 2025.20 53.5881 26.3425 2046.70 52.4843 25.9604 2046.90 52.4989 27.0616 2057.95 53.9357 26.8737 2091.24 54.8910 26.3215 2125.06 55.5483 25.7762 2159.43 56.1056 25.2390 2194.36 56.6024 24.7089 2229.85 57.0532 24.1860 2265.92 57.4664 23.6712 2302.57 57.8475 23.1642 2339.81 58.2007 22.6656 2377.66 58.5287 22.1746 2416.11 58.8332 21.6918 2455.19 59.1168 21.2174 2494.90 59.3806 20.7505 2535.26 59.6258 20.2921 2576.26 59.8544 19.8421 2617.93 60.0671 19.3998 2660.27 60.2645 18.9655 2703.30 60.4477 18.5393 2747.03 60.6173 18.1213 2791.46 60.7745 17.7115 2836.61 60.9203 17.3097 2882.49 61.0545 16.9151 2929.11 61.1782 16.5291 2976.48 61.2919 16.1501 3024.63 61.3962 15.7791 3073.55 61.4911 15.4147 3123.26 61.5768 15.0586 3173.78 61.6548 14.7102 3225.11 61.7255 14.3687 3277.27 61.7882 14.0334 3330.28 61.8434 13.7063 3384.15 61.8923 13.3861 3438.88 61.9347 13.0725 3494.50 61.9709 12.7657 3551.02 62.0012 12.4656 3608.46 62.0260 12.1720 3666.82 62.0452 11.8848 3726.13 62.0594 11.6040 3786.40 62.0685 11.3293 3847.64 62.0729 11.0607 3909.87 62.0726 10.7981 3973.11 62.0678 10.5415 4037.38 62.0589 10.2906 4102.68 62.0458 10.0454 4169.03 62.0285 9.80560 4236.46 62.0072 9.57138 4304.98 61.9822 9.34258 4374.62 61.9535 9.11884 4445.37 61.9208 8.90030 4517.27 61.8845 8.68689 4590.33 61.8447 8.47839 4664.58 61.8013 8.27464 4740.03 61.7541 8.07557 4816.69 61.7033 7.88121 4894.60 61.6488 7.69137 4973.77 61.5905 7.50588 5054.21 61.5283 7.32483 5135.96 61.4622 7.14799 5219.03 61.3920 6.97523 5303.44 61.3174 6.80651 5389.22 61.2382 6.64187 5476.39 61.1543 6.48109 5564.97 61.0652 6.32400 5654.98 60.9706 6.17080 5746.44 60.8701 6.02107 5839.39 60.7631 5.87494 5933.83 60.6489 5.73228 6029.81 60.5268 5.59303 6127.33 60.3959 5.45695 6226.44 60.2548 5.32415 6327.15 60.1023 5.19454 6429.48 59.9367 5.06807 6533.48 59.7555 4.94443 6639.15 59.5560 4.82389 6746.54 59.3343 4.70604 6855.65 59.0852 4.59115 6966.54 58.8016 4.47901 7079.22 58.4729 4.36943 7193.72 58.0828 4.26249 7310.07 57.6038 4.15807 7428.31 56.9849 4.05627 7548.45 56.1101 3.95668 7670.54 54.6014 3.85952 7790. 39.4034 3.76820 7790.20 39.4042 10.5382 7794.61 47.6200 10.5272 7920.68 54.8897 10.2205 8048.79 56.2386 9.92265 8178.98 56.8777 9.63359 8311.26 57.1090 9.35297 8445.69 56.9093 9.08041 8580.50 49.6117 8.81917 8580.70 49.6140 12.2874 8582.29 52.5864 12.2831 8721.11 57.6088 11.9235 8862.16 58.4433 11.5744 9005.50 58.4008 11.2353 9045.70 55.4366 11.1429 9045.90 55.4388 12.8122 9151.16 59.4861 12.5914 9299.17 60.4375 12.2916 9449.58 61.1011 11.9972 9602.42 61.6335 11.7082 9757.73 62.0826 11.4246 9915.55 62.4717 11.1469 10075.9 62.8144 10.8742 10238.9 63.1190 10.6070 10404.5 63.3920 10.3452 10572.8 63.6380 10.0887 10743.8 63.8606 9.83754 10917.6 64.0626 9.59162 11094.2 64.2465 9.35091 11273.6 64.4140 9.11536 11455.9 64.5669 8.88491 11641.2 64.7065 8.65950 11829.5 64.8340 8.43906 12020.8 64.9505 8.22354 12215.3 65.0569 8.01285 12412.8 65.1540 7.80695 12613.6 65.2425 7.60574 12817.6 65.3232 7.40918 13025.0 65.3965 7.21716 13235.6 65.4630 7.02963 13449.7 65.5233 6.84651 13667.2 65.5777 6.66772 13888.3 65.6266 6.49319 14112.9 65.6705 6.32283 14341.2 65.7097 6.15658 14573.1 65.7444 5.99435 14808.9 65.7751 5.83608 15048.4 65.8019 5.68167 15291.8 65.8251 5.53107 15539.1 65.8449 5.38418 15790.4 65.8616 5.24094 16045.8 65.8754 5.10127 16305.4 65.8865 4.96509 16569.1 65.8950 4.83233 16837.1 65.9011 4.70292 17109.4 65.9049 4.57680 17386.1 65.9067 4.45387 17667.4 65.9065 4.33408 17953.1 65.9044 4.21735 18243.5 65.9007 4.10362 18538.6 65.8953 3.99281 18838.4 65.8885 3.88487 19143.1 65.8802 3.77972 19452.7 65.8707 3.67731 19767.4 65.8599 3.57755 20087.1 65.8480 3.48041 20412.0 65.8351 3.38580 20742.1 65.8212 3.29368 21077.6 65.8063 3.20397 21418.5 65.7906 3.11663 21765.0 65.7740 3.03159 22117.0 65.7567 2.94881 22474.7 65.7388 2.86822 22838.2 65.7201 2.78977 23207.6 65.7009 2.71340 23583.0 65.6810 2.63907 23964.4 65.6607 2.56672 24352.0 65.6398 2.49631 24745.9 65.6185 2.42778 25146.2 65.5967 2.36109 25552.9 65.5745 2.29619 25966.2 65.5519 2.23304 26386.1 65.5289 2.17158 26812.9 65.5055 2.11178 27246.6 65.4818 2.05360 27687.3 65.4577 1.99698 28135.1 65.4334 1.94190 28590.2 65.4088 1.88830 29052.6 65.3841 1.83616 29522.5 65.3639 1.78543 30000.0 65.3175 1.73608 periodictable-1.5.0/periodictable/xsf/er.nff000066400000000000000000000320711310514471200210330ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.183326 10.1617 -9999. 0.186265 10.3261 -9999. 0.189251 10.4931 -9999. 0.192286 10.6628 -9999. 0.195368 10.8353 -9999. 0.198501 11.0106 -9999. 0.201683 11.1886 -9999. 0.207387 11.3696 -9999. 0.213987 11.5535 -9999. 0.220796 11.7404 -9999. 0.227823 11.9303 -9999. 0.235072 12.1232 -9999. 0.242553 12.3193 -9999. 0.250432 12.5186 -9999. 0.258593 12.7210 -9999. 0.267020 12.9268 -9999. 0.275721 13.1359 -9999. 0.284706 13.3483 -9999. 0.293984 13.5642 -9999. 0.303546 13.7836 -9999. 0.312450 14.0066 -9999. 0.321615 14.2331 -9999. 0.331050 14.4633 -9999. 0.340761 14.6973 -9999. 0.350757 14.9350 -9999. 0.361227 15.1765 -9999. 0.372211 15.4220 -9999. 0.383528 15.6714 -9999. 0.395190 15.9249 -9999. 0.407206 16.1825 -9999. 0.419588 16.4442 -9999. 0.432346 16.7102 -9999. 0.445503 16.9805 -9999. 0.459197 17.2551 -9999. 0.473311 17.5342 -9999. 0.487860 17.8178 -9999. 0.502855 18.1060 -9999. 0.518312 18.3989 -9999. 0.534244 18.6964 -9999. 0.550665 18.9988 -9999. 0.565831 19.3061 -9999. 0.581023 19.6184 -9999. 0.596622 19.9357 -9999. 0.612641 20.2582 -9999. 0.629090 20.5858 -9999. 0.647086 20.9188 -9999. 0.668378 21.2571 -9999. 0.690372 21.6009 -9999. 0.713088 21.9503 -9999. 0.736552 22.3053 -9999. 0.760789 22.6661 -9999. 0.808368 23.0327 -9999. 0.866467 23.4053 -9999. 0.928741 23.7838 -9999. 1.01712 24.1685 -9999. 1.12317 24.5594 -9999. 1.25529 24.9566 -9999. 1.46146 25.3603 -9999. 1.84167 25.7705 -9999. 2.76004 26.1873 -9999. 5.13353 26.6109 -9999. 6.94578 27.0413 -9999. 7.87961 27.4786 -9999. 8.83283 27.9231 -9999. 9.83569 28.3747 -9999. 10.9384 28.8337 -9999. 11.6621 29.3000 -2.73063 12.2610 29.7739 -1.95191 13.0525 30.2555 -0.742260 13.5835 30.7449 0.250293 13.8024 31.2421 1.12926 13.8277 31.7475 1.88863 13.8468 32.2609 2.59966 13.8659 32.7827 3.34200 13.8851 33.3130 4.23651 13.8898 33.8518 4.98066 13.3269 34.3993 5.32013 12.8719 34.9557 5.62060 12.6044 35.5211 5.87936 12.3461 36.0956 6.11641 12.1890 36.6794 6.35647 12.0340 37.2727 6.58638 11.9191 37.8755 6.84161 11.8171 38.4882 7.12835 11.7060 39.1107 7.39132 11.5161 39.7432 7.60185 11.3294 40.3861 7.76097 11.1457 41.0393 7.90517 11.0421 41.7031 8.09098 10.9494 42.3776 8.33547 10.8236 43.0630 8.51915 10.5795 43.7595 8.60912 10.3410 44.4673 8.57795 10.1455 45.1865 8.58166 10.1096 45.9174 8.64159 10.0738 46.6600 8.72478 10.0382 47.4147 8.83138 9.99634 48.1816 8.93235 9.92770 48.9609 9.02207 9.85955 49.7528 9.10524 9.79185 50.5576 9.18206 9.72462 51.3753 9.25183 9.65786 52.2062 9.31316 9.59154 53.0506 9.36055 9.52569 53.9087 9.37819 9.47149 54.7806 9.40829 9.46039 55.6667 9.45442 9.44931 56.5670 9.50604 9.43825 57.4820 9.56055 9.42719 58.4117 9.61741 9.41615 59.3564 9.67422 9.40065 60.3165 9.72739 9.38457 61.2921 9.77693 9.36853 62.2834 9.82234 9.35251 63.2908 9.86234 9.33653 64.3145 9.89288 9.32056 65.3547 9.90107 9.31397 66.4118 9.91942 9.33646 67.4859 9.94805 9.35900 68.5775 9.97884 9.38160 69.6867 10.0089 9.40425 70.8138 10.0339 9.42696 71.9591 10.0419 9.44972 73.1230 10.0528 9.51613 74.3057 10.0835 9.58503 75.5076 10.1246 9.65443 76.7289 10.1732 9.72434 77.9699 10.2282 9.79475 79.2310 10.2895 9.86567 80.5125 10.3576 9.93711 81.8147 10.4338 10.0091 83.1380 10.5243 10.0815 84.4827 10.6548 10.1356 85.8491 10.7585 10.1360 87.2377 10.8350 10.1365 88.6487 10.8977 10.1370 90.0825 10.9484 10.1375 91.5395 10.9869 10.1380 93.0201 11.0113 10.1384 94.5246 11.0127 10.1389 96.0535 10.9665 10.1773 97.6071 10.9543 10.2588 99.1858 10.9633 10.3410 100.790 10.9784 10.4238 102.420 10.9970 10.5073 104.077 11.0171 10.5914 105.760 11.0367 10.6762 107.471 11.0521 10.7617 109.209 11.0472 10.8593 110.975 11.0606 10.9856 112.770 11.0915 11.1134 114.594 11.1345 11.2428 116.448 11.2007 11.3719 118.331 11.2648 11.4649 120.245 11.3165 11.5586 122.190 11.3634 11.6530 124.166 11.4081 11.7483 126.175 11.4521 11.8443 128.215 11.4978 11.9411 130.289 11.5501 12.0386 132.397 11.6208 12.1370 134.538 11.7631 12.2362 136.714 11.8961 12.1120 138.925 11.9053 11.9560 141.172 11.8264 11.8020 143.456 11.7493 11.6248 145.776 11.4824 11.2123 148.134 10.9788 10.8145 150.530 10.4106 10.4307 152.964 9.24113 9.33994 155.439 6.60109 7.97383 157.953 0.699302 7.46300 160.507 -18.0091 18.4903 163.103 11.6185 41.4954 165.742 17.9520 26.9251 168.422 16.7470 23.7117 171.146 16.5718 21.6199 173.915 16.3940 21.2039 176.727 16.6261 20.8436 179.586 16.8618 20.4894 182.491 17.0784 20.3337 185.442 17.3628 20.2227 188.442 17.6820 20.1123 191.489 17.9978 20.0026 194.587 18.3018 19.8934 197.734 18.5863 19.7849 200.932 18.8199 19.6769 204.182 19.0536 19.6529 207.485 19.3125 19.6307 210.840 19.5784 19.6085 214.251 19.8459 19.5864 217.716 20.1130 19.5643 221.237 20.3786 19.5422 224.816 20.6422 19.5201 228.452 20.9034 19.4981 232.147 21.1624 19.4761 235.902 21.4192 19.4541 239.717 21.6747 19.4321 243.595 21.9369 19.4079 247.535 22.1896 19.3668 251.538 22.4293 19.3258 255.607 22.6601 19.2848 259.741 22.8818 19.2440 263.942 23.0937 19.2032 268.211 23.2935 19.1625 272.549 23.4771 19.1219 276.957 23.6234 19.0814 281.437 23.7205 19.1038 285.989 23.8736 19.1976 290.615 24.0642 19.2920 295.315 24.2775 19.3868 300.092 24.5094 19.4821 304.945 24.7587 19.5778 309.878 25.0266 19.6741 314.890 25.3157 19.7707 319.983 25.6317 19.8679 325.158 26.0484 19.9431 330.418 26.4271 19.8845 335.762 26.7457 19.8261 341.192 27.0433 19.7679 346.711 27.3262 19.7098 352.319 27.5978 19.6519 358.017 27.8597 19.5942 363.808 28.1127 19.5366 369.692 28.3561 19.4792 375.672 28.5845 19.4220 381.748 28.8014 19.3892 387.922 29.0283 19.3686 394.197 29.2645 19.3480 400.573 29.5038 19.3275 407.052 29.7456 19.3069 413.635 29.9896 19.2864 420.326 30.2362 19.2659 427.124 30.4853 19.2454 434.032 30.7377 19.2250 441.052 30.9939 19.2046 448.186 31.2550 19.1842 455.435 31.5226 19.1638 462.802 31.7995 19.1434 470.287 32.0909 19.1231 477.894 32.4336 19.0746 485.623 32.7461 18.9661 493.478 33.0228 18.8582 501.459 33.2881 18.7509 509.570 33.5452 18.6443 517.812 33.7965 18.5382 526.187 34.0436 18.4327 534.698 34.2885 18.3279 543.346 34.5332 18.2237 552.134 34.7796 18.1200 561.065 35.0527 18.0169 570.139 35.3183 17.8598 579.361 35.5546 17.6997 588.732 35.7765 17.5392 598.254 35.9876 17.3791 607.930 36.1907 17.2204 617.763 36.3888 17.0632 627.755 36.5887 16.9062 637.908 36.7889 16.7355 648.226 36.9801 16.5443 658.711 37.1417 16.3408 669.365 37.2741 16.1398 680.191 37.3823 15.9689 691.193 37.4969 15.8208 702.372 37.6359 15.6781 713.733 37.7810 15.5108 725.277 37.9056 15.3277 737.008 38.0150 15.1470 748.928 38.1141 14.9684 761.042 38.2051 14.7916 773.351 38.2905 14.6150 785.859 38.3687 14.4335 798.570 38.4324 14.2485 811.486 38.4835 14.0659 824.611 38.5238 13.8856 837.949 38.5546 13.7075 851.502 38.5757 13.5298 865.274 38.5865 13.3520 879.269 38.5843 13.1746 893.491 38.5701 12.9997 907.943 38.5448 12.8270 922.628 38.5108 12.6565 937.551 38.4632 12.4790 952.715 38.3992 12.3014 968.124 38.3162 12.1241 983.783 38.2158 11.9497 999.695 38.0987 11.7763 1015.86 37.9658 11.6039 1032.29 37.8084 11.4213 1048.99 37.6226 11.2393 1065.96 37.4050 11.0578 1083.20 37.1543 10.8793 1100.72 36.8681 10.7037 1118.52 36.5425 10.5308 1136.61 36.1727 10.3608 1155. 35.7521 10.1936 1173.68 35.2724 10.0290 1192.66 34.7229 9.86702 1211.95 34.0892 9.70770 1231.55 33.3520 9.55095 1251.47 32.4843 9.39710 1271.72 31.4471 9.24621 1292.29 30.1812 9.09833 1313.19 28.5886 8.95259 1334.43 26.4926 8.80930 1356.01 23.5260 8.66848 1377.94 18.6945 8.52971 1400.23 6.71894 8.39314 1409.20 -38.9950 8.33940 1409.40 -38.9702 40.5887 1422.88 12.0296 40.0367 1445.89 22.8727 39.1231 1469.28 28.4128 38.2306 1493.04 32.1810 37.3590 1517.19 35.0307 36.5107 1541.73 37.3061 35.6821 1566.67 39.1804 34.8723 1592.01 40.7524 34.0811 1617.76 42.0826 33.3076 1643.92 43.2077 32.5514 1670.51 44.1483 31.8125 1697.53 44.9099 31.0907 1724.99 45.4772 30.3855 1752.89 45.7895 29.6961 1781.24 45.6264 29.0223 1810.05 42.0381 28.3638 1811.70 37.8317 28.3268 1811.90 37.8489 33.0892 1839.32 47.0044 32.3649 1869.07 48.7071 31.6088 1899.30 49.8324 30.8705 1930.02 50.6519 30.1494 1961.24 51.1967 29.4453 1992.96 51.0989 28.7576 2005.70 48.6219 28.4891 2005.90 48.6389 30.4855 2025.20 52.1298 30.0719 2057.95 53.3485 29.3915 2091.24 54.1709 28.7264 2125.06 54.8029 28.0763 2159.43 55.2620 27.4414 2194.36 55.2803 26.8202 2206.40 53.9070 26.6116 2206.60 53.9201 27.7968 2229.85 56.1185 27.4134 2265.92 56.9651 26.8368 2302.57 57.6084 26.2695 2339.81 58.1614 25.7109 2377.66 58.6554 25.1620 2416.11 59.1039 24.6217 2455.19 59.5152 24.0912 2494.90 59.8945 23.5691 2535.26 60.2448 23.0561 2576.26 60.5696 22.5527 2617.93 60.8714 22.0580 2660.27 61.1516 21.5720 2703.30 61.4121 21.0955 2747.03 61.6543 20.6275 2791.46 61.8794 20.1689 2836.61 62.0892 19.7190 2882.49 62.2837 19.2769 2929.11 62.4636 18.8439 2976.48 62.6312 18.4201 3024.63 62.7865 18.0035 3073.55 62.9290 17.5956 3123.26 63.0612 17.1967 3173.78 63.1830 16.8048 3225.11 63.2947 16.4215 3277.27 63.3968 16.0456 3330.28 63.4902 15.6781 3384.15 63.5753 15.3177 3438.88 63.6518 14.9649 3494.50 63.7213 14.6202 3551.02 63.7838 14.2821 3608.46 63.8388 13.9507 3666.82 63.8869 13.6268 3726.13 63.9288 13.3099 3786.40 63.9648 12.9998 3847.64 63.9950 12.6964 3909.87 64.0197 12.3997 3973.11 64.0390 12.1093 4037.38 64.0533 11.8252 4102.68 64.0627 11.5473 4169.03 64.0673 11.2755 4236.46 64.0674 11.0098 4304.98 64.0631 10.7499 4374.62 64.0545 10.4956 4445.37 64.0417 10.2471 4517.27 64.0249 10.0040 4590.33 64.0041 9.76644 4664.58 63.9796 9.53405 4740.03 63.9511 9.30684 4816.69 63.9188 9.08480 4894.60 63.8829 8.86763 4973.77 63.8432 8.65548 5054.21 63.7999 8.44800 5135.96 63.7528 8.24524 5219.03 63.7019 8.04688 5303.44 63.6471 7.85317 5389.22 63.5884 7.66372 5476.39 63.5257 7.47864 5564.97 63.4588 7.29775 5654.98 63.3877 7.12095 5746.44 63.3120 6.94801 5839.39 63.2313 6.77909 5933.83 63.1457 6.61398 6029.81 63.0545 6.45254 6127.33 62.9574 6.29492 6226.44 62.8540 6.14069 6327.15 62.7435 5.99012 6429.48 62.6252 5.84282 6533.48 62.4984 5.69901 6639.15 62.3618 5.55832 6746.54 62.2143 5.42089 6855.65 62.0540 5.28650 6966.54 61.8791 5.15530 7079.22 61.6868 5.02685 7193.72 61.4737 4.90141 7310.07 61.2351 4.77871 7428.31 60.9648 4.65904 7548.45 60.6537 4.54189 7670.54 60.2878 4.42752 7794.61 59.8448 4.31558 7920.68 59.2846 4.20616 8048.79 58.5238 4.09925 8178.98 57.3345 3.99475 8311.26 54.4278 3.89259 8357.80 40.9938 3.85766 8358. 40.9947 10.7476 8445.69 55.9215 10.5401 8582.29 57.9179 10.2289 8721.11 58.8085 9.92690 8862.16 59.2467 9.63385 9005.50 59.3315 9.34914 9151.16 58.8895 9.07307 9264.20 51.5037 8.86737 9264.40 51.5058 12.3854 9299.17 57.9459 12.2981 9449.58 60.0307 11.9309 9602.42 60.6958 11.5751 9751.20 57.5653 11.2441 9751.40 57.5668 12.9154 9757.73 59.8201 12.8932 9915.55 62.0647 12.3549 10075.9 62.7355 12.0806 10238.9 63.3073 11.8099 10404.5 63.7777 11.5428 10572.8 64.1848 11.2794 10743.8 64.5429 11.0199 10917.6 64.8618 10.7643 11094.2 65.1482 10.5126 11273.6 65.4071 10.2650 11455.9 65.6420 10.0216 11641.2 65.8561 9.78223 11829.5 66.0515 9.54707 12020.8 66.2304 9.31613 12215.3 66.3942 9.08939 12412.8 66.5445 8.86689 12613.6 66.6823 8.64860 12817.6 66.8088 8.43455 13025.0 66.9248 8.22470 13235.6 67.0312 8.01905 13449.7 67.1287 7.81757 13667.2 67.2179 7.62024 13888.3 67.2995 7.42703 14112.9 67.3740 7.23791 14341.2 67.4417 7.05283 14573.1 67.5034 6.87176 14808.9 67.5592 6.69466 15048.4 67.6096 6.52147 15291.8 67.6549 6.35216 15539.1 67.6956 6.18667 15790.4 67.7318 6.02494 16045.8 67.7638 5.86694 16305.4 67.7919 5.71260 16569.1 67.8164 5.56187 16837.1 67.8375 5.41468 17109.4 67.8554 5.27099 17386.1 67.8702 5.13074 17667.4 67.8822 4.99385 17953.1 67.8916 4.86029 18243.5 67.8985 4.72998 18538.6 67.9031 4.60287 18838.4 67.9054 4.47889 19143.1 67.9058 4.35800 19452.7 67.9042 4.24012 19767.4 67.9008 4.12520 20087.1 67.8957 4.01317 20412.0 67.8891 3.90399 20742.1 67.8809 3.79758 21077.6 67.8714 3.69390 21418.5 67.8606 3.59288 21765.0 67.8486 3.49447 22117.0 67.8355 3.39861 22474.7 67.8213 3.30524 22838.2 67.8061 3.21431 23207.6 67.7900 3.12577 23583.0 67.7730 3.03955 23964.4 67.7552 2.95561 24352.0 67.7367 2.87390 24745.9 67.7175 2.79435 25146.2 67.6976 2.71693 25552.9 67.6771 2.64158 25966.2 67.6560 2.56826 26386.1 67.6343 2.49690 26812.9 67.6122 2.42747 27246.6 67.5896 2.35992 27687.3 67.5665 2.29420 28135.1 67.5431 2.23027 28590.2 67.5193 2.16808 29052.6 67.4955 2.10759 29522.5 67.4768 2.04876 30000.0 67.4279 1.99154 periodictable-1.5.0/periodictable/xsf/eu.nff000066400000000000000000000320571310514471200210420ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.185834 10.1617 -9999. 0.194890 10.3261 -9999. 0.204387 10.4931 -9999. 0.214346 10.6628 -9999. 0.224791 10.8353 -9999. 0.235293 11.0106 -9999. 0.245981 11.1886 -9999. 0.257155 11.3696 -9999. 0.268172 11.5535 -9999. 0.278545 11.7404 -9999. 0.289319 11.9303 -9999. 0.300510 12.1232 -9999. 0.310819 12.3193 -9999. 0.321127 12.5186 -9999. 0.331777 12.7210 -9999. 0.343044 12.9268 -9999. 0.355778 13.1359 -9999. 0.368984 13.3483 -9999. 0.382680 13.5642 -9999. 0.396727 13.7836 -9999. 0.408295 14.0066 -9999. 0.421248 14.2331 -9999. 0.434613 14.4633 -9999. 0.448402 14.6973 -9999. 0.462407 14.9350 -9999. 0.476622 15.1765 -9999. 0.491273 15.4220 -9999. 0.506375 15.6714 -9999. 0.520948 15.9249 -9999. 0.533821 16.1825 -9999. 0.547013 16.4442 -9999. 0.560531 16.7102 -9999. 0.575321 16.9805 -9999. 0.592399 17.2551 -9999. 0.609983 17.5342 -9999. 0.628090 17.8178 -9999. 0.646792 18.1060 -9999. 0.666166 18.3989 -9999. 0.686121 18.6964 -9999. 0.706672 18.9988 -9999. 0.729930 19.3061 -9999. 0.757327 19.6184 -9999. 0.785752 19.9357 -9999. 0.828093 20.2582 -9999. 0.883875 20.5858 -9999. 0.969026 20.9188 -9999. 1.13042 21.2571 -9999. 1.32975 21.6009 -9999. 1.70929 21.9503 -9999. 2.05425 22.3053 -9999. 2.56963 22.6661 -9999. 3.13395 23.0327 -9999. 3.66446 23.4053 -9999. 4.52170 23.7838 -9999. 5.20343 24.1685 -9999. 7.07901 24.5594 -9999. 9.05336 24.9566 -9999. 10.2633 25.3603 -9999. 11.5457 25.7705 -9999. 12.7844 26.1873 -9999. 13.8159 26.6109 -9999. 14.4928 27.0413 -9999. 15.1669 27.4786 -9999. 15.7859 27.9231 -9999. 16.4302 28.3747 -9999. 16.6264 28.8337 -9999. 16.7421 29.3000 2.90775 16.6530 29.7739 3.78453 16.4964 30.2555 4.56983 16.3413 30.7449 5.32570 16.1876 31.2421 6.10863 16.0354 31.7475 6.84178 15.6642 32.2609 7.43599 15.2938 32.7827 7.94986 14.9321 33.3130 8.40654 14.5857 33.8518 8.82127 14.2480 34.3993 9.20011 13.9181 34.9557 9.54888 13.5958 35.5211 9.87542 13.2810 36.0956 10.1961 12.9544 36.6794 10.4654 12.6023 37.2727 10.6860 12.2597 37.8755 10.8538 11.9337 38.4882 11.0174 11.6753 39.1107 11.2016 11.4225 39.7432 11.4252 11.1436 40.3861 11.5809 10.7662 41.0393 11.6367 10.4016 41.7031 11.5785 10.1419 42.3776 11.5956 9.96463 43.0630 11.6444 9.79047 43.7595 11.7056 9.61347 44.4673 11.7590 9.42618 45.1865 11.8043 9.24253 45.9174 11.8464 9.05803 46.6600 11.8683 8.86355 47.4147 11.8631 8.67326 48.1816 11.8132 8.50177 48.9609 11.7755 8.40426 49.7528 11.7612 8.30787 50.5576 11.7572 8.21258 51.3753 11.7588 8.11839 52.2062 11.7586 8.01433 53.0506 11.7493 7.91129 53.9087 11.7292 7.80956 54.7806 11.6884 7.70914 55.6667 11.6316 7.65364 56.5670 11.5979 7.61209 57.4820 11.5750 7.57077 58.4117 11.5539 7.52968 59.3564 11.5292 7.48880 60.3165 11.5057 7.46055 61.2921 11.4858 7.43243 62.2834 11.4646 7.40444 63.2908 11.4362 7.37655 64.3145 11.4042 7.36661 65.3547 11.3799 7.36103 66.4118 11.3561 7.35546 67.4859 11.3245 7.34990 68.5775 11.2826 7.37037 69.6867 11.2639 7.40702 70.8138 11.2595 7.44385 71.9591 11.2684 7.48088 73.1230 11.2940 7.50884 74.3057 11.3207 7.51287 75.5076 11.3358 7.51134 76.7289 11.3441 7.50981 77.9699 11.3490 7.50827 79.2310 11.3511 7.50674 80.5125 11.3511 7.50521 81.8147 11.3494 7.50368 83.1380 11.3469 7.50215 84.4827 11.3461 7.50062 85.8491 11.3566 7.49192 87.2377 11.3523 7.45646 88.6487 11.3321 7.42116 90.0825 11.3003 7.38603 91.5395 11.2594 7.35106 93.0201 11.2107 7.31626 94.5246 11.1571 7.28162 96.0535 11.1097 7.24715 97.6071 11.0573 7.17081 99.1858 10.9660 7.08146 100.790 10.8486 6.99321 102.420 10.7122 6.90606 104.077 10.5721 6.82000 105.760 10.4533 6.66635 107.471 10.2345 6.45642 109.209 9.94351 6.25310 110.975 9.61061 6.00472 112.770 9.14243 5.71920 114.594 8.55879 5.44726 116.448 7.88923 5.15714 118.331 7.01640 4.83137 120.245 5.91495 4.52616 122.190 4.55296 4.26457 124.166 2.88315 4.03482 126.175 0.763467 3.80646 128.215 -2.11010 3.55452 130.289 -6.48000 3.31927 132.397 -16.3328 4.36314 134.538 -25.7024 15.0485 136.714 -34.6364 41.3611 138.925 -9.71490 66.1748 141.172 17.1208 57.8027 143.456 28.5644 42.0620 145.776 26.1723 31.4923 148.134 24.3442 27.9775 150.530 22.8147 25.5125 152.964 22.2303 24.7059 155.439 22.3370 23.9248 157.953 22.5457 23.1832 160.507 22.7928 22.4887 163.103 23.0568 21.8747 165.742 23.3321 21.2873 168.422 23.6035 20.7449 171.146 23.8749 20.2226 173.915 24.1306 19.7134 176.727 24.3501 19.2170 179.586 24.5553 18.7763 182.491 24.7634 18.3503 185.442 24.9633 17.9339 188.442 25.1520 17.5269 191.489 25.3303 17.1292 194.587 25.5182 16.7323 197.734 25.6693 16.3019 200.932 25.7772 15.8825 204.182 25.8526 15.4740 207.485 25.8948 15.0759 210.840 25.8979 14.6881 214.251 25.8144 14.3103 217.716 25.7065 14.0807 221.237 25.6614 13.8923 224.816 25.6414 13.7065 228.452 25.6302 13.5231 232.147 25.6202 13.3421 235.902 25.6061 13.1636 239.717 25.5827 12.9875 243.595 25.5417 12.8137 247.535 25.4560 12.6423 251.538 25.3512 12.5737 255.607 25.2920 12.5365 259.741 25.2671 12.4993 263.942 25.2544 12.4622 268.211 25.2487 12.4253 272.549 25.2454 12.3884 276.957 25.2256 12.3588 281.437 25.2210 12.3571 285.989 25.2324 12.3553 290.615 25.2497 12.3535 295.315 25.2696 12.3517 300.092 25.2888 12.3500 304.945 25.3029 12.3482 309.878 25.2986 12.3464 314.890 25.2656 12.3965 319.983 25.2716 12.4887 325.158 25.3142 12.5817 330.418 25.3746 12.6753 335.762 25.4507 12.7696 341.192 25.5415 12.8646 346.711 25.6489 12.9604 352.319 25.7761 13.0493 358.017 25.9077 13.1270 363.808 26.0461 13.2045 369.692 26.1943 13.2825 375.672 26.3558 13.3611 381.748 26.5368 13.4402 387.922 26.7512 13.5078 394.197 26.9917 13.5488 400.573 27.2348 13.5255 407.052 27.4392 13.4768 413.635 27.6223 13.4281 420.326 27.7934 13.3796 427.124 27.9563 13.3313 434.032 28.1134 13.2832 441.052 28.2665 13.2353 448.186 28.4219 13.1859 455.435 28.5726 13.1286 462.802 28.7173 13.0657 470.287 28.8539 13.0000 477.894 28.9836 12.9348 485.623 29.1086 12.8698 493.478 29.2298 12.8051 501.459 29.3480 12.7408 509.570 29.4645 12.6767 517.812 29.5828 12.6113 526.187 29.7012 12.5402 534.698 29.8158 12.4582 543.346 29.9191 12.3710 552.134 30.0165 12.2844 561.065 30.1084 12.1913 570.139 30.1912 12.0953 579.361 30.2637 11.9980 588.732 30.3280 11.9013 598.254 30.3849 11.8053 607.930 30.4351 11.7099 617.763 30.4795 11.6153 627.755 30.5216 11.5208 637.908 30.5599 11.4188 648.226 30.5890 11.3052 658.711 30.5966 11.1846 669.365 30.5820 11.0654 680.191 30.5477 10.9646 691.193 30.5121 10.8780 702.372 30.4858 10.7945 713.733 30.4568 10.6954 725.277 30.4078 10.5862 737.008 30.3412 10.4781 748.928 30.2594 10.3712 761.042 30.1634 10.2652 773.351 30.0540 10.1580 785.859 29.9281 10.0448 798.570 29.7766 9.92691 811.486 29.5999 9.81049 824.611 29.3979 9.69536 837.949 29.1694 9.58149 851.502 28.9116 9.46671 865.274 28.6204 9.35064 879.269 28.2890 9.23366 893.491 27.9133 9.11807 907.943 27.4882 9.00396 922.628 27.0080 8.89133 937.551 26.4599 8.77388 952.715 25.8295 8.65656 968.124 25.0996 8.53960 983.783 24.2482 8.42397 999.695 23.2445 8.30953 1015.86 22.0436 8.19626 1032.29 20.5739 8.08056 1048.99 18.7214 7.96537 1065.96 16.2836 7.85065 1083.20 12.8470 7.73760 1100.72 7.32983 7.62607 1118.52 -5.39855 7.51600 1127.40 -60.8489 7.46236 1127.60 -60.8139 46.7448 1136.61 -3.74857 46.2262 1155. 10.9622 45.1984 1173.68 18.1065 44.1936 1192.66 22.9318 43.2107 1211.95 26.5900 42.2498 1231.55 29.5332 41.3103 1251.47 31.9878 40.3930 1271.72 34.0845 39.4981 1292.29 35.9081 38.6253 1313.19 37.5131 37.7714 1334.43 38.9375 36.9366 1356.01 40.2099 36.1206 1377.94 41.3509 35.3220 1400.23 42.3757 34.5411 1422.88 43.2957 33.7777 1445.89 44.1185 33.0315 1469.28 44.8462 32.3017 1480.50 45.1712 31.9613 1480.70 45.1755 31.9376 1493.04 45.4535 31.6043 1517.19 46.0088 30.9697 1541.73 46.4885 30.3478 1566.67 46.8487 29.7381 1592.01 46.9510 29.1409 1613.80 43.8244 28.6442 1614. 43.8307 30.7759 1617.76 46.4120 30.6755 1643.92 48.3734 29.9915 1670.51 49.2885 29.3227 1697.53 49.9729 28.6688 1724.99 50.5175 28.0296 1752.89 50.9311 27.4043 1781.24 51.1210 26.7929 1799.90 49.5256 26.4030 1800.10 49.5288 27.5459 1810.05 51.3717 27.3432 1839.32 52.3119 26.7616 1869.07 52.9269 26.1926 1899.30 53.4405 25.6365 1930.02 53.8945 25.0915 1961.24 54.3056 24.5580 1992.96 54.6787 24.0358 2025.20 55.0321 23.5345 2057.95 55.3645 23.0259 2091.24 55.6700 22.5261 2125.06 55.9525 22.0353 2159.43 56.2150 21.5532 2194.36 56.4584 21.0798 2229.85 56.6848 20.6160 2265.92 56.8955 20.1606 2302.57 57.0914 19.7144 2339.81 57.2734 19.2766 2377.66 57.4427 18.8477 2416.11 57.5999 18.4269 2455.19 57.7455 18.0144 2494.90 57.8801 17.6097 2535.26 58.0039 17.2131 2576.26 58.1180 16.8251 2617.93 58.2230 16.4449 2660.27 58.3189 16.0723 2703.30 58.4065 15.7077 2747.03 58.4865 15.3506 2791.46 58.5587 15.0003 2836.61 58.6233 14.6580 2882.49 58.6815 14.3232 2929.11 58.7331 13.9948 2976.48 58.7781 13.6737 3024.63 58.8175 13.3595 3073.55 58.8511 13.0517 3123.26 58.8789 12.7507 3173.78 58.9014 12.4564 3225.11 58.9195 12.1688 3277.27 58.9325 11.8866 3330.28 58.9406 11.6112 3384.15 58.9446 11.3417 3438.88 58.9442 11.0780 3494.50 58.9395 10.8200 3551.02 58.9308 10.5678 3608.46 58.9181 10.3211 3666.82 58.9016 10.0799 3726.13 58.8814 9.84401 3786.40 58.8575 9.61340 3847.64 58.8300 9.38791 3909.87 58.7989 9.16739 3973.11 58.7643 8.95182 4037.38 58.7262 8.74108 4102.68 58.6847 8.53495 4169.03 58.6395 8.33350 4236.46 58.5908 8.13652 4304.98 58.5386 7.94408 4374.62 58.4827 7.75585 4445.37 58.4230 7.57179 4517.27 58.3594 7.39196 4590.33 58.2920 7.21626 4664.58 58.2204 7.04436 4740.03 58.1442 6.87623 4816.69 58.0634 6.71209 4894.60 57.9777 6.55165 4973.77 57.8868 6.39478 5054.21 57.7903 6.24144 5135.96 57.6875 6.09153 5219.03 57.5780 5.94493 5303.44 57.4610 5.80163 5389.22 57.3357 5.66158 5476.39 57.2011 5.52484 5564.97 57.0562 5.39105 5654.98 56.8993 5.26031 5746.44 56.7287 5.13247 5839.39 56.5419 5.00739 5933.83 56.3358 4.88519 6029.81 56.1068 4.76602 6127.33 55.8496 4.64917 6226.44 55.5566 4.53504 6327.15 55.2173 4.42351 6429.48 54.8153 4.31442 6533.48 54.3236 4.20782 6639.15 53.6924 4.10352 6746.54 52.8128 4.00161 6855.65 51.3533 3.90188 6966.54 45.8022 3.80449 6976.80 35.2494 3.79567 6977. 35.2505 10.9555 7079.22 51.0728 10.6501 7193.72 52.6410 10.3230 7310.07 53.3299 10.0056 7428.31 53.5054 9.69811 7548.45 52.8957 9.40022 7617. 45.6503 9.23642 7617.20 45.6514 12.8525 7670.54 53.0633 12.6847 7794.61 54.7024 12.3073 7920.68 55.3366 11.9407 8048.79 54.0591 11.5853 8051.90 52.2193 11.5768 8052.10 52.2201 13.2566 8178.98 56.5824 12.9561 8311.26 57.4448 12.6548 8445.69 58.0852 12.3585 8582.29 58.6108 12.0670 8721.11 59.0601 11.7804 8862.16 59.4524 11.4988 9005.50 59.8000 11.2226 9151.16 60.1108 10.9507 9299.17 60.3901 10.6844 9449.58 60.6431 10.4233 9602.42 60.8728 10.1669 9757.73 61.0817 9.91573 9915.55 61.2724 9.66983 10075.9 61.4469 9.42856 10238.9 61.6063 9.19224 10404.5 61.7523 8.96083 10572.8 61.8858 8.73430 10743.8 62.0081 8.51260 10917.6 62.1200 8.29567 11094.2 62.2223 8.08347 11273.6 62.3158 7.87595 11455.9 62.4010 7.67304 11641.2 62.4787 7.47469 11829.5 62.5494 7.28082 12020.8 62.6134 7.09139 12215.3 62.6714 6.90632 12412.8 62.7237 6.72555 12613.6 62.7706 6.54901 12817.6 62.8126 6.37663 13025.0 62.8500 6.20834 13235.6 62.8830 6.04408 13449.7 62.9120 5.88376 13667.2 62.9372 5.72732 13888.3 62.9588 5.57469 14112.9 62.9772 5.42580 14341.2 62.9924 5.28057 14573.1 63.0047 5.13893 14808.9 63.0143 5.00082 15048.4 63.0213 4.86616 15291.8 63.0260 4.73488 15539.1 63.0284 4.60692 15790.4 63.0287 4.48220 16045.8 63.0271 4.36065 16305.4 63.0236 4.24221 16569.1 63.0185 4.12680 16837.1 63.0117 4.01437 17109.4 63.0035 3.90485 17386.1 62.9938 3.79817 17667.4 62.9829 3.69426 17953.1 62.9707 3.59307 18243.5 62.9574 3.49453 18538.6 62.9430 3.39858 18838.4 62.9277 3.30515 19143.1 62.9114 3.21420 19452.7 62.8943 3.12567 19767.4 62.8764 3.03948 20087.1 62.8577 2.95559 20412.0 62.8383 2.87394 20742.1 62.8183 2.79449 21077.6 62.7977 2.71716 21418.5 62.7765 2.64191 21765.0 62.7548 2.56870 22117.0 62.7325 2.49746 22474.7 62.7098 2.42815 22838.2 62.6867 2.36073 23207.6 62.6632 2.29513 23583.0 62.6392 2.23133 23964.4 62.6149 2.16926 24352.0 62.5902 2.10889 24745.9 62.5652 2.05017 25146.2 62.5398 1.99307 25552.9 62.5141 1.93753 25966.2 62.4881 1.88352 26386.1 62.4618 1.83100 26812.9 62.4351 1.77992 27246.6 62.4081 1.73026 27687.3 62.3807 1.68197 28135.1 62.3531 1.63502 28590.2 62.3251 1.58936 29052.6 62.2970 1.54498 29522.5 62.2725 1.50183 30000.0 62.2257 1.45987 periodictable-1.5.0/periodictable/xsf/f.nff000066400000000000000000000324211310514471200206510ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.516473E-01 10.1617 -9999. 0.564796E-01 10.3261 -9999. 0.617639E-01 10.4931 -9999. 0.675427E-01 10.6628 -9999. 0.738623E-01 10.8353 -9999. 0.807729E-01 11.0106 -9999. 0.883303E-01 11.1886 -9999. 0.965947E-01 11.3696 -9999. 0.108313 11.5535 -9999. 0.124621 11.7404 -9999. 0.147675 11.9303 -9999. 0.182934 12.1232 -9999. 0.286819 12.3193 -9999. 0.427324 12.5186 -9999. 0.526258 12.7210 -9999. 0.597229 12.9268 -9999. 0.676277 13.1359 -9999. 0.758009 13.3483 -9999. 0.849618 13.5642 -9999. 0.921830 13.7836 -9999. 0.987157 14.0066 -9999. 1.05711 14.2331 -9999. 1.13203 14.4633 -9999. 1.21042 14.6973 -9999. 1.29408 14.9350 -9999. 1.38352 15.1765 -9999. 1.47159 15.4220 -9999. 1.55088 15.6714 -9999. 1.63444 15.9249 -9999. 1.72250 16.1825 -9999. 1.80568 16.4442 -9999. 1.89012 16.7102 -9999. 1.97852 16.9805 -9999. 2.07103 17.2551 -9999. 2.15963 17.5342 -9999. 2.25202 17.8178 -9999. 2.34836 18.1060 -9999. 2.44883 18.3989 -9999. 2.54900 18.6964 -9999. 2.64222 18.9988 -9999. 2.73886 19.3061 -9999. 2.83903 19.6184 -9999. 2.94287 19.9357 -9999. 3.00878 20.2582 -9999. 3.07304 20.5858 -9999. 3.13868 20.9188 -9999. 3.20572 21.2571 -9999. 3.27419 21.6009 -9999. 3.34589 21.9503 -9999. 3.42018 22.3053 -9999. 3.49611 22.6661 -9999. 3.57373 23.0327 -9999. 3.65342 23.4053 -9999. 3.73752 23.7838 -9999. 3.82355 24.1685 -9999. 3.91157 24.5594 -9999. 4.00163 24.9566 -9999. 4.09386 25.3603 -9999. 4.18821 25.7705 -9999. 4.28474 26.1873 -9999. 4.37975 26.6109 -9999. 4.45994 27.0413 -9999. 4.54160 27.4786 -9999. 4.62477 27.9231 -9999. 4.70945 28.3747 -9999. 4.78193 28.8337 -9999. 4.84730 29.3000 0.226996 4.91356 29.7739 0.384977 4.95547 30.2555 0.517012 4.96088 30.7449 0.632930 4.96630 31.2421 0.741702 4.97169 31.7475 0.843041 4.96961 32.2609 0.935161 4.96752 32.7827 1.01869 4.96544 33.3130 1.09087 4.96877 33.8518 1.16564 4.98028 34.3993 1.24090 4.99181 34.9557 1.31432 5.00336 35.5211 1.38409 5.01495 36.0956 1.44517 5.03487 36.6794 1.51571 5.06402 37.2727 1.59158 5.09333 37.8755 1.67171 5.12282 38.4882 1.75846 5.15247 39.1107 1.85565 5.17148 39.7432 1.94343 5.18208 40.3861 2.02685 5.19270 41.0393 2.10858 5.20335 41.7031 2.18907 5.21402 42.3776 2.26852 5.22471 43.0630 2.34674 5.23542 43.7595 2.42403 5.24813 44.4673 2.50254 5.26164 45.1865 2.58173 5.27519 45.9174 2.66148 5.28879 46.6600 2.74181 5.30241 47.4147 2.82280 5.31607 48.1816 2.90450 5.32976 48.9609 2.98703 5.34349 49.7528 3.07048 5.35725 50.5576 3.15497 5.37106 51.3753 3.24062 5.38489 52.2062 3.32756 5.39876 53.0506 3.41588 5.41267 53.9087 3.50572 5.42661 54.7806 3.59394 5.44059 55.6667 3.66975 5.47877 56.5670 3.80894 5.50844 57.4820 3.93129 5.50408 58.4117 4.04771 5.49978 59.3564 4.16932 5.49039 60.3165 4.28507 5.47242 61.2921 4.40251 5.45038 62.2834 4.51175 5.41870 63.2908 4.61445 5.38722 64.3145 4.71396 5.35596 65.3547 4.81148 5.32485 66.4118 4.90780 5.29387 67.4859 5.00390 5.26314 68.5775 5.10210 5.23266 69.6867 5.20433 5.19583 70.8138 5.30366 5.15523 71.9591 5.40026 5.10646 73.1230 5.49039 5.05650 74.3057 5.57643 5.00700 75.5076 5.66011 4.95790 76.7289 5.74238 4.90928 77.9699 5.82490 4.86112 79.2310 5.90640 4.80893 80.5125 5.98696 4.75718 81.8147 6.06832 4.70000 83.1380 6.14317 4.63995 84.4827 6.21375 4.58088 85.8491 6.28211 4.52256 87.2377 6.34916 4.46501 88.6487 6.41631 4.40662 90.0825 6.48102 4.34714 91.5395 6.54638 4.28615 93.0201 6.60671 4.22208 94.5246 6.66374 4.15894 96.0535 6.71854 4.09670 97.6071 6.77197 4.03538 99.1858 6.82552 3.97497 100.790 6.88114 3.91047 102.420 6.92943 3.84210 104.077 6.97366 3.77553 105.760 7.01511 3.71011 107.471 7.05418 3.64583 109.209 7.09118 3.58268 110.975 7.12636 3.52060 112.770 7.15983 3.45959 114.594 7.19182 3.39966 116.448 7.22246 3.34076 118.331 7.25186 3.28287 120.245 7.28017 3.22601 122.190 7.30755 3.17011 124.166 7.33412 3.11517 126.175 7.36015 3.06119 128.215 7.38610 3.00816 130.289 7.41380 2.95521 132.397 7.43894 2.89798 134.538 7.46113 2.84188 136.714 7.48123 2.78686 138.925 7.49981 2.73290 141.172 7.51710 2.67999 143.456 7.53325 2.62810 145.776 7.54838 2.57722 148.134 7.56260 2.52734 150.530 7.57606 2.47844 152.964 7.58883 2.43047 155.439 7.60109 2.38340 157.953 7.61317 2.33722 160.507 7.62467 2.29077 163.103 7.63562 2.24467 165.742 7.64500 2.19877 168.422 7.65329 2.15387 171.146 7.66076 2.10987 173.915 7.66750 2.06676 176.727 7.67358 2.02450 179.586 7.67908 1.98311 182.491 7.68406 1.94258 185.442 7.68870 1.90291 188.442 7.69322 1.86384 191.489 7.69756 1.82515 194.587 7.70097 1.78639 197.734 7.70356 1.74843 200.932 7.70552 1.71126 204.182 7.70701 1.67487 207.485 7.70817 1.63917 210.840 7.70909 1.60412 214.251 7.70941 1.56903 217.716 7.70899 1.53468 221.237 7.70797 1.50109 224.816 7.70649 1.46825 228.452 7.70463 1.43613 232.147 7.70242 1.40471 235.902 7.70000 1.37397 239.717 7.69747 1.34363 243.595 7.69442 1.31361 247.535 7.69085 1.28406 251.538 7.68679 1.25513 255.607 7.68229 1.22683 259.741 7.67744 1.19923 263.942 7.67232 1.17223 268.211 7.66701 1.14583 272.549 7.66142 1.11977 276.957 7.65544 1.09423 281.437 7.64914 1.06924 285.989 7.64258 1.04483 290.615 7.63584 1.02097 295.315 7.62913 0.997652 300.092 7.62289 0.974426 304.945 7.61565 0.950230 309.878 7.60745 0.926635 314.890 7.59852 0.903624 319.983 7.58904 0.881185 325.158 7.57904 0.859304 330.418 7.56858 0.837966 335.762 7.55766 0.817158 341.192 7.54631 0.796866 346.711 7.53454 0.777080 352.319 7.52236 0.757783 358.017 7.50977 0.738966 363.808 7.49680 0.720616 369.692 7.48346 0.702721 375.672 7.46981 0.685272 381.748 7.45597 0.668255 387.922 7.44250 0.651661 394.197 7.42885 0.633203 400.573 7.41329 0.614319 407.052 7.39596 0.595997 413.635 7.37744 0.578222 420.326 7.35778 0.560977 427.124 7.33701 0.544246 434.032 7.31510 0.528014 441.052 7.29202 0.512267 448.186 7.26769 0.496989 455.435 7.24189 0.482202 462.802 7.21490 0.468296 470.287 7.18665 0.454791 477.894 7.15697 0.441676 485.623 7.12566 0.428938 493.478 7.09257 0.416567 501.459 7.05748 0.404554 509.570 7.02018 0.392888 517.812 6.98039 0.381557 526.187 6.93783 0.370553 534.698 6.89211 0.359867 543.346 6.84283 0.349489 552.134 6.78953 0.339410 561.065 6.73141 0.329269 570.139 6.66747 0.319340 579.361 6.59672 0.309710 588.732 6.51789 0.300371 598.254 6.42927 0.291313 607.930 6.32851 0.282529 617.763 6.21291 0.274009 627.755 6.07690 0.264419 637.908 5.91248 0.254836 648.226 5.70824 0.245599 658.711 5.44338 0.236698 669.365 5.07493 0.228119 680.191 4.49043 0.219851 691.193 3.15666 0.211882 696.600 -1.94772 0.208117 696.800 -1.94318 4.25895 702.372 3.32349 4.21271 713.733 4.82037 4.12109 725.277 5.54534 4.03145 737.008 6.03412 3.94377 748.928 6.40462 3.85800 761.042 6.70309 3.77409 773.351 6.95272 3.69201 785.859 7.16683 3.61170 798.570 7.35385 3.53315 811.486 7.51947 3.45631 824.611 7.66774 3.38114 837.949 7.80166 3.30760 851.502 7.92355 3.23567 865.274 8.03528 3.16529 879.269 8.13844 3.09645 893.491 8.23477 3.02910 907.943 8.32638 2.96067 922.628 8.40972 2.89030 937.551 8.48485 2.82159 952.715 8.55409 2.75453 968.124 8.61813 2.68905 983.783 8.67783 2.62525 999.695 8.73399 2.56216 1015.86 8.78586 2.49961 1032.29 8.83342 2.43829 1048.99 8.87741 2.37845 1065.96 8.91817 2.32006 1083.20 8.95607 2.26315 1100.72 8.99143 2.20754 1118.52 9.02433 2.15315 1136.61 9.05493 2.10007 1155. 9.08348 2.04828 1173.68 9.11025 1.99776 1192.66 9.13541 1.94833 1211.95 9.15924 1.89964 1231.55 9.18115 1.85150 1251.47 9.20115 1.80462 1271.72 9.21971 1.75892 1292.29 9.23745 1.71436 1313.19 9.25383 1.66995 1334.43 9.26857 1.62652 1356.01 9.28196 1.58407 1377.94 9.29416 1.54272 1400.23 9.30537 1.50232 1422.88 9.31553 1.46279 1445.89 9.32471 1.42423 1469.28 9.33307 1.38668 1493.04 9.34101 1.35014 1517.19 9.34812 1.31361 1541.73 9.35415 1.27789 1566.67 9.35919 1.24306 1592.01 9.36343 1.20914 1617.76 9.36691 1.17615 1643.92 9.36981 1.14412 1670.51 9.37220 1.11293 1697.53 9.37408 1.08257 1724.99 9.37567 1.05302 1752.89 9.37681 1.02396 1781.24 9.37738 0.995586 1810.05 9.37745 0.967927 1839.32 9.37707 0.941048 1869.07 9.37632 0.914906 1899.30 9.37523 0.889466 1930.02 9.37382 0.864740 1961.24 9.37213 0.840703 1992.96 9.37009 0.817335 2025.20 9.36817 0.794916 2057.95 9.36612 0.772632 2091.24 9.36371 0.750928 2125.06 9.36107 0.729789 2159.43 9.35823 0.709212 2194.36 9.35523 0.689181 2229.85 9.35205 0.669677 2265.92 9.34874 0.650699 2302.57 9.34530 0.632218 2339.81 9.34174 0.614237 2377.66 9.33807 0.596729 2416.11 9.33430 0.579696 2455.19 9.33045 0.563120 2494.90 9.32652 0.546979 2535.26 9.32252 0.531280 2576.26 9.31846 0.516004 2617.93 9.31435 0.501142 2660.27 9.31019 0.486672 2703.30 9.30599 0.472600 2747.03 9.30177 0.458907 2791.46 9.29751 0.445585 2836.61 9.29324 0.432617 2882.49 9.28894 0.420009 2929.11 9.28464 0.407744 2976.48 9.28033 0.395808 3024.63 9.27602 0.384190 3073.55 9.27171 0.372905 3123.26 9.26741 0.361916 3173.78 9.26311 0.351220 3225.11 9.25882 0.340826 3277.27 9.25455 0.330716 3330.28 9.25030 0.320869 3384.15 9.24606 0.311308 3438.88 9.24185 0.302003 3494.50 9.23767 0.292948 3551.02 9.23351 0.284136 3608.46 9.22937 0.275569 3666.82 9.22526 0.267242 3726.13 9.22119 0.259143 3786.40 9.21715 0.251250 3847.64 9.21313 0.243587 3909.87 9.20915 0.236125 3973.11 9.20519 0.228872 4037.38 9.20127 0.221828 4102.68 9.19738 0.214980 4169.03 9.19352 0.208329 4236.46 9.18969 0.201871 4304.98 9.18590 0.195620 4374.62 9.18217 0.189531 4445.37 9.17846 0.183630 4517.27 9.17481 0.177901 4590.33 9.17120 0.172344 4664.58 9.16764 0.166950 4740.03 9.16412 0.161717 4816.69 9.16065 0.156639 4894.60 9.15723 0.151715 4973.77 9.15386 0.146934 5054.21 9.15054 0.142300 5135.96 9.14726 0.137803 5219.03 9.14404 0.133443 5303.44 9.14087 0.129212 5389.22 9.13774 0.125110 5476.39 9.13467 0.121133 5564.97 9.13165 0.117276 5654.98 9.12867 0.113536 5746.44 9.12575 0.109908 5839.39 9.12287 0.106394 5933.83 9.12005 0.102985 6029.81 9.11727 0.996809E-01 6127.33 9.11454 0.964772E-01 6226.44 9.11187 0.933711E-01 6327.15 9.10923 0.903615E-01 6429.48 9.10665 0.874446E-01 6533.48 9.10411 0.846192E-01 6639.15 9.10162 0.818799E-01 6746.54 9.09918 0.792250E-01 6855.65 9.09679 0.766529E-01 6966.54 9.09444 0.741586E-01 7079.22 9.09213 0.717451E-01 7193.72 9.08987 0.694045E-01 7310.07 9.08765 0.671388E-01 7428.31 9.08548 0.649421E-01 7548.45 9.08335 0.628154E-01 7670.54 9.08126 0.607550E-01 7794.61 9.07922 0.587594E-01 7920.68 9.07722 0.568259E-01 8048.79 9.07525 0.549528E-01 8178.98 9.07333 0.531394E-01 8311.26 9.07145 0.513851E-01 8445.69 9.06961 0.496838E-01 8582.29 9.06780 0.480370E-01 8721.11 9.06603 0.464430E-01 8862.16 9.06430 0.448991E-01 9005.50 9.06261 0.434069E-01 9151.16 9.06096 0.419581E-01 9299.17 9.05933 0.405582E-01 9449.58 9.05775 0.392026E-01 9602.42 9.05620 0.378903E-01 9757.73 9.05468 0.366203E-01 9915.55 9.05319 0.353915E-01 10075.9 9.05174 0.342018E-01 10238.9 9.05032 0.330505E-01 10404.5 9.04894 0.319365E-01 10572.8 9.04758 0.308584E-01 10743.8 9.04625 0.298153E-01 10917.6 9.04496 0.288060E-01 11094.2 9.04369 0.278296E-01 11273.6 9.04245 0.268849E-01 11455.9 9.04124 0.259711E-01 11641.2 9.04006 0.250872E-01 11829.5 9.03890 0.242321E-01 12020.8 9.03777 0.234051E-01 12215.3 9.03667 0.226052E-01 12412.8 9.03560 0.218317E-01 12613.6 9.03454 0.210836E-01 12817.6 9.03352 0.203602E-01 13025.0 9.03251 0.196608E-01 13235.6 9.03153 0.189845E-01 13449.7 9.03058 0.183307E-01 13667.2 9.02965 0.176985E-01 13888.3 9.02873 0.170875E-01 14112.9 9.02785 0.164968E-01 14341.2 9.02698 0.159259E-01 14573.1 9.02613 0.153741E-01 14808.9 9.02530 0.148408E-01 15048.4 9.02450 0.143254E-01 15291.8 9.02371 0.138274E-01 15539.1 9.02294 0.133462E-01 15790.4 9.02219 0.128813E-01 16045.8 9.02146 0.124321E-01 16305.4 9.02075 0.119982E-01 16569.1 9.02005 0.115791E-01 16837.1 9.01937 0.111742E-01 17109.4 9.01871 0.107832E-01 17386.1 9.01807 0.104056E-01 17667.4 9.01744 0.100409E-01 17953.1 9.01683 0.968875E-02 18243.5 9.01623 0.934876E-02 18538.6 9.01565 0.902052E-02 18838.4 9.01508 0.870365E-02 19143.1 9.01453 0.839779E-02 19452.7 9.01399 0.810257E-02 19767.4 9.01346 0.781765E-02 20087.1 9.01295 0.754257E-02 20412.0 9.01245 0.727735E-02 20742.1 9.01196 0.702156E-02 21077.6 9.01149 0.677484E-02 21418.5 9.01103 0.653687E-02 21765.0 9.01058 0.630733E-02 22117.0 9.01014 0.608592E-02 22474.7 9.00972 0.587235E-02 22838.2 9.00930 0.566631E-02 23207.6 9.00890 0.546756E-02 23583.0 9.00851 0.527582E-02 23964.4 9.00812 0.509084E-02 24352.0 9.00775 0.491238E-02 24745.9 9.00739 0.474021E-02 25146.2 9.00704 0.457410E-02 25552.9 9.00669 0.441383E-02 25966.2 9.00636 0.425919E-02 26386.1 9.00604 0.410999E-02 26812.9 9.00572 0.396602E-02 27246.6 9.00541 0.382710E-02 27687.3 9.00511 0.369306E-02 28135.1 9.00482 0.356371E-02 28590.2 9.00454 0.343889E-02 29052.6 9.00427 0.331845E-02 29522.5 9.00401 0.320221E-02 30000.0 9.00371 0.309004E-02 periodictable-1.5.0/periodictable/xsf/f0_WaasKirf.dat000066400000000000000000001227521310514471200225260ustar00rootroot00000000000000#F f0_WaasKirf.dat #UT Elastic Photon-Atom Scattering, relativistic form factors. #UF0TYPE PARAMETRIZATION ; TABLE OR PARAMETRIZATION? #UIDL xf0 #C This file has been created using f0_WaasKirf.tcl #D Tue Oct 1 14:37:14 CEST 2002 #C This file belongs to the DABAX library. More information on #C DABAX can be found at: #C http://www.esrf.fr/computing/scientific/dabax #UD Elastic Photon-Atom Scattering, relativistic form factors. #UD #UD This data set contains data calculated by D. Waasmaier & A. Kirfel. #UD The original data is available from : #UD ftp://wrzx02.rz.uni-wuerzburg.de/pub/local/Crystallography #UD These data, computed for neutral atoms and ions are valid for the full #UD range of sin(theta)/lambda from 0.0 to 6.0 A-1.This table have been #UD developped from fits of o linear combination of five Gaussians to the #UD values of the scattering factors tabulated in "International tables for #UD Crystallography (1992) [Vol. C. Dordrecht: Kluwer Academic Publishers]. #UD For a detailed discussion of the underlying validity of the #UD information contained in these directories see, for example: #UD #UD New Analytical Scattering Factor Functions for Free Atoms #UD and Ions for Free Atoms and Ions #UD D. Waasmaier & A. Kirfel #UD Acta Cryst. (1995). A51, 416-413 #UD #UD fo the non-dispersive part of the atomic scattering factor is a #UD function of the selected element and of sin(theta)/lambda, where #UD lambda is the photon wavelengh and theta is incident angle. #UD This function can be approximated by a function: #UD #UD f0[k] = c + [SUM a_i*EXP(-b_i*(k^2)) ] #UD i=1,5 #UD #UD where k = sin(theta) / lambda and c, a_i and b_i #UD are the coefficients tabulated in this file (in columns: #UD a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 #C #C The original README fime from D. Waasmaier & A. Kirfel follows here : #C #UO April, 1995 #UO #UO This directory contains the results of the publication: #UO #UO New Analytical Scattering Factor Functions for Free Atoms and Ions #UO D. Waasmaier & A. Kirfel #UO Acta Cryst. (1995). A51, 416-413 #UO #UO - *.zip: A detailed compilation of all relevant results (one page per #UO atom or ion) has been prepared in form of an 'atlas'. This atlas is #UO stored in the postscript-files #UO sfac10.zip - sfac98.zip for atoms with increasing atom number and #UO sfaci1.zip - sfaci6.zip for ions, again with increasing atom number. #UO #UO - abstract.ps contains an extract of the publication refering to the atlas. #UO #UO - sfac.dat contains the new parameters ai, bi and c for all atoms and ions. #UO #UO Fitparameters of all atoms/ions (with the excepetion of O1-) #UO from publication "New Analytical Scattering Factor Functions for #UO Free Atoms and Ions", D. Waasmaier & A. Kirfel, Acta Cryst. A 95 #UO #UO Fit for O1- based on the tabulated values of Table 2 (D.REZ, #UO P.REZ & I.GRANT, Acta Cryst. (1994), A50, 481-497). #UO #UO Fits for all other atoms/ions based on the tabulated values #UO of Table 6.1.1.1 (atoms) and Table 6.1.1.3 (ions) #UO (International Tables for Crystallography, Vol. C, 1992). #S 1 H #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.413048 0.294953 0.187491 0.080701 0.023736 0.000049 15.569946 32.398468 5.711404 61.889874 1.334118 #S 1 H1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.702260 0.763666 0.248678 0.261323 0.023017 0.000425 23.945604 74.897919 6.773289 233.583450 1.337531 #S 2 He #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.732354 0.753896 0.283819 0.190003 0.039139 0.000487 11.553918 4.595831 1.546299 26.463964 0.377523 #S 3 Li #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.974637 0.158472 0.811855 0.262416 0.790108 0.002542 4.334946 0.342451 97.102966 201.363831 1.409234 #S 3 Li1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.432724 0.549257 0.376575 -0.336481 0.976060 0.001764 0.260367 1.042836 7.885294 0.260368 3.042539 #S 4 Be #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.533712 0.638283 0.601052 0.106139 1.118414 0.002511 42.662079 0.595420 99.106499 0.151340 1.843093 #S 4 Be2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.055430 -2.372617 1.044914 0.544233 0.381737 -0.653773 0.001226 0.001227 1.542106 0.456279 4.047479 #S 5 B #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 2.085185 1.064580 1.062788 0.140515 0.641784 0.003823 23.494068 1.137894 61.238976 0.114886 0.399036 #S 6 C #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 2.657506 1.078079 1.490909 -4.241070 0.713791 4.297983 14.780758 0.776775 42.086842 -0.000294 0.239535 #S 6 Cval #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.258489 0.728215 1.119856 2.168133 0.705239 0.019722 10.683769 0.208177 0.836097 24.603704 58.954273 #S 7 N #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.893780 3.277479 1.858092 0.858927 0.912985 -11.804902 0.000158 10.232723 30.344690 0.656065 0.217287 #S 8 O #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 2.960427 2.508818 0.637853 0.722838 1.142756 0.027014 14.182259 5.936858 0.112726 34.958481 0.390240 #S 8 O1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.106934 3.235142 1.148886 0.783981 0.676953 0.046136 19.868080 6.960252 0.170043 65.693512 0.630757 #S 8 O2- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.990247 2.300563 0.607200 1.907882 1.167080 0.025429 16.639956 5.636819 0.108493 47.299709 0.379984 #S 9 F #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.511943 2.772244 0.678385 0.915159 1.089261 0.032557 10.687859 4.380466 0.093982 27.255203 0.313066 #S 9 F1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 0.457649 3.841561 1.432771 0.801876 3.395041 0.069525 0.917243 5.507803 0.164955 51.076206 15.821679 #S 10 Ne #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.183749 2.905726 0.520513 1.135641 1.228065 0.025576 8.175457 3.252536 0.063295 21.813910 0.224952 #S 11 Na #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.910127 3.081783 1.262067 1.098938 0.560991 0.079712 3.281434 9.119178 0.102763 132.013947 0.405878 #S 11 Na1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.148690 4.073989 0.767888 0.995612 0.968249 0.045300 2.594987 6.046925 0.070139 14.122657 0.217037 #S 12 Mg #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.708971 1.194814 1.558157 1.170413 3.239403 0.126842 4.875207 108.506081 0.111516 48.292408 1.928171 #S 12 Mg2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.062918 4.135106 0.853742 1.036792 0.852520 0.058851 2.015803 4.417941 0.065307 9.669710 0.187818 #S 13 Al #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.730796 2.313951 1.541980 1.117564 3.154754 0.139509 3.628931 43.051167 0.095960 108.932388 1.555918 #S 13 Al3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.132015 0.912049 1.102425 0.614876 3.219136 0.019397 3.528641 7.378344 0.133708 0.039065 1.644728 #S 14 Si #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 5.275329 3.191038 1.511514 1.356849 2.519114 0.145073 2.631338 33.730728 0.081119 86.288643 1.170087 #S 14 Siva #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 2.879033 3.072960 1.515981 1.390030 4.995051 0.146030 1.239713 38.706276 0.081481 93.616333 2.770293 #S 14 Si4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 3.676722 3.828496 1.258033 0.419024 0.720421 0.097266 1.446851 3.013144 0.064397 0.206254 5.970222 #S 15 P #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.950541 4.146930 1.494560 1.522042 5.729711 0.155233 0.908139 27.044952 0.071280 67.520187 1.981173 #S 16 S #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.372157 5.154568 1.473732 1.635073 1.209372 0.154722 1.514347 22.092527 0.061373 55.445175 0.646925 #S 17 Cl #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.446071 6.870609 6.151801 1.750347 0.634168 0.146773 0.052357 1.193165 18.343416 46.398396 0.401005 #S 17 Cl1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.061802 7.139886 6.524271 2.355626 35.829403 -34.916603 0.144727 1.171795 19.467655 60.320301 0.000436 #S 18 Ar #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.188004 6.638454 0.454180 1.929593 1.523654 0.265954 0.956221 15.339877 15.339862 39.043823 0.062409 #S 19 K #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 8.163991 7.146945 1.070140 0.877316 1.486434 0.253614 12.816323 0.808945 210.327011 39.597652 0.052821 #S 19 K1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 -17.609339 1.494873 7.150305 10.899569 15.808228 0.257164 18.840979 0.053453 0.812940 22.264105 14.351593 #S 20 Ca #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 8.593655 1.477324 1.436254 1.182839 7.113258 0.196255 10.460644 0.041891 81.390381 169.847839 0.688098 #S 20 Ca2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 8.501441 12.880483 9.765095 7.156669 0.711160 -21.013187 10.525848 -0.004033 0.010692 0.684443 27.231771 #S 21 Sc #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 1.476566 1.487278 1.600187 9.177463 7.099750 0.157765 53.131023 0.035325 137.319489 9.098031 0.602102 #S 21 Sc3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.104348 1.511488 -53.669773 38.404816 24.532240 0.118642 0.601957 0.033386 12.572138 10.859736 14.125230 #S 22 Ti #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 9.818524 1.522646 1.703101 1.768774 7.082555 0.102473 8.001879 0.029763 39.885422 120.157997 0.532405 #S 22 Ti2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.040119 1.496285 9.657304 0.006534 1.649561 0.150362 0.537072 0.031914 8.009958 201.800293 24.039482 #S 22 Ti3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 36.587933 7.230255 -9.086077 2.084594 17.294008 -35.111282 0.000681 0.522262 5.262317 15.881716 6.149805 #S 22 Ti4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 45.355537 7.092900 7.483858 -43.498817 1.678915 -0.110628 9.252186 0.523046 13.082852 10.193876 0.023064 #S 23 V #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 10.473575 1.547881 1.986381 1.865616 7.056250 0.067744 7.081940 0.026040 31.909672 108.022842 0.474882 #S 23 V2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.754356 2.064100 2.576998 2.011404 7.126177 -0.533379 7.066315 0.014993 7.066308 22.055786 0.467568 #S 23 V3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 9.958480 1.596350 1.483442 -10.846044 17.332867 0.474921 6.763041 0.056895 17.750029 0.328826 0.388013 #S 23 V5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.575018 8.448095 1.612040 -9.721855 1.534029 0.552676 0.682708 5.566640 10.527077 0.907961 0.066667 #S 24 Cr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.007069 1.555477 2.985293 1.347855 7.034779 0.065510 6.366281 0.023987 23.244839 105.774498 0.429369 #S 24 Cr2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 10.598877 1.565858 2.728280 0.098064 6.959321 0.049870 6.151846 0.023519 17.432816 54.002388 0.426301 #S 24 Cr3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.989310 1.765079 2.627125 1.829380 6.980908 -0.192123 6.068867 0.018342 6.068887 16.309284 0.420864 #S 25 Mn #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.709542 1.733414 2.673141 2.023368 7.003180 -0.147293 5.597120 0.017800 21.788420 89.517914 0.383054 #S 25 Mn2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.287712 26.042414 3.058096 0.090258 7.088306 -24.566132 5.506225 0.000774 16.158575 54.766354 0.375580 #S 25 Mn3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.926972 2.081342 11.128379 2.375107 -0.419287 -0.093713 0.378315 0.015054 5.379957 14.429586 0.004939 #S 25 Mn4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 12.409131 7.466993 1.809947 -12.138477 10.780248 0.672146 0.300400 0.112814 12.520756 0.168653 5.173237 #S 26 Fe #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 12.311098 1.876623 3.066177 2.070451 6.975185 -0.304931 5.009415 0.014461 18.743040 82.767876 0.346506 #S 26 Fe2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.776765 11.165097 3.533495 0.165345 7.036932 -9.676919 4.912232 0.001748 14.166556 42.381958 0.341324 #S 26 Fe3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 9.721638 63.403847 2.141347 2.629274 7.033846 -61.930725 4.869297 0.000293 4.867602 13.539076 0.338520 #S 27 Co #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 12.914510 2.481908 3.466894 2.106351 6.960892 -0.936572 4.507138 0.009126 16.438129 76.987320 0.314418 #S 27 Co2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.993840 26.285812 12.254289 0.246114 4.017407 -24.796852 0.310779 0.000684 4.400528 35.741447 12.536393 #S 27 Co3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.861739 2.678570 12.281889 3.501741 -0.179384 -1.147345 0.309794 0.008142 4.331703 11.914167 11.914167 #S 28 Ni #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 13.521865 6.947285 3.866028 2.135900 4.284731 -2.762697 4.077277 0.286763 14.622634 71.966080 0.004437 #S 28 Ni2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 12.519017 37.832058 4.387257 0.661552 6.949072 -36.344471 3.933053 0.000442 10.449184 23.860998 0.283723 #S 28 Ni3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 13.579366 1.902844 12.859268 3.811005 -6.838595 -0.317618 0.313140 0.012621 3.906407 10.894311 0.344379 #S 29 Cu #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 14.014192 4.784577 5.056806 1.457971 6.932996 -3.254477 3.738280 0.003744 13.034982 72.554794 0.265666 #S 29 Cu1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 12.960763 16.342150 1.110102 5.520682 6.915452 -14.849320 3.576010 0.000975 29.523218 10.114283 0.261326 #S 29 Cu2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 11.895569 16.344978 5.799817 1.048804 6.789088 -14.878383 3.378519 0.000924 8.133653 20.526524 0.254741 #S 30 Zn #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 14.741002 6.907748 4.642337 2.191766 38.424042 -36.915829 3.388232 0.243315 11.903689 63.312130 0.000397 #S 30 Zn2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 13.340772 10.428857 5.544489 0.762295 6.869172 -8.945248 3.215913 0.001413 8.542680 21.891756 0.239215 #S 31 Ga #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.758946 6.841123 4.121016 2.714681 2.395246 -0.847395 3.121754 0.226057 12.482196 66.203621 0.007238 #S 31 Ga3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 13.123875 35.288189 6.126979 0.611551 6.724807 -33.875122 2.809960 0.000323 6.831534 16.784311 0.212002 #S 32 Ge #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.540613 1.567900 3.727829 3.345098 6.785079 0.018726 2.866618 0.012198 13.432163 58.866047 0.210974 #S 32 Ge4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.876636 6.779091 9.969591 3.135857 0.152389 1.086542 2.025174 0.176650 3.573822 7.685848 16.677574 #S 33 As #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.025642 4.503441 3.715904 3.937200 6.790175 -2.984117 2.597739 0.003012 14.272119 50.437996 0.193015 #S 34 Se #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.354071 4.653248 4.259489 4.136455 6.749163 -3.160982 2.349787 0.002550 15.579460 45.181202 0.177432 #S 35 Br #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.550570 5.411882 3.937180 3.880645 6.707793 -2.492088 2.119226 16.557184 0.002481 42.164009 0.162121 #S 35 Br1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.714310 6.466926 6.947385 4.402674 -0.697279 1.152674 2.122554 19.050768 0.152708 58.690361 58.690372 #S 36 Kr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.655279 6.848105 4.171004 3.446760 6.685200 -2.810592 1.908231 16.606236 0.001598 39.917473 0.146896 #S 37 Rb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 8.123134 2.138042 6.761702 1.156051 17.679546 1.139548 15.142385 33.542667 0.129372 224.132507 1.713368 #S 37 Rb1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.684320 7.761588 6.680874 2.668883 0.070974 1.133263 1.710209 14.919863 0.128542 31.654478 0.128543 #S 38 Sr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.730219 9.795867 6.099763 2.620025 0.600053 1.140251 1.563060 14.310868 0.120574 135.771317 0.120574 #S 38 Sr2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.694973 1.275762 6.154252 9.234786 0.515995 1.125309 1.550888 30.133041 0.118774 13.821799 0.118774 #S 39 Y #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.792040 10.253252 5.714949 3.170516 0.918251 1.131787 1.429691 13.132816 0.112173 108.197029 0.112173 #S 40 Zr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.859772 10.911038 5.821115 3.512513 0.746965 1.124859 1.310692 12.319285 0.104353 91.777542 0.104353 #S 40 Zr4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.802956 17.699253 10.650647 -0.248108 0.250338 0.827902 0.096228 1.296127 11.240715 -0.219259 -0.219021 #S 41 Nb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.958399 12.063054 5.007015 3.287667 1.531019 1.123452 1.211590 12.246687 0.098615 75.011948 0.098615 #S 41 Nb3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.714323 1.675213 7.483963 8.322464 11.143573 -8.339573 1.172419 30.102791 0.080255 -0.002983 10.456687 #S 41 Nb5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.580206 7.633277 10.793497 0.180884 67.837921 -68.024780 1.165852 0.078558 9.507652 31.621656 -0.000438 #S 42 Mo #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.236218 17.987711 12.973127 3.451426 0.210899 1.108770 0.090780 1.108310 11.468720 66.684151 0.090780 #S 42 Mo3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.447050 17.778122 11.886068 1.997905 1.789626 -1.898764 0.072000 1.073145 9.834720 28.221746 -0.011674 #S 42 Mo5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 7.929879 17.667669 11.515987 0.500402 77.444084 -78.056595 0.068856 1.068064 9.046229 26.558945 -0.000473 #S 42 Mo6+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 34.757683 9.653037 6.584769 -18.628115 2.490594 1.141916 1.301770 7.123843 0.094097 1.617443 12.335434 #S 43 Tc #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.840963 3.428236 1.373012 12.947364 6.335469 1.074784 1.005729 41.901382 119.320541 9.781542 0.083391 #S 44 Ru #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.271624 17.906738 14.123269 3.746008 0.908235 1.043992 0.077040 0.928222 9.555345 35.860680 123.552246 #S 44 Ru3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.894758 13.579529 10.729251 2.474095 48.227997 -51.905243 0.902827 8.740579 0.045125 24.764954 -0.001699 #S 44 Ru4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.845776 13.455084 10.229087 1.653524 14.059795 -17.241762 0.901070 8.482392 0.045972 23.015272 -0.004889 #S 45 Rh #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.216648 17.919739 3.854252 0.840326 15.173498 0.995452 0.070789 0.856121 33.889484 121.686691 9.029517 #S 45 Rh3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.758621 14.569813 5.298320 2.533579 0.879753 0.960843 0.841779 8.319533 0.069050 23.709131 0.069050 #S 45 Rh4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.716188 14.446654 5.185801 1.703448 0.989992 0.959941 0.840572 8.100647 0.068995 22.357307 0.068995 #S 46 Pd #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.121511 4.784063 16.631683 4.318258 13.246773 0.883099 0.062549 0.784031 8.751391 34.489983 0.784031 #S 46 Pd2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.122282 15.651012 3.513508 9.060790 8.771199 0.879336 0.062424 8.018296 24.784275 0.776457 0.776457 #S 46 Pd4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.152421 -96.069023 31.622141 81.578255 17.801403 0.915874 0.063951 11.090354 13.466152 9.758302 0.783014 #S 47 Ag #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.073874 17.155437 4.173344 0.852238 17.988686 0.756603 0.055333 7.896512 28.443739 110.376106 0.716809 #S 47 Ag1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.091192 4.019526 16.948174 4.258638 13.889437 0.785127 0.056305 0.719340 7.758938 27.368349 0.719340 #S 47 Ag2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.401808 48.699802 4.799859 -32.332523 16.356710 1.068247 0.068167 0.942270 20.639496 1.100365 6.883131 #S 48 Cd #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.080986 18.019468 4.018197 1.303510 17.974669 0.603504 0.048990 7.273646 29.119284 95.831207 0.661231 #S 48 Cd2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.093711 43.909691 17.041306 -39.675117 17.958918 0.664795 0.050624 8.654143 15.621396 11.082067 0.667591 #S 49 In #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.196477 18.816183 4.050479 1.638929 17.962912 0.333097 0.042072 6.695665 31.009790 103.284348 0.610714 #S 49 In3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.206277 18.497746 3.078131 10.524613 7.401234 0.293677 0.041357 6.605563 18.792250 0.608082 0.608082 #S 50 Sn #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.325171 6.281571 4.498866 1.856934 17.917318 0.119024 6.118104 0.036915 32.529045 95.037186 0.565651 #S 50 Sn2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.353672 4.770377 14.672025 4.235959 18.002131 -0.042519 0.034720 6.167891 6.167879 29.006456 0.561774 #S 50 Sn4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.445732 6.420892 4.562980 1.713385 18.033537 -0.172219 6.280898 0.033144 6.280899 17.983601 0.557980 #S 51 Sb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 5.394956 6.549570 19.650681 1.827820 17.867832 -0.290506 33.326523 0.030974 5.564929 87.130966 0.523992 #S 51 Sb3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 10.189171 57.461918 19.356573 4.862206 -45.394096 1.516108 0.089485 0.375256 5.357987 22.153736 0.297768 #S 51 Sb5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.920622 6.647932 12.724075 1.555545 7.600591 -0.445371 0.522315 0.029487 5.718210 16.433775 5.718204 #S 52 Te #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 6.660302 6.940756 19.847015 1.557175 17.802427 -0.806668 33.031654 0.025750 5.065547 84.101616 0.487660 #S 53 I #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.884502 6.736593 8.110516 1.170953 17.548716 -0.448811 4.628591 0.027754 31.849096 84.406387 0.463550 #S 53 I1- #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 20.010330 17.835524 8.104130 2.231118 9.158548 -3.341004 4.565931 0.444266 32.430672 95.149040 0.014906 #S 54 Xe #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.978920 11.774945 9.332182 1.244749 17.737501 -6.065902 4.143356 0.010142 28.796200 75.280685 0.413616 #S 55 Cs #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.418674 8.314444 10.323193 1.383834 19.876251 -2.322802 0.399828 0.016872 25.605827 233.339676 3.826915 #S 55 Cs1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.939056 24.967621 10.375884 0.454243 17.660248 -19.394306 3.770511 0.004040 25.311275 76.537766 0.384730 #S 56 Ba #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.747343 17.368477 10.465718 2.592602 11.003653 -5.183497 3.481823 0.371224 21.226641 173.834274 0.010719 #S 56 Ba2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.750200 17.513683 10.884892 0.321585 65.149834 -59.618172 3.430748 0.361590 21.358307 70.309402 0.001418 #S 57 La #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.966019 27.329655 11.018425 3.086696 17.335455 -21.745489 3.197408 0.003446 19.955492 141.381973 0.341817 #S 57 La3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 19.688887 17.345703 11.356296 0.099418 82.358124 -76.846909 3.146211 0.339586 18.753832 90.345459 0.001072 #S 58 Ce #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.355122 43.988499 20.546650 3.130670 11.353665 -38.386017 0.328369 0.002047 3.088196 134.907654 18.832960 #S 58 Ce3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 26.593231 85.866432 -6.677695 12.111847 17.401903 -80.313423 3.280381 0.001012 4.313575 17.868504 0.326962 #S 58 Ce4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.457533 25.659941 11.691037 19.695251 -16.994749 -3.515096 0.311812 -0.003793 16.568687 2.886395 -0.008931 #S 59 Pr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 21.551311 17.161730 11.903859 2.679103 9.564197 -3.871068 2.995675 0.312491 17.716705 152.192825 0.010468 #S 59 Pr3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 20.879841 36.035797 12.135341 0.283103 17.167803 -30.500784 2.870897 0.002364 16.615236 53.909359 0.306993 #S 59 Pr4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.496082 21.538509 20.403114 12.062211 -7.492043 -9.016722 0.294457 -0.002742 2.772886 15.804613 -0.013556 #S 60 Nd #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.331244 62.783924 12.160097 2.663483 22.239950 -57.189842 0.300269 0.001320 17.026001 148.748993 2.910268 #S 60 Nd3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.120077 56.038139 21.468307 10.000671 2.905866 -50.541992 0.291295 0.001421 2.743681 14.581367 22.485098 #S 61 Pm #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.286388 51.560162 12.478557 2.675515 22.960947 -45.973682 0.286620 0.001550 16.223755 143.984512 2.796480 #S 61 Pm3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 22.221066 17.068142 12.805423 0.435687 52.238770 -46.767181 2.635767 0.277039 14.927315 45.768017 0.001455 #S 62 Sm #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 23.700363 23.072214 12.777782 2.684217 17.204367 -17.452166 2.689539 0.003491 15.495437 139.862473 0.274536 #S 62 Sm3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.618565 19.538092 13.398946 -4.358811 24.490461 -9.714854 0.006001 0.306379 14.979594 0.748825 2.454492 #S 63 Eu #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.186195 37.156837 13.103387 2.707246 24.419271 -31.586687 0.261678 0.001995 14.787360 134.816299 2.581883 #S 63 Eu2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 23.899035 31.657497 12.955752 1.700576 16.992199 -26.204315 2.467332 0.002230 13.625002 35.089481 0.253136 #S 63 Eu3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.758327 33.498665 24.067188 13.436883 -9.019134 -19.768026 0.244474 -0.003901 2.487526 14.568011 -0.015628 #S 64 Gd #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 24.898117 17.104952 13.222581 3.266152 48.995213 -43.505684 2.435028 0.246961 13.996325 110.863091 0.001383 #S 64 Gd3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 24.344999 16.945311 13.866931 0.481674 93.506378 -88.147179 2.333971 0.239215 12.982995 43.876347 0.000673 #S 65 Tb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 25.910013 32.344139 13.765117 2.751404 17.064405 -26.851971 2.373912 0.002034 13.481969 125.836510 0.236916 #S 65 Tb3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 24.878252 16.856016 13.663937 1.279671 39.271294 -33.950317 2.223301 0.227290 11.812528 29.910065 0.001527 #S 66 Dy #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 26.671785 88.687576 14.065445 2.768497 17.067781 -83.279831 2.282593 0.000665 12.920230 121.937187 0.225531 #S 66 Dy3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.864344 90.383461 13.675473 1.687078 25.540651 -85.150650 0.216275 0.000593 11.121207 26.250975 2.135930 #S 67 Ho #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 27.150190 16.999819 14.059334 3.386979 46.546471 -41.165253 2.169660 0.215414 12.213148 100.506783 0.001211 #S 67 Ho3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.837524 63.221336 13.703766 2.061602 26.202621 -58.026505 0.206873 0.000796 10.500283 24.031883 2.055060 #S 68 Er #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.174887 82.493271 14.624002 2.802756 17.018515 -77.135223 2.120995 0.000640 11.915256 114.529938 0.207519 #S 68 Er3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.810127 22.681061 13.864114 2.294506 26.864477 -17.513460 0.198293 0.002126 9.973341 22.836388 1.979442 #S 69 Tm #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.925894 76.173798 14.904704 2.814812 16.998117 -70.839813 2.046203 0.000656 11.465375 111.411980 0.199376 #S 69 Tm3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.787500 15.350905 14.182357 2.299111 27.573771 -10.192087 0.190852 0.003036 9.602934 22.526880 1.912862 #S 70 Yb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 29.676760 65.624069 15.160854 2.830288 16.997850 -60.313812 1.977630 0.000720 11.044622 108.139153 0.192110 #S 70 Yb2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.443794 16.849527 14.165081 3.445311 28.308853 -23.214935 1.863896 0.183811 9.225469 23.691355 0.001463 #S 70 Yb3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.191629 16.828087 14.167848 2.744962 23.171774 -18.103676 1.842889 0.182788 9.045957 20.799847 0.001759 #S 71 Lu #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 30.122866 15.099346 56.314899 3.540980 16.943729 -51.049416 1.883090 10.342764 0.000780 89.559250 0.183849 #S 71 Lu3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.828693 16.823227 14.247617 3.079559 25.647667 -20.626528 1.776641 0.175560 8.575531 19.693701 0.001453 #S 72 Hf #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 30.617033 15.145351 54.933548 4.096253 16.896156 -49.719837 1.795613 9.934469 0.000739 76.189705 0.175914 #S 72 Hf4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 29.267378 16.792543 14.785310 2.184128 23.791996 -18.820383 1.697911 0.168313 8.190025 18.277578 0.001431 #S 73 Ta #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.066359 15.341823 49.278297 4.577665 16.828321 -44.119026 1.708732 9.618455 0.000760 66.346199 0.168002 #S 73 Ta5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 29.539469 16.741854 15.182070 1.642916 16.437447 -11.542459 1.612934 0.160460 7.654408 17.070732 0.001858 #S 74 W #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.507900 15.682498 37.960129 4.885509 16.792112 -32.864574 1.629485 9.446448 0.000898 59.980675 0.160798 #S 74 W6+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 29.729357 17.247808 15.184488 1.154652 0.739335 3.945157 1.501648 0.140803 6.880573 14.299601 14.299618 #S 75 Re #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.888456 16.117104 42.390297 5.211669 16.767591 -37.412682 1.549238 9.233474 0.000689 54.516373 0.152815 #S 76 Os #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.210297 16.678440 48.559906 5.455839 16.735533 -43.677956 1.473531 9.049695 0.000519 50.210201 0.145771 #S 76 Os4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 17.113485 15.792370 23.342392 4.090271 7.671292 3.988390 0.131850 7.288542 1.389307 19.629425 1.389307 #S 77 Ir #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.004436 1.975454 17.070105 15.939454 5.990003 4.018893 1.353767 81.014175 0.128093 7.661196 26.659403 #S 77 Ir3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.537575 16.363338 15.597141 5.051404 1.436935 4.009459 1.334144 7.451918 0.127514 21.705648 0.127515 #S 77 Ir4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 30.391249 16.146996 17.019068 4.458904 0.975372 4.006865 1.328519 7.181766 0.127337 19.060146 1.328519 #S 78 Pt #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.273891 18.445440 17.063745 5.555933 1.575270 4.050394 1.316992 8.797154 0.124741 40.177994 1.316997 #S 78 Pt2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.986849 17.249048 15.269374 5.760234 1.694079 4.032512 1.281143 7.625512 0.123571 24.190826 0.123571 #S 78 Pt4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 41.932713 16.339224 17.653894 6.012420 -12.036877 4.094551 1.111409 6.466086 0.128917 16.954155 0.778721 #S 79 Au #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.777390 19.317156 32.979683 5.595453 10.576854 -6.279078 0.122737 8.621570 1.256902 38.008820 0.000601 #S 79 Au1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.124306 16.716476 16.814100 7.311565 0.993064 4.040792 1.216073 7.165378 0.118715 20.442486 53.095985 #S 79 Au3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 31.704271 17.545767 16.819551 5.522640 0.361725 4.042679 1.215561 7.220506 0.118812 20.050970 1.215562 #S 80 Hg #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.839890 20.023823 28.428564 5.881564 4.714706 4.076478 0.115905 8.256927 1.195250 39.247227 1.195250 #S 80 Hg1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 28.866837 19.277540 16.776051 6.281459 3.710289 4.068430 1.173967 7.583842 0.115351 29.055994 1.173968 #S 80 Hg2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.411079 18.690371 16.711773 9.974835 -3.847611 4.052869 1.162980 7.329806 0.114518 22.009489 22.009493 #S 81 Tl #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.630795 19.386616 32.808571 1.747191 6.356862 4.066939 0.110704 7.181401 1.119730 90.660263 26.014978 #S 81 Tl1+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.295044 16.570049 17.991013 1.535355 7.554591 4.054030 1.101544 0.110020 6.528559 52.495068 20.338634 #S 81 Tl3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.525639 19.139185 17.100321 5.891115 12.599463 -9.256075 1.094966 6.900992 0.103667 18.489614 -0.001401 #S 82 Pb #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.419567 32.738590 6.530247 2.342742 19.916475 4.049824 0.105499 1.055049 25.025890 80.906593 6.664449 #S 82 Pb2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 27.392647 16.496822 19.984501 6.813923 5.233910 4.065623 1.058874 0.106305 6.708123 24.395554 1.058874 #S 82 Pb4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.505657 20.014240 14.645661 5.029499 1.760138 4.044678 1.047035 6.670321 0.105279 16.525040 0.105279 #S 83 Bi #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.282274 32.725136 6.678302 2.694750 20.576559 4.040914 0.101180 1.002287 25.714146 77.057549 6.291882 #S 83 Bi3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.461437 19.438683 16.302486 7.322662 0.431704 4.043703 0.997930 6.038867 0.101338 18.371586 46.361046 #S 83 Bi5+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.734028 20.580494 9.452623 61.155834 -34.041023 4.113663 0.105076 4.773282 11.762162 1.211775 1.619408 #S 84 Po #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.289164 32.807171 21.095163 2.505901 7.254589 4.046556 0.098121 0.966265 6.046622 76.598068 28.096128 #S 85 At #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.011461 32.615547 8.113899 2.884082 21.377867 3.995684 0.092639 0.904416 26.543257 68.372963 5.499512 #S 86 Rn #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.070229 32.641106 21.489658 2.299218 9.480184 4.020977 0.090437 0.876409 5.239687 69.188477 27.632641 #S 87 Fr #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 16.007385 32.663830 21.594351 1.598497 11.121192 4.003472 0.087031 0.840187 4.954467 199.805801 26.905106 #S 88 Ra #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.563690 21.396671 11.298093 2.834688 15.914965 3.981773 0.801980 4.590666 22.758972 160.404388 0.083544 #S 88 Ra2+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 4.986228 32.474945 21.947443 11.800013 10.807292 3.956572 0.082597 0.791468 4.608034 24.792431 0.082597 #S 89 Ac #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.914053 32.535042 21.553976 11.433394 3.612409 3.939212 0.080511 0.770669 4.352206 21.381622 130.500748 #S 89 Ac3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.584983 32.022125 21.456327 0.757593 12.341252 3.838984 0.077438 0.739963 4.040735 47.525002 19.406845 #S 90 Th #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.784024 32.454899 21.849222 4.239077 11.736191 3.922533 0.077067 0.735137 4.097976 109.464111 20.512138 #S 90 Th4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.515445 32.090691 13.996399 12.918157 7.635514 3.831122 0.074499 0.711663 3.871044 18.596891 3.871044 #S 91 Pa #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.740208 21.973675 12.957398 3.683832 15.744058 3.886066 0.709545 4.050881 19.231543 117.255005 0.074040 #S 92 U #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.679275 32.824306 13.660459 3.687261 22.279434 3.854444 0.071206 0.681177 18.236156 112.500038 3.930325 #S 92 U3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.360309 32.395657 21.961290 1.325894 14.251453 3.706622 0.067815 0.654643 3.643409 39.604965 16.330570 #S 92 U4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.355091 32.235306 0.557745 14.396367 21.751173 3.705863 0.067789 0.652613 42.354237 15.908239 3.553231 #S 92 U6+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.333844 31.770849 21.274414 13.872636 0.048519 3.700591 0.067644 0.646384 3.317894 14.650250 75.339699 #S 93 Np #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 32.999901 22.638077 14.219973 3.672950 15.683245 3.769391 0.657086 3.854918 17.435474 109.464485 0.068033 #S 93 Np3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.378152 32.572132 22.206125 1.413295 14.828381 3.603370 0.064613 0.631420 3.561936 37.875511 15.546129 #S 93 Np4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.373926 32.423019 21.969994 0.662078 14.969350 3.603039 0.064597 0.629658 3.476389 39.438942 15.135764 #S 93 Np6+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.359986 31.992825 21.412458 0.066574 14.568174 3.600942 0.064528 0.624505 3.253441 67.658318 13.980832 #S 94 Pu #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 33.281178 23.148544 15.153755 3.031492 15.704215 3.664200 0.634999 3.856168 16.849735 121.292038 0.064857 #S 94 Pu3+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.356004 32.769127 22.680210 1.351055 15.416232 3.428895 0.060590 0.604663 3.491509 37.260635 14.981921 #S 94 Pu4+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.416219 32.610569 22.256662 0.719495 15.518152 3.480408 0.061456 0.607938 3.411848 37.628792 14.464360 #S 94 Pu6+ #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.436506 32.289719 14.726737 15.012391 7.024677 3.502325 0.061815 0.606541 3.245363 13.616438 3.245364 #S 95 Am #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 33.435162 23.657259 15.576339 3.027023 15.746100 3.541160 0.612785 3.792942 16.195778 117.757004 0.061755 #S 96 Cm #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.804837 33.480801 24.150198 3.655563 15.499866 3.390840 0.058619 0.590160 3.674720 100.736191 15.408296 #S 97 Bk #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 15.889072 33.625286 24.710381 3.707139 15.839268 3.213169 0.055503 0.569571 3.615472 97.694786 14.754303 #S 98 Cf #N 11 #L a1 a2 a3 a4 a5 c b1 b2 b3 b4 b5 33.794075 25.467693 16.048487 3.657525 16.008982 3.005326 0.550447 3.581973 14.357388 96.064972 0.052450 periodictable-1.5.0/periodictable/xsf/fe.nff000066400000000000000000000315121310514471200210160ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.37852 10.1617 -9999. 1.42961 10.3261 -9999. 1.48259 10.4931 -9999. 1.53754 10.6628 -9999. 1.59453 10.8353 -9999. 1.65362 11.0106 -9999. 1.71491 11.1886 -9999. 1.77847 11.3696 -9999. 1.84438 11.5535 -9999. 1.91274 11.7404 -9999. 1.97402 11.9303 -9999. 2.01044 12.1232 -9999. 2.04752 12.3193 -9999. 2.08529 12.5186 -9999. 2.12375 12.7210 -9999. 2.16292 12.9268 -9999. 2.20282 13.1359 -9999. 2.24345 13.3483 -9999. 2.28484 13.5642 -9999. 2.32698 13.7836 -9999. 2.36990 14.0066 -9999. 2.41362 14.2331 -9999. 2.45814 14.4633 -9999. 2.50348 14.6973 -9999. 2.54966 14.9350 -9999. 2.59669 15.1765 -9999. 2.64458 15.4220 -9999. 2.69337 15.6714 -9999. 2.73188 15.9249 -9999. 2.75688 16.1825 -9999. 2.78211 16.4442 -9999. 2.80756 16.7102 -9999. 2.83325 16.9805 -9999. 2.85918 17.2551 -9999. 2.88534 17.5342 -9999. 2.91174 17.8178 -9999. 2.93838 18.1060 -9999. 2.96261 18.3989 -9999. 2.97951 18.6964 -9999. 2.99650 18.9988 -9999. 3.01359 19.3061 -9999. 3.03078 19.6184 -9999. 3.04806 19.9357 -9999. 3.06544 20.2582 -9999. 3.08293 20.5858 -9999. 3.10051 20.9188 -9999. 3.11819 21.2571 -9999. 3.13597 21.6009 -9999. 3.15386 21.9503 -9999. 3.17184 22.3053 -9999. 3.18993 22.6661 -9999. 3.19901 23.0327 -9999. 3.20529 23.4053 -9999. 3.21159 23.7838 -9999. 3.21789 24.1685 -9999. 3.22421 24.5594 -9999. 3.23054 24.9566 -9999. 3.23689 25.3603 -9999. 3.24324 25.7705 -9999. 3.24961 26.1873 -9999. 3.25599 26.6109 -9999. 3.26239 27.0413 -9999. 3.26879 27.4786 -9999. 3.27521 27.9231 -9999. 3.28164 28.3747 -9999. 3.28184 28.8337 -9999. 3.26361 29.3000 4.56551 3.24547 29.7739 4.59674 3.22745 30.2555 4.62389 3.20951 30.7449 4.64752 3.19168 31.2421 4.66794 3.17395 31.7475 4.68534 3.15632 32.2609 4.69985 3.13878 32.7827 4.71157 3.12135 33.3130 4.72056 3.10401 33.8518 4.72726 3.08676 34.3993 4.73253 3.06821 34.9557 4.73284 3.04783 35.5211 4.72873 3.02759 36.0956 4.72057 3.00747 36.6794 4.70833 2.98750 37.2727 4.69185 2.96765 37.8755 4.67095 2.94794 38.4882 4.64540 2.92835 39.1107 4.61496 2.90891 39.7432 4.57945 2.88958 40.3861 4.53898 2.87039 41.0393 4.49519 2.85002 41.7031 4.44170 2.82162 42.3776 4.37564 2.79349 43.0630 4.29742 2.76565 43.7595 4.20634 2.73809 44.4673 4.10080 2.71079 45.1865 3.97865 2.68377 45.9174 3.83697 2.65703 46.6600 3.67191 2.63054 47.4147 3.47817 2.60433 48.1816 3.24835 2.57837 48.9609 2.97172 2.55267 49.7528 2.63237 2.52664 50.5576 2.19808 2.49588 51.3753 1.60564 2.46550 52.2062 0.746053 2.49950 53.0506 -0.823081 2.57469 53.9087 -3.48492 4.80517 54.7806 -2.28294 9.28509 55.6667 -0.253217 9.98238 56.5670 1.29776 10.4549 57.4820 2.40276 10.7076 58.4117 3.54172 10.9275 59.3564 4.53869 10.6850 60.3165 5.32958 10.4478 61.2921 6.03752 10.1122 62.2834 6.55392 9.71669 63.2908 6.93943 9.33663 64.3145 7.23531 8.97142 65.3547 7.45267 8.62050 66.4118 7.58608 8.28332 67.4859 7.58843 7.97015 68.5775 7.59044 7.86267 69.6867 7.64565 7.75663 70.8138 7.70968 7.65203 71.9591 7.76921 7.54883 73.1230 7.81595 7.44703 74.3057 7.83798 7.34660 75.5076 7.79781 7.28864 76.7289 7.80545 7.30616 77.9699 7.84188 7.32372 79.2310 7.89300 7.34133 80.5125 7.95279 7.35898 81.8147 8.01851 7.37667 83.1380 8.08850 7.39440 84.4827 8.16154 7.41218 85.8491 8.23668 7.43000 87.2377 8.31282 7.44786 88.6487 8.38740 7.46624 90.0825 8.46471 7.49275 91.5395 8.54659 7.51936 93.0201 8.63178 7.54607 94.5246 8.71938 7.57286 96.0535 8.80911 7.59976 97.6071 8.90086 7.62675 99.1858 8.99454 7.65383 100.790 9.09017 7.68101 102.420 9.18782 7.70829 104.077 9.28776 7.73567 105.760 9.39101 7.76314 107.471 9.49649 7.78722 109.209 9.60195 7.81049 110.975 9.70842 7.83383 112.770 9.81640 7.85724 114.594 9.92628 7.88073 116.448 10.0384 7.90428 118.331 10.1533 7.92791 120.245 10.2717 7.95160 122.190 10.3951 7.97537 124.166 10.5280 7.99921 126.175 10.6739 8.00625 128.215 10.8068 7.99853 130.289 10.9332 7.99083 132.397 11.0565 7.98313 134.538 11.1781 7.97544 136.714 11.2989 7.96776 138.925 11.4196 7.96008 141.172 11.5409 7.95241 143.456 11.6638 7.94475 145.776 11.7907 7.93710 148.134 11.9278 7.92106 150.530 12.0547 7.89217 152.964 12.1758 7.86339 155.439 12.2937 7.83471 157.953 12.4094 7.80615 160.507 12.5237 7.77768 163.103 12.6369 7.74932 165.742 12.7495 7.72106 168.422 12.8619 7.69290 171.146 12.9745 7.66485 173.915 13.0877 7.63690 176.727 13.2020 7.60905 179.586 13.3183 7.58130 182.491 13.4377 7.55366 185.442 13.5621 7.52611 188.442 13.6963 7.49867 191.489 13.8601 7.46087 194.587 14.0038 7.36866 197.734 14.1251 7.27760 200.932 14.2321 7.18766 204.182 14.3296 7.09884 207.485 14.4192 7.01111 210.840 14.5017 6.92446 214.251 14.5772 6.83889 217.716 14.6454 6.75437 221.237 14.7045 6.67090 224.816 14.7449 6.58963 228.452 14.7884 6.54414 232.147 14.8416 6.49896 235.902 14.9009 6.45410 239.717 14.9627 6.40954 243.595 15.0264 6.36529 247.535 15.0917 6.32135 251.538 15.1585 6.27771 255.607 15.2269 6.23437 259.741 15.2972 6.19133 263.942 15.3702 6.14859 268.211 15.4469 6.10615 272.549 15.5294 6.06399 276.957 15.6410 6.01084 281.437 15.7338 5.92255 285.989 15.8063 5.83556 290.615 15.8710 5.74984 295.315 15.9298 5.66539 300.092 15.9839 5.58217 304.945 16.0341 5.50018 309.878 16.0811 5.41940 314.890 16.1256 5.33979 319.983 16.1683 5.26136 325.158 16.2101 5.18408 330.418 16.2525 5.10794 335.762 16.3098 5.03291 341.192 16.3581 4.92380 346.711 16.3869 4.81616 352.319 16.4048 4.71086 358.017 16.4142 4.60787 363.808 16.4160 4.50713 369.692 16.4107 4.40859 375.672 16.3980 4.31221 381.748 16.3707 4.21793 387.922 16.3387 4.14490 394.197 16.3170 4.07954 400.573 16.3037 4.00915 407.052 16.2822 3.92917 413.635 16.2534 3.85080 420.326 16.2191 3.77398 427.124 16.1797 3.69870 434.032 16.1354 3.62491 441.052 16.0859 3.55260 448.186 16.0312 3.48174 455.435 15.9711 3.41228 462.802 15.9052 3.34421 470.287 15.8333 3.27750 477.894 15.7550 3.21212 485.623 15.6698 3.14804 493.478 15.5777 3.08503 501.459 15.4771 3.02269 509.570 15.3672 2.96160 517.812 15.2475 2.90175 526.187 15.1169 2.84310 534.698 14.9742 2.78564 543.346 14.8181 2.72935 552.134 14.6466 2.67418 561.065 14.4577 2.62014 570.139 14.2486 2.56719 579.361 14.0158 2.51530 588.732 13.7542 2.46447 598.254 13.4583 2.41999 607.930 13.1273 2.37973 617.763 12.7523 2.34017 627.755 12.3194 2.30104 637.908 11.8093 2.25957 648.226 11.1915 2.21452 658.711 10.4155 2.16757 669.365 9.39778 2.12164 680.191 7.96562 2.08255 691.193 5.65397 2.04874 702.372 -0.512550E-01 2.01713 706.700 -17.9878 2.00516 706.900 -17.9717 17.0241 713.733 2.56129 16.8005 725.277 7.51167 16.4340 737.008 10.0375 16.0756 748.928 11.7441 15.7252 761.042 13.0180 15.3828 773.351 14.0079 15.0480 785.859 14.7737 14.7261 798.570 15.2522 14.4327 811.486 15.7357 14.5066 824.611 16.3010 14.5809 837.949 16.9294 14.6555 851.502 17.6531 14.7305 865.274 18.4917 14.5915 879.269 19.1933 14.2652 893.491 19.7329 13.9465 907.943 20.2084 13.6347 922.628 20.6272 13.3297 937.551 21.0059 13.0418 952.715 21.3544 12.7630 968.124 21.6780 12.4928 983.783 21.9801 12.2280 999.695 22.2623 11.9685 1015.86 22.5278 11.7140 1032.29 22.7773 11.4617 1048.99 23.0123 11.2106 1065.96 23.2295 10.9604 1083.20 23.4294 10.7157 1100.72 23.6157 10.4765 1118.52 23.7895 10.2426 1136.61 23.9522 10.0139 1155. 24.1046 9.79036 1173.68 24.2478 9.57181 1192.66 24.3825 9.35813 1211.95 24.5096 9.14919 1231.55 24.6313 8.94492 1251.47 24.7468 8.74240 1271.72 24.8564 8.54142 1292.29 24.9571 8.34135 1313.19 25.0487 8.14613 1334.43 25.1338 7.95544 1356.01 25.2129 7.76913 1377.94 25.2865 7.58714 1400.23 25.3551 7.40943 1422.88 25.4192 7.23595 1445.89 25.4798 7.06656 1469.28 25.5369 6.90047 1493.04 25.5920 6.73728 1517.19 25.6426 6.57391 1541.73 25.6872 6.41399 1566.67 25.7275 6.25803 1592.01 25.7642 6.10583 1617.76 25.7977 5.95731 1643.92 25.8282 5.81239 1670.51 25.8563 5.67104 1697.53 25.8823 5.53311 1724.99 25.9076 5.39847 1752.89 25.9308 5.26344 1781.24 25.9507 5.13051 1810.05 25.9667 4.99990 1839.32 25.9797 4.87266 1869.07 25.9902 4.74866 1899.30 25.9985 4.62785 1930.02 26.0049 4.51012 1961.24 26.0098 4.39537 1992.96 26.0124 4.28350 2025.20 26.0153 4.17638 2057.95 26.0175 4.06827 2091.24 26.0174 3.96272 2125.06 26.0155 3.85956 2159.43 26.0122 3.75885 2194.36 26.0074 3.66043 2229.85 26.0014 3.56442 2265.92 25.9942 3.47073 2302.57 25.9860 3.37928 2339.81 25.9766 3.28988 2377.66 25.9662 3.20281 2416.11 25.9549 3.11785 2455.19 25.9428 3.03494 2494.90 25.9299 2.95409 2535.26 25.9162 2.87525 2576.26 25.9018 2.79837 2617.93 25.8866 2.72340 2660.27 25.8709 2.65034 2703.30 25.8546 2.57909 2747.03 25.8377 2.50966 2791.46 25.8202 2.44201 2836.61 25.8023 2.37611 2882.49 25.7839 2.31186 2929.11 25.7650 2.24928 2976.48 25.7457 2.18831 3024.63 25.7260 2.12895 3073.55 25.7059 2.07110 3123.26 25.6855 2.01476 3173.78 25.6647 1.95990 3225.11 25.6436 1.90650 3277.27 25.6221 1.85449 3330.28 25.6003 1.80385 3384.15 25.5782 1.75456 3438.88 25.5559 1.70657 3494.50 25.5332 1.65983 3551.02 25.5102 1.61438 3608.46 25.4869 1.57013 3666.82 25.4632 1.52704 3726.13 25.4393 1.48515 3786.40 25.4151 1.44434 3847.64 25.3905 1.40465 3909.87 25.3655 1.36603 3973.11 25.3402 1.32847 4037.38 25.3145 1.29190 4102.68 25.2884 1.25636 4169.03 25.2619 1.22173 4236.46 25.2348 1.18809 4304.98 25.2073 1.15533 4374.62 25.1792 1.12346 4445.37 25.1505 1.09249 4517.27 25.1211 1.06239 4590.33 25.0910 1.03305 4664.58 25.0601 1.00457 4740.03 25.0283 0.976873 4816.69 24.9955 0.949891 4894.60 24.9617 0.923701 4973.77 24.9266 0.898161 5054.21 24.8902 0.873392 5135.96 24.8522 0.849294 5219.03 24.8126 0.825838 5303.44 24.7710 0.803057 5389.22 24.7271 0.780872 5476.39 24.6808 0.759346 5564.97 24.6315 0.738385 5654.98 24.5789 0.718011 5746.44 24.5222 0.698203 5839.39 24.4609 0.678946 5933.83 24.3940 0.660221 6029.81 24.3204 0.642017 6127.33 24.2384 0.624321 6226.44 24.1460 0.607117 6327.15 24.0402 0.590390 6429.48 23.9168 0.574125 6533.48 23.7691 0.558319 6639.15 23.5861 0.542948 6746.54 23.3481 0.528004 6855.65 23.0124 0.513483 6966.54 22.4591 0.499359 7079.22 20.9344 0.485638 7111.90 14.7513 0.481770 7112.10 14.7518 3.85592 7193.72 22.0197 3.79269 7310.07 23.0311 3.70552 7428.31 23.5788 3.61951 7548.45 23.9595 3.53462 7670.54 24.2518 3.45114 7794.61 24.4888 3.36893 7920.68 24.6873 3.28802 8048.79 24.8575 3.20844 8178.98 25.0058 3.13021 8311.26 25.1364 3.05334 8445.69 25.2527 2.97792 8582.29 25.3569 2.90374 8721.11 25.4507 2.83104 8862.16 25.5355 2.75967 9005.50 25.6126 2.68982 9151.16 25.6829 2.62115 9299.17 25.7468 2.55398 9449.58 25.8054 2.48817 9602.42 25.8590 2.42376 9757.73 25.9081 2.36063 9915.55 25.9532 2.29898 10075.9 25.9946 2.23854 10238.9 26.0325 2.17943 10404.5 26.0673 2.12163 10572.8 26.0992 2.06511 10743.8 26.1284 2.00987 10917.6 26.1552 1.95589 11094.2 26.1797 1.90315 11273.6 26.2020 1.85164 11455.9 26.2224 1.80133 11641.2 26.2410 1.75222 11829.5 26.2578 1.70428 12020.8 26.2730 1.65749 12215.3 26.2868 1.61183 12412.8 26.2992 1.56728 12613.6 26.3103 1.52383 12817.6 26.3202 1.48146 13025.0 26.3289 1.44014 13235.6 26.3366 1.39985 13449.7 26.3433 1.36058 13667.2 26.3491 1.32231 13888.3 26.3540 1.28501 14112.9 26.3582 1.24866 14341.2 26.3616 1.21326 14573.1 26.3642 1.17877 14808.9 26.3663 1.14518 15048.4 26.3677 1.11246 15291.8 26.3685 1.08061 15539.1 26.3689 1.04960 15790.4 26.3687 1.01941 16045.8 26.3681 0.990019 16305.4 26.3670 0.961418 16569.1 26.3655 0.933585 16837.1 26.3637 0.906501 17109.4 26.3616 0.880150 17386.1 26.3591 0.854515 17667.4 26.3563 0.829578 17953.1 26.3533 0.805322 18243.5 26.3500 0.781732 18538.6 26.3465 0.758791 18838.4 26.3428 0.736483 19143.1 26.3389 0.714793 19452.7 26.3348 0.693706 19767.4 26.3305 0.673206 20087.1 26.3261 0.653279 20412.0 26.3216 0.633910 20742.1 26.3170 0.615086 21077.6 26.3123 0.596791 21418.5 26.3075 0.579014 21765.0 26.3026 0.561739 22117.0 26.2976 0.544955 22474.7 26.2926 0.528649 22838.2 26.2875 0.512808 23207.6 26.2824 0.497420 23583.0 26.2772 0.482472 23964.4 26.2720 0.467954 24352.0 26.2668 0.453854 24745.9 26.2616 0.440160 25146.2 26.2564 0.426862 25552.9 26.2512 0.413949 25966.2 26.2460 0.401411 26386.1 26.2408 0.389237 26812.9 26.2356 0.377418 27246.6 26.2304 0.365944 27687.3 26.2253 0.354805 28135.1 26.2202 0.343992 28590.2 26.2151 0.333497 29052.6 26.2100 0.323310 29522.5 26.2050 0.313422 30000.0 26.2000 0.303827 periodictable-1.5.0/periodictable/xsf/fr.nff000066400000000000000000000321521310514471200210340ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.504421E-01 10.1617 -9999. 0.605877E-01 10.3261 -9999. 0.727738E-01 10.4931 -9999. 0.893847E-01 10.6628 -9999. 0.117123 10.8353 -9999. 0.153468 11.0106 -9999. 0.201091 11.1886 -9999. 0.263493 11.3696 -9999. 0.403215 11.5535 -9999. 0.637593 11.7404 -9999. 1.00820 11.9303 -9999. 1.59425 12.1232 -9999. 2.49402 12.3193 -9999. 3.36797 12.5186 -9999. 4.54817 12.7210 -9999. 6.14193 12.9268 -9999. 6.92048 13.1359 -9999. 7.24654 13.3483 -9999. 7.58796 13.5642 -9999. 7.88271 13.7836 -9999. 8.17329 14.0066 -9999. 8.47458 14.2331 -9999. 8.76458 14.4633 -9999. 8.92935 14.6973 -9999. 9.09722 14.9350 -9999. 9.26824 15.1765 -9999. 9.44249 15.4220 -9999. 9.62001 15.6714 -9999. 9.74189 15.9249 -9999. 9.83268 16.1825 -9999. 9.92431 16.4442 -9999. 10.0168 16.7102 -9999. 10.1101 16.9805 -9999. 10.2043 17.2551 -9999. 10.3012 17.5342 -9999. 10.4303 17.8178 -9999. 10.5610 18.1060 -9999. 10.6933 18.3989 -9999. 10.8272 18.6964 -9999. 10.9268 18.9988 -9999. 10.9941 19.3061 -9999. 11.0620 19.6184 -9999. 11.1302 19.9357 -9999. 11.1988 20.2582 -9999. 11.2458 20.5858 -9999. 11.2666 20.9188 -9999. 11.2875 21.2571 -9999. 11.3085 21.6009 -9999. 11.3294 21.9503 -9999. 11.3504 22.3053 -9999. 11.2709 22.6661 -9999. 11.1410 23.0327 -9999. 11.0127 23.4053 -9999. 10.8858 23.7838 -9999. 10.7603 24.1685 -9999. 10.6363 24.5594 -9999. 10.3907 24.9566 -9999. 10.1364 25.3603 -9999. 9.88839 25.7705 -9999. 9.64642 26.1873 -9999. 9.41037 26.6109 -9999. 9.18010 27.0413 -9999. 8.95545 27.4786 -9999. 8.73631 27.9231 -9999. 8.36961 28.3747 -9999. 8.01786 28.8337 -9999. 7.68089 29.3000 8.20151 7.35808 29.7739 8.23441 7.04884 30.2555 8.24724 6.75259 30.7449 8.24326 6.46880 31.2421 8.22521 6.19693 31.7475 8.19569 5.93649 32.2609 8.15753 5.68699 32.7827 8.11852 5.44798 33.3130 8.09379 5.21574 33.8518 8.04513 4.92411 34.3993 7.95254 4.64877 34.9557 7.83510 4.38884 35.5211 7.69907 4.14344 36.0956 7.54766 3.91176 36.6794 7.38289 3.69303 37.2727 7.20616 3.48654 37.8755 7.01849 3.29159 38.4882 6.82067 3.10754 39.1107 6.61351 2.93378 39.7432 6.39861 2.76918 40.3861 6.17244 2.60801 41.0393 5.93336 2.45622 41.7031 5.68251 2.31327 42.3776 5.42014 2.17863 43.0630 5.14591 2.05184 43.7595 4.85917 1.93242 44.4673 4.55899 1.81995 45.1865 4.24399 1.71403 45.9174 3.91179 1.61427 46.6600 3.55697 1.52420 47.4147 3.18975 1.45074 48.1816 2.80584 1.38083 48.9609 2.39436 1.32098 49.7528 1.96878 1.27596 50.5576 1.51783 1.23537 51.3753 1.04624 1.21125 52.2062 0.548511 1.18759 53.0506 0.670946E-02 1.17509 53.9087 -0.561414 1.17949 54.7806 -1.17372 1.18619 55.6667 -1.83459 1.20744 56.5670 -2.56196 1.22906 57.4820 -3.37803 1.28161 58.4117 -4.28019 1.35180 59.3564 -5.34996 1.44648 60.3165 -6.58169 1.67507 61.2921 -7.95180 2.20927 62.2834 -9.30353 2.82885 63.2908 -10.7475 3.62220 64.3145 -12.2909 4.63807 65.3547 -13.9294 5.93880 66.4118 -15.6401 7.60433 67.4859 -17.4392 9.73701 68.5775 -19.3935 13.0209 69.6867 -18.9220 16.9540 70.8138 -18.4113 20.1567 71.9591 -17.4802 23.1402 73.1230 -15.6951 26.0543 74.3057 -14.0159 27.7573 75.5076 -12.4719 29.5716 76.7289 -10.4841 31.2632 77.9699 -8.74043 32.3030 79.2310 -7.21406 33.3775 80.5125 -5.65142 34.4876 81.8147 -3.93848 35.4116 83.1380 -2.35099 36.2088 84.4827 -0.785691 37.0239 85.8491 0.916632 37.8574 87.2377 2.63936 38.3688 88.6487 4.29564 38.8845 90.0825 5.96767 39.4071 91.5395 7.77770 39.8552 93.0201 9.55404 40.1866 94.5246 11.3939 40.5207 96.0535 13.4668 40.8575 97.6071 15.7734 40.7079 99.1858 17.7984 40.2947 100.790 19.7665 39.8856 102.420 21.9487 39.4807 104.077 24.4055 38.3227 105.760 26.1375 36.6917 107.471 27.4660 35.1300 109.209 28.5434 33.6349 110.975 29.4335 32.2034 112.770 30.1739 30.8328 114.594 30.7890 29.5205 116.448 31.2958 28.2641 118.331 31.7036 27.0612 120.245 32.0015 25.9095 122.190 32.2052 24.8924 124.166 32.4282 23.9679 126.175 32.6437 23.0778 128.215 32.8428 22.2207 130.289 33.0262 21.3954 132.397 33.1984 20.6008 134.538 33.3676 19.8357 136.714 33.5520 19.0991 138.925 33.8206 18.3897 141.172 34.0583 17.4253 143.456 34.1392 16.4744 145.776 34.1129 15.5753 148.134 34.0295 14.7254 150.530 33.9034 13.9217 152.964 33.7450 13.1620 155.439 33.5652 12.4437 157.953 33.3868 11.7474 160.507 33.1577 11.0518 163.103 32.8917 10.3974 165.742 32.6006 9.78179 168.422 32.2902 9.20258 171.146 31.9647 8.65768 173.915 31.6272 8.14504 176.727 31.2834 7.66276 179.586 30.9323 7.19660 182.491 30.5613 6.75174 185.442 30.1761 6.33440 188.442 29.7797 5.94283 191.489 29.3739 5.57548 194.587 28.9708 5.22303 197.734 28.5364 4.87132 200.932 28.0645 4.54327 204.182 27.5334 4.23733 207.485 26.9664 4.08256 210.840 26.4795 3.99129 214.251 26.0727 3.88848 217.716 25.6600 3.75850 221.237 25.2354 3.63287 224.816 24.8024 3.50930 228.452 24.3491 3.38833 232.147 23.8617 3.28584 235.902 23.3420 3.20832 239.717 22.8109 3.21316 243.595 22.3185 3.24731 247.535 21.8371 3.28183 251.538 21.3433 3.31222 255.607 20.7913 3.34244 259.741 20.2516 3.52247 263.942 19.7531 3.67600 268.211 19.2610 3.83622 272.549 18.7511 4.00466 276.957 18.2392 4.21675 281.437 17.7280 4.44009 285.989 17.2042 4.67525 290.615 16.6569 4.93749 295.315 16.0981 5.23003 300.092 15.5105 5.53991 304.945 14.7850 5.93425 309.878 14.1313 6.51216 314.890 13.5958 7.14638 319.983 13.0852 7.74686 325.158 12.5592 8.39106 330.418 12.0135 9.10047 335.762 11.5074 9.93026 341.192 11.0627 10.8357 346.711 10.7325 11.8029 352.319 10.4466 12.7834 358.017 10.2398 13.8453 363.808 10.1713 14.9043 369.692 10.1183 15.9324 375.672 10.1230 17.0314 381.748 10.3144 18.2062 387.922 10.6910 19.2109 394.197 10.9882 20.0720 400.573 11.2682 20.9717 407.052 11.6032 21.9118 413.635 12.1193 22.8152 420.326 12.5619 23.5265 427.124 12.9540 24.2599 434.032 13.3424 25.0161 441.052 13.7491 25.7960 448.186 14.1936 26.6001 455.435 14.7291 27.4040 462.802 15.2640 28.1419 470.287 15.8142 28.8996 477.894 16.4128 29.6778 485.623 17.1107 30.4769 493.478 17.9839 31.1245 501.459 18.7684 31.5948 509.570 19.4516 32.0722 517.812 20.1179 32.5568 526.187 20.7795 33.0487 534.698 21.4467 33.5481 543.346 22.1514 34.0550 552.134 22.8749 34.5069 561.065 23.5618 34.9290 570.139 24.2220 35.3562 579.361 24.7993 35.7886 588.732 25.2954 36.3997 598.254 25.9975 37.2383 607.930 26.9086 38.0962 617.763 28.0481 38.9739 627.755 29.7023 39.7894 637.908 31.2485 39.8286 648.226 32.6112 39.8678 658.711 34.1322 39.8011 669.365 35.4298 39.3794 680.191 36.4527 38.9622 691.193 37.3235 38.5495 702.372 38.1307 38.2563 713.733 38.9185 37.9709 725.277 39.6908 37.6876 737.008 40.4639 37.4065 748.928 41.2133 37.0405 761.042 41.8831 36.6436 773.351 42.4664 36.2509 785.859 42.9837 35.8804 798.570 43.4592 35.5360 811.486 43.8874 35.1995 824.611 44.2473 34.8663 837.949 44.4649 34.5362 851.502 44.5618 34.4281 865.274 44.6398 34.5656 879.269 44.9663 34.9261 893.491 45.4932 35.2900 907.943 46.1977 35.6579 922.628 47.2259 36.0296 937.551 48.3156 35.8739 952.715 49.3199 35.5848 968.124 50.1449 35.1819 983.783 50.8674 34.7837 999.695 51.5308 34.3849 1015.86 52.1576 33.9853 1032.29 52.7043 33.5441 1048.99 53.1798 33.1564 1065.96 53.6578 32.8253 1083.20 54.1379 32.4967 1100.72 54.6110 32.1711 1118.52 55.0763 31.8486 1136.61 55.5343 31.5285 1155. 55.9863 31.2112 1173.68 56.4345 30.8968 1192.66 56.8817 30.5849 1211.95 57.3335 30.2759 1231.55 57.8066 29.9695 1251.47 58.2990 29.6183 1271.72 58.7939 29.2201 1292.29 59.2283 28.7649 1313.19 59.6140 28.3156 1334.43 59.9686 27.8729 1356.01 60.2988 27.4366 1377.94 60.6084 27.0065 1400.23 60.9004 26.5826 1422.88 61.1767 26.1646 1445.89 61.4402 25.7530 1469.28 61.6951 25.3439 1493.04 61.9423 24.9356 1517.19 62.1706 24.5136 1541.73 62.3769 24.0956 1566.67 62.5642 23.6843 1592.01 62.7360 23.2790 1617.76 62.8933 22.8801 1643.92 63.0373 22.4873 1670.51 63.1687 22.1008 1697.53 63.2886 21.7206 1724.99 63.4035 21.3460 1752.89 63.5059 20.9654 1781.24 63.5910 20.5871 1810.05 63.6593 20.2120 1839.32 63.7108 19.8430 1869.07 63.7476 19.4805 1899.30 63.7705 19.1242 1930.02 63.7792 18.7736 1961.24 63.7735 18.4293 1992.96 63.7511 18.0909 2025.20 63.7249 17.7664 2057.95 63.6857 17.4314 2091.24 63.6247 17.1003 2125.06 63.5448 16.7728 2159.43 63.4451 16.4500 2194.36 63.3248 16.1310 2229.85 63.1824 15.8168 2265.92 63.0164 15.5068 2302.57 62.8247 15.2013 2339.81 62.6053 14.9002 2377.66 62.3546 14.6024 2416.11 62.0682 14.3086 2455.19 61.7416 14.0198 2494.90 61.3702 13.7357 2535.26 60.9460 13.4550 2576.26 60.4591 13.1785 2617.93 59.8965 12.9062 2660.27 59.2412 12.6381 2703.30 58.4682 12.3739 2747.03 57.5406 12.1139 2791.46 56.4004 11.8581 2836.61 54.9474 11.6062 2882.49 52.9829 11.3581 2929.11 50.0080 11.1141 2976.48 43.7571 10.8739 2999.80 14.7588 10.7590 3000. 14.7598 27.3411 3024.63 43.5016 26.9988 3073.55 47.7068 26.3394 3123.26 45.2210 25.6965 3136.10 28.3985 25.5346 3136.30 28.4101 36.8344 3173.78 51.3460 36.1758 3225.11 56.0636 35.3049 3277.27 58.9599 34.4576 3330.28 61.0702 33.6308 3384.15 62.6955 32.8259 3438.88 63.9602 32.0403 3494.50 64.9104 31.2760 3551.02 65.5147 30.5293 3608.46 65.5359 29.8028 3662.90 57.1638 29.1403 3663.10 57.1679 33.7873 3666.82 62.6257 33.7358 3726.13 67.6779 32.9324 3786.40 69.4397 32.1506 3847.64 70.7093 31.3878 3909.87 71.7279 30.6440 3973.11 72.5770 29.9189 4037.38 73.2932 29.2121 4102.68 73.8913 28.5227 4169.03 74.3660 27.8490 4236.46 74.6756 27.1939 4304.98 74.5157 26.5536 4326.90 72.0670 26.3542 4327.10 72.0685 27.8702 4374.62 75.3603 27.4310 4445.37 76.1956 26.7982 4517.27 76.7376 26.1794 4590.33 77.3433 25.5745 4651.90 75.8060 25.0829 4652.10 75.8133 26.1797 4664.58 77.0697 26.0793 4740.03 78.1543 25.4862 4816.69 78.7891 24.9064 4894.60 79.3065 24.3360 4973.77 79.7544 23.7768 5054.21 80.1531 23.2285 5135.96 80.5125 22.6908 5219.03 80.8390 22.1636 5303.44 81.1369 21.6469 5389.22 81.4093 21.1404 5476.39 81.6587 20.6442 5564.97 81.8874 20.1584 5654.98 82.0973 19.6826 5746.44 82.2897 19.2165 5839.39 82.4657 18.7603 5933.83 82.6265 18.3138 6029.81 82.7736 17.8771 6127.33 82.9076 17.4494 6226.44 83.0291 17.0313 6327.15 83.1393 16.6224 6429.48 83.2387 16.2224 6533.48 83.3279 15.8312 6639.15 83.4075 15.4488 6746.54 83.4782 15.0752 6855.65 83.5403 14.7097 6966.54 83.5943 14.3529 7079.22 83.6410 14.0041 7193.72 83.6805 13.6631 7310.07 83.7129 13.3301 7428.31 83.7389 13.0049 7548.45 83.7589 12.6874 7670.54 83.7733 12.3772 7794.61 83.7820 12.0743 7920.68 83.7854 11.7785 8048.79 83.7837 11.4897 8178.98 83.7773 11.2077 8311.26 83.7664 10.9328 8445.69 83.7512 10.6640 8582.29 83.7317 10.4022 8721.11 83.7084 10.1462 8862.16 83.6811 9.89667 9005.50 83.6502 9.65290 9151.16 83.6157 9.41525 9299.17 83.5780 9.18341 9449.58 83.5369 8.95697 9602.42 83.4931 8.73654 9757.73 83.4476 8.52126 9915.55 83.4018 8.31068 10075.9 83.3538 8.09597 10238.9 83.2965 7.88559 10404.5 83.2338 7.67944 10572.8 83.1655 7.47743 10743.8 83.0916 7.27948 10917.6 83.0118 7.08550 11094.2 82.9259 6.89542 11273.6 82.8335 6.70915 11455.9 82.7340 6.52662 11641.2 82.6268 6.34774 11829.5 82.5112 6.17244 12020.8 82.3862 6.00065 12215.3 82.2506 5.83228 12412.8 82.1030 5.66728 12613.6 81.9414 5.50556 12817.6 81.7633 5.34707 13025.0 81.5655 5.19173 13235.6 81.3437 5.03948 13449.7 81.0914 4.89026 13667.2 80.7995 4.74399 13888.3 80.4537 4.60062 14112.9 80.0295 4.46009 14341.2 79.4808 4.32234 14573.1 78.7013 4.18730 14808.9 77.3355 4.05493 15031.1 62.5967 3.93578 15031.3 62.5970 9.97013 15048.4 72.5037 9.95030 15291.8 77.7719 9.67449 15539.1 79.0260 9.40633 15790.4 79.7286 9.14560 16045.8 80.1794 8.89211 16305.4 80.4733 8.64564 16569.1 80.6477 8.40601 16837.1 80.7135 8.17303 17109.4 80.6586 7.94651 17386.1 80.4305 7.72627 17667.4 79.8216 7.51213 17906.4 72.4356 7.33736 17906.6 72.4357 10.3520 17953.1 78.3486 10.3123 18243.5 80.2277 10.0704 18538.6 80.4351 9.83412 18638.9 77.6556 9.75589 18639.1 77.6561 11.1125 18838.4 81.2916 10.9408 19143.1 82.1175 10.6867 19452.7 82.6729 10.4370 19767.4 83.1094 10.1915 20087.1 83.4726 9.95041 20412.0 83.7840 9.71366 20742.1 84.0559 9.48127 21077.6 84.2964 9.25323 21418.5 84.5108 9.02956 21765.0 84.7032 8.81022 22117.0 84.8766 8.59521 22474.7 85.0335 8.38450 22838.2 85.1758 8.17805 23207.6 85.3050 7.97585 23583.0 85.4225 7.77785 23964.4 85.5295 7.58403 24352.0 85.6268 7.39432 24745.9 85.7154 7.20869 25146.2 85.7959 7.02710 25552.9 85.8690 6.84950 25966.2 85.9353 6.67583 26386.1 85.9954 6.50603 26812.9 86.0496 6.34007 27246.6 86.0985 6.17787 27687.3 86.1423 6.01939 28135.1 86.1815 5.86455 28590.2 86.2164 5.71332 29052.6 86.2472 5.56562 29522.5 86.2743 5.42140 30000.0 86.2979 5.28059 periodictable-1.5.0/periodictable/xsf/ga.nff000066400000000000000000000315561310514471200210230ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.98527 10.1617 -9999. 2.98141 10.3261 -9999. 2.97756 10.4931 -9999. 2.97370 10.6628 -9999. 2.96986 10.8353 -9999. 2.96602 11.0106 -9999. 2.95695 11.1886 -9999. 2.90859 11.3696 -9999. 2.86103 11.5535 -9999. 2.81425 11.7404 -9999. 2.76823 11.9303 -9999. 2.66636 12.1232 -9999. 2.55394 12.3193 -9999. 2.44626 12.5186 -9999. 2.34311 12.7210 -9999. 2.24432 12.9268 -9999. 2.14969 13.1359 -9999. 2.02163 13.3483 -9999. 1.89458 13.5642 -9999. 1.70752 13.7836 -9999. 1.44713 14.0066 -9999. 1.24110 14.2331 -9999. 1.07107 14.4633 -9999. 0.920747 14.6973 -9999. 0.773401 14.9350 -9999. 0.650876 15.1765 -9999. 0.599352 15.4220 -9999. 0.551909 15.6714 -9999. 0.508220 15.9249 -9999. 0.472778 16.1825 -9999. 0.439966 16.4442 -9999. 0.433950 16.7102 -9999. 0.432236 16.9805 -9999. 0.430552 17.2551 -9999. 0.442783 17.5342 -9999. 0.455362 17.8178 -9999. 0.468298 18.1060 -9999. 0.488631 18.3989 -9999. 0.535543 18.6964 -9999. 0.586959 18.9988 -9999. 0.671684 19.3061 -9999. 0.792094 19.6184 -9999. 0.911933 19.9357 -9999. 1.00319 20.2582 -9999. 1.10359 20.5858 -9999. 1.18802 20.9188 -9999. 1.25195 21.2571 -9999. 1.31932 21.6009 -9999. 1.34907 21.9503 -9999. 1.35917 22.3053 -9999. 1.36934 22.6661 -9999. 1.37959 23.0327 -9999. 1.38992 23.4053 -9999. 1.38942 23.7838 -9999. 1.38002 24.1685 -9999. 1.37069 24.5594 -9999. 1.36143 24.9566 -9999. 1.36635 25.3603 -9999. 1.39605 25.7705 -9999. 1.42639 26.1873 -9999. 1.45740 26.6109 -9999. 1.48908 27.0413 -9999. 1.52145 27.4786 -9999. 1.56001 27.9231 -9999. 1.61325 28.3747 -9999. 1.66830 28.8337 -9999. 1.72524 29.3000 1.32710 1.78411 29.7739 1.29434 1.84500 30.2555 1.26276 1.90796 30.7449 1.23223 1.97307 31.2421 1.20263 2.04041 31.7475 1.17370 2.11039 32.2609 1.14626 2.18330 32.7827 1.12028 2.25873 33.3130 1.09579 2.33677 33.8518 1.07289 2.41750 34.3993 1.05177 2.50102 34.9557 1.03270 2.58742 35.5211 1.01600 2.67682 36.0956 1.00218 2.76930 36.6794 0.991934 2.86497 37.2727 0.987219 2.96395 37.8755 0.992342 3.06635 38.4882 1.00331 3.15305 39.1107 1.00729 3.23858 39.7432 1.00928 3.32644 40.3861 1.01098 3.41667 41.0393 1.01317 3.50936 41.7031 1.01640 3.60456 42.3776 1.02117 3.70234 43.0630 1.02796 3.80277 43.7595 1.03740 3.90593 44.4673 1.05032 4.01189 45.1865 1.06945 4.12072 45.9174 1.10145 4.22650 46.6600 1.12842 4.31941 47.4147 1.15058 4.41435 48.1816 1.17169 4.51138 48.9609 1.19271 4.61054 49.7528 1.21422 4.71189 50.5576 1.23663 4.81545 51.3753 1.26035 4.92130 52.2062 1.28574 5.02947 53.0506 1.31348 5.14003 53.9087 1.34493 5.25301 54.7806 1.37899 5.36368 55.6667 1.41287 5.47581 56.5670 1.44803 5.59028 57.4820 1.48515 5.70715 58.4117 1.52477 5.82646 59.3564 1.56740 5.94826 60.3165 1.61373 6.07261 61.2921 1.66466 6.19957 62.2834 1.72239 6.32917 63.2908 1.79299 6.46148 64.3145 1.87125 6.57308 65.3547 1.94010 6.68044 66.4118 2.00598 6.78956 67.4859 2.07133 6.90045 68.5775 2.13739 7.01316 69.6867 2.20506 7.12770 70.8138 2.27544 7.24412 71.9591 2.35039 7.36243 73.1230 2.43607 7.48088 74.3057 2.52023 7.57994 75.5076 2.59758 7.68030 76.7289 2.67119 7.78200 77.9699 2.74299 7.88504 79.2310 2.81326 7.98945 80.5125 2.88199 8.09524 81.8147 2.94853 8.20243 83.1380 3.00986 8.31104 84.4827 3.06677 8.43420 85.8491 3.13203 8.56433 87.2377 3.20293 8.69646 88.6487 3.27700 8.83063 90.0825 3.35367 8.96688 91.5395 3.43237 9.10522 93.0201 3.51169 9.24571 94.5246 3.59012 9.39145 96.0535 3.66777 9.54948 97.6071 3.75804 9.71719 99.1858 3.85869 9.88785 100.790 3.96758 10.0615 102.420 4.08488 10.2382 104.077 4.21120 10.4180 105.760 4.34745 10.6010 107.471 4.49520 10.7871 109.209 4.65675 10.9766 110.975 4.83802 11.1694 112.770 5.06362 11.3655 114.594 5.29532 11.4855 116.448 5.50090 11.6006 118.331 5.69762 11.7168 120.245 5.89150 11.8342 122.190 6.08532 11.9527 124.166 6.28088 12.0725 126.175 6.47967 12.1934 128.215 6.68306 12.3156 130.289 6.89260 12.4390 132.397 7.11019 12.5636 134.538 7.33864 12.6894 136.714 7.58301 12.8166 138.925 7.86035 12.9450 141.172 8.17319 13.0064 143.456 8.44711 13.0318 145.776 8.69366 13.0573 148.134 8.93038 13.0828 150.530 9.16028 13.1084 152.964 9.38539 13.1340 155.439 9.60708 13.1597 157.953 9.82645 13.1854 160.507 10.0444 13.2112 163.103 10.2616 13.2370 165.742 10.4790 13.2629 168.422 10.6974 13.2888 171.146 10.9179 13.3148 173.915 11.1420 13.3408 176.727 11.3732 13.3669 179.586 11.6249 13.3872 182.491 11.8660 13.3696 185.442 12.0934 13.3520 188.442 12.3126 13.3345 191.489 12.5271 13.3170 194.587 12.7383 13.2995 197.734 12.9470 13.2821 200.932 13.1537 13.2646 204.182 13.3592 13.2472 207.485 13.5637 13.2298 210.840 13.7677 13.2124 214.251 13.9716 13.1951 217.716 14.1758 13.1777 221.237 14.3808 13.1604 224.816 14.5871 13.1431 228.452 14.7952 13.1259 232.147 15.0059 13.1087 235.902 15.2202 13.0914 239.717 15.4398 13.0742 243.595 15.6675 13.0571 247.535 15.9120 13.0399 251.538 16.1840 12.9860 255.607 16.4295 12.9000 259.741 16.6519 12.8147 263.942 16.8658 12.7299 268.211 17.0737 12.6457 272.549 17.2771 12.5620 276.957 17.4775 12.4789 281.437 17.6757 12.3963 285.989 17.8730 12.3143 290.615 18.0706 12.2328 295.315 18.2699 12.1518 300.092 18.4732 12.0714 304.945 18.6851 11.9916 309.878 18.9226 11.9122 314.890 19.1684 11.7685 319.983 19.3807 11.6058 325.158 19.5654 11.4453 330.418 19.7368 11.2870 335.762 19.8977 11.1310 341.192 20.0500 10.9770 346.711 20.1949 10.8253 352.319 20.3335 10.6756 358.017 20.4666 10.5280 363.808 20.5950 10.3824 369.692 20.7193 10.2388 375.672 20.8404 10.0972 381.748 20.9593 9.95761 387.922 21.0771 9.81992 394.197 21.2069 9.68322 400.573 21.3269 9.52024 407.052 21.4304 9.35999 413.635 21.5248 9.20246 420.326 21.6123 9.04756 427.124 21.6937 8.89528 434.032 21.7699 8.74556 441.052 21.8413 8.59835 448.186 21.9084 8.45363 455.435 21.9714 8.31134 462.802 22.0307 8.17145 470.287 22.0867 8.03391 477.894 22.1395 7.89869 485.623 22.1895 7.76574 493.478 22.2370 7.63503 501.459 22.2824 7.50653 509.570 22.3264 7.38018 517.812 22.3696 7.25597 526.187 22.4216 7.13384 534.698 22.4676 6.99252 543.346 22.5005 6.85265 552.134 22.5260 6.71559 561.065 22.5456 6.58127 570.139 22.5604 6.44963 579.361 22.5708 6.32062 588.732 22.5771 6.19420 598.254 22.5798 6.07031 607.930 22.5792 5.94889 617.763 22.5755 5.82990 627.755 22.5693 5.71330 637.908 22.5611 5.59902 648.226 22.5518 5.48703 658.711 22.5438 5.37728 669.365 22.5459 5.26972 680.191 22.5496 5.13025 691.193 22.5304 4.97901 702.372 22.4890 4.83223 713.733 22.4349 4.68978 725.277 22.3697 4.55152 737.008 22.2939 4.41734 748.928 22.2079 4.28711 761.042 22.1117 4.16073 773.351 22.0047 4.03807 785.859 21.8861 3.91903 798.570 21.7541 3.80350 811.486 21.6009 3.69137 824.611 21.4381 3.60783 837.949 21.2746 3.53097 851.502 21.1073 3.45531 865.274 20.9301 3.38059 879.269 20.7394 3.30688 893.491 20.5327 3.23494 907.943 20.3074 3.16450 922.628 20.0595 3.09553 937.551 19.7850 3.02848 952.715 19.4782 2.96292 968.124 19.1317 2.89882 983.783 18.7352 2.83615 999.695 18.2744 2.77532 1015.86 17.7277 2.71630 1032.29 17.0656 2.66264 1048.99 16.2329 2.60963 1065.96 15.1233 2.55721 1083.20 13.4922 2.50580 1100.72 10.5124 2.45541 1116.60 -10.6725 2.41128 1116.80 -10.6678 15.6268 1118.52 1.56871 15.6115 1136.61 11.7921 15.4531 1155. 14.6652 15.2962 1173.68 16.4368 15.1410 1192.66 17.7288 14.9873 1211.95 18.7442 14.8352 1231.55 19.5700 14.6846 1251.47 20.2418 14.5368 1271.72 20.7413 14.3906 1292.29 20.7723 14.2458 1298.90 18.7899 14.2001 1299.10 18.8011 15.8852 1313.19 21.9927 15.6365 1334.43 23.1209 15.2738 1356.01 23.9234 14.9194 1377.94 24.5811 14.5734 1400.23 25.1467 14.2353 1422.88 25.6448 13.9051 1445.89 26.0897 13.5824 1469.28 26.4909 13.2674 1493.04 26.8552 12.9599 1517.19 27.1881 12.6606 1541.73 27.4943 12.3682 1566.67 27.7766 12.0826 1592.01 28.0376 11.8036 1617.76 28.2797 11.5311 1643.92 28.5048 11.2649 1670.51 28.7148 11.0048 1697.53 28.9117 10.7507 1724.99 29.0990 10.5025 1752.89 29.2746 10.2521 1781.24 29.4364 10.0052 1810.05 29.5842 9.76228 1839.32 29.7201 9.52519 1869.07 29.8457 9.29382 1899.30 29.9619 9.06803 1930.02 30.0697 8.84787 1961.24 30.1700 8.63307 1992.96 30.2620 8.42343 2025.20 30.3509 8.22260 2057.95 30.4352 8.01944 2091.24 30.5116 7.82020 2125.06 30.5812 7.62565 2159.43 30.6452 7.43531 2194.36 30.7036 7.24887 2229.85 30.7570 7.06688 2265.92 30.8057 6.88880 2302.57 30.8499 6.71491 2339.81 30.8900 6.54485 2377.66 30.9261 6.37861 2416.11 30.9584 6.21644 2455.19 30.9873 6.05785 2494.90 31.0130 5.90315 2535.26 31.0356 5.75194 2576.26 31.0552 5.60422 2617.93 31.0720 5.46015 2660.27 31.0864 5.31950 2703.30 31.0983 5.18207 2747.03 31.1077 5.04796 2791.46 31.1152 4.91733 2836.61 31.1205 4.78938 2882.49 31.1238 4.66502 2929.11 31.1255 4.54352 2976.48 31.1254 4.42500 3024.63 31.1237 4.30940 3073.55 31.1205 4.19667 3123.26 31.1160 4.08670 3173.78 31.1101 3.97946 3225.11 31.1029 3.87493 3277.27 31.0946 3.77296 3330.28 31.0852 3.67355 3384.15 31.0748 3.57666 3438.88 31.0634 3.48218 3494.50 31.0512 3.39009 3551.02 31.0380 3.30032 3608.46 31.0241 3.21283 3666.82 31.0094 3.12755 3726.13 30.9941 3.04450 3786.40 30.9781 2.96347 3847.64 30.9614 2.88455 3909.87 30.9442 2.80767 3973.11 30.9265 2.73275 4037.38 30.9083 2.65973 4102.68 30.8896 2.58859 4169.03 30.8704 2.51925 4236.46 30.8508 2.45171 4304.98 30.8309 2.38597 4374.62 30.8106 2.32185 4445.37 30.7898 2.25940 4517.27 30.7688 2.19861 4590.33 30.7475 2.13936 4664.58 30.7258 2.08162 4740.03 30.7038 2.02540 4816.69 30.6815 1.97063 4894.60 30.6590 1.91730 4973.77 30.6362 1.86534 5054.21 30.6130 1.81472 5135.96 30.5896 1.76543 5219.03 30.5660 1.71743 5303.44 30.5420 1.67060 5389.22 30.5177 1.62508 5476.39 30.4932 1.58067 5564.97 30.4683 1.53750 5654.98 30.4431 1.49538 5746.44 30.4175 1.45443 5839.39 30.3916 1.41448 5933.83 30.3652 1.37561 6029.81 30.3385 1.33772 6127.33 30.3113 1.30087 6226.44 30.2836 1.26495 6327.15 30.2554 1.22995 6429.48 30.2266 1.19587 6533.48 30.1972 1.16263 6639.15 30.1670 1.13029 6746.54 30.1361 1.09881 6855.65 30.1044 1.06813 6966.54 30.0717 1.03825 7079.22 30.0380 1.00914 7193.72 30.0031 0.980786 7310.07 29.9670 0.953177 7428.31 29.9294 0.926276 7548.45 29.8902 0.900071 7670.54 29.8492 0.874545 7794.61 29.8061 0.849687 7920.68 29.7606 0.825458 8048.79 29.7124 0.801857 8178.98 29.6611 0.778864 8311.26 29.6061 0.756468 8445.69 29.5468 0.734664 8582.29 29.4824 0.713390 8721.11 29.4118 0.692675 8862.16 29.3338 0.672497 9005.50 29.2465 0.652833 9151.16 29.1474 0.633681 9299.17 29.0331 0.615009 9449.58 28.8982 0.596807 9602.42 28.7342 0.579077 9757.73 28.5268 0.561816 9915.55 28.2473 0.544992 10075.9 27.8273 0.528583 10238.9 27.0132 0.512592 10367.0 19.4428 0.500533 10367.2 19.4432 3.85480 10404.5 25.8007 3.83433 10572.8 27.6942 3.74426 10743.8 28.3901 3.65556 10917.6 28.8326 3.56828 11094.2 29.1586 3.48242 11273.6 29.4164 3.39800 11455.9 29.6290 3.31505 11641.2 29.8091 3.23357 11829.5 29.9646 3.15356 12020.8 30.1007 3.07503 12215.3 30.2210 2.99799 12412.8 30.3283 2.92244 12613.6 30.4245 2.84837 12817.6 30.5113 2.77577 13025.0 30.5898 2.70465 13235.6 30.6611 2.63499 13449.7 30.7259 2.56679 13667.2 30.7851 2.50002 13888.3 30.8391 2.43470 14112.9 30.8884 2.37078 14341.2 30.9336 2.30828 14573.1 30.9750 2.24716 14808.9 31.0128 2.18741 15048.4 31.0475 2.12902 15291.8 31.0792 2.07196 15539.1 31.1082 2.01623 15790.4 31.1346 1.96179 16045.8 31.1588 1.90863 16305.4 31.1809 1.85674 16569.1 31.2009 1.80608 16837.1 31.2191 1.75665 17109.4 31.2356 1.70841 17386.1 31.2505 1.66136 17667.4 31.2639 1.61546 17953.1 31.2759 1.57069 18243.5 31.2866 1.52704 18538.6 31.2961 1.48449 18838.4 31.3045 1.44301 19143.1 31.3119 1.40258 19452.7 31.3182 1.36318 19767.4 31.3237 1.32480 20087.1 31.3283 1.28740 20412.0 31.3321 1.25096 20742.1 31.3352 1.21548 21077.6 31.3376 1.18092 21418.5 31.3393 1.14727 21765.0 31.3404 1.11451 22117.0 31.3410 1.08262 22474.7 31.3411 1.05157 22838.2 31.3407 1.02135 23207.6 31.3398 0.991945 23583.0 31.3385 0.963326 23964.4 31.3368 0.935481 24352.0 31.3348 0.908389 24745.9 31.3324 0.882035 25146.2 31.3297 0.856398 25552.9 31.3268 0.831463 25966.2 31.3236 0.807212 26386.1 31.3201 0.783629 26812.9 31.3164 0.760696 27246.6 31.3126 0.738399 27687.3 31.3085 0.716721 28135.1 31.3043 0.695645 28590.2 31.3000 0.675159 29052.6 31.2956 0.655246 29522.5 31.2930 0.635891 30000.0 31.2806 0.617081 periodictable-1.5.0/periodictable/xsf/gd.nff000066400000000000000000000445101310514471200210200ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.59886 10.1152 -9999. 2.63957 10.2317 -9999. 2.68119 10.3496 -9999. 2.72415 10.4688 -9999. 2.76780 10.5894 -9999. 2.81214 10.7114 -9999. 2.85720 10.8348 -9999. 2.90298 10.9596 -9999. 2.94949 11.0859 -9999. 2.99675 11.2136 -9999. 3.04476 11.3428 -9999. 3.09354 11.4734 -9999. 3.14311 11.6056 -9999. 3.19347 11.7393 -9999. 3.24463 11.8745 -9999. 3.29662 12.0113 -9999. 3.34944 12.1497 -9999. 3.40310 12.2897 -9999. 3.45763 12.4312 -9999. 3.51302 12.5744 -9999. 3.56931 12.7193 -9999. 3.62650 12.8658 -9999. 3.68460 13.0140 -9999. 3.74364 13.1640 -9999. 3.80043 13.3156 -9999. 3.85797 13.4690 -9999. 3.91639 13.6242 -9999. 3.97569 13.7811 -9999. 4.03570 13.9399 -9999. 4.06196 14.1005 -9999. 4.07958 14.2629 -9999. 3.94937 14.4272 -9999. 3.82332 14.5934 -9999. 3.48844 14.7615 -9999. 3.14840 14.9316 -9999. 2.84152 15.1036 -9999. 2.56453 15.2776 -9999. 2.31455 15.4536 -9999. 2.08894 15.6316 -9999. 1.88532 15.8117 -9999. 1.68950 15.9938 -9999. 1.50568 16.1781 -9999. 1.34186 16.3644 -9999. 1.29132 16.5529 -9999. 1.27552 16.7436 -9999. 1.25992 16.9365 -9999. 1.24450 17.1316 -9999. 1.22928 17.3290 -9999. 1.21424 17.5286 -9999. 1.19938 17.7305 -9999. 1.18471 17.9348 -9999. 1.17022 18.1414 -9999. 1.15590 18.3504 -9999. 1.14176 18.5618 -9999. 1.12779 18.7756 -9999. 1.12334 18.9919 -9999. 1.13672 19.2107 1.43277 1.15027 19.4320 1.13211 1.16398 19.6558 0.698747 1.17785 19.8823 0.194414 1.36993 20.1113 -0.298941 1.70882 20.3430 -0.740252 2.23387 20.5773 -0.809073 2.96323 20.8144 -0.721060 3.31242 21.0542 -0.776530 3.70275 21.2967 -0.740473 4.10925 21.5421 -0.675681 4.39405 21.7902 -0.644206 4.69858 22.0412 -0.574942 5.02421 22.2952 -0.425837 5.34323 22.5520 -0.268313 5.48238 22.8118 -0.192988 5.62516 23.0746 -0.145541 5.77166 23.3404 -0.114818 5.92197 23.6093 -0.956905E-01 6.07620 23.8812 -0.848224E-01 6.23444 24.1564 -0.769488E-01 6.39681 24.4346 -0.694149E-01 6.55797 24.7161 -0.731684E-01 6.70066 25.0008 -0.983987E-01 6.84647 25.2889 -0.140872 6.99544 25.5802 -0.202277 7.14767 25.8749 -0.287074 7.30320 26.1729 -0.403155 7.46211 26.4744 -0.564845 7.62679 26.7794 -0.789996 7.79875 27.0275 -1.14823 7.94001 27.3008 -1.63032 8.39773 27.6153 -1.96589 9.22140 27.9334 -2.05888 10.1259 28.2552 -1.89371 11.0010 28.5807 -1.64471 11.7319 28.9100 -1.34246 12.5113 29.2430 -0.872725 13.2364 29.5799 -0.392051 13.7334 29.9206 0.346690E-01 14.2490 30.2653 0.476598 14.7567 30.6140 0.934560 15.2676 30.9666 1.42155 15.7962 31.3234 1.96221 16.3432 31.6842 2.57706 16.9091 32.0492 3.30443 17.4945 32.4184 4.23079 18.0225 32.7919 5.22926 18.3692 33.1696 6.38397 18.6842 33.5518 7.55615 18.6228 33.9383 8.74608 18.5616 34.3292 9.89314 18.0514 34.7247 10.6965 17.5050 35.1247 11.3890 16.9753 35.5294 12.0250 16.4615 35.9386 12.5982 15.9068 36.3527 13.0798 15.3501 36.7714 13.5023 14.8128 37.1950 13.9694 14.2943 37.6235 14.3849 13.6087 38.0569 14.6025 12.9040 38.4953 14.6750 12.2357 38.9388 14.6851 11.7487 39.3874 14.7228 11.2932 39.8411 14.7534 10.8553 40.3001 14.7652 10.4343 40.7643 14.7459 10.0324 41.2339 14.7125 9.67281 41.7090 14.6818 9.32612 42.1894 14.6386 8.99187 42.6755 14.5837 8.66960 43.1671 14.5145 8.35624 43.6644 14.4276 8.05409 44.1674 14.3225 7.76285 44.6762 14.1956 7.48215 45.1908 14.0451 7.21161 45.7114 13.7958 6.95084 46.2380 13.5269 6.85319 46.7707 13.3609 6.80425 47.3095 13.2326 6.75565 47.8545 13.1284 6.70740 48.4058 13.0433 6.65950 48.9634 12.9699 6.60348 49.5274 12.9005 6.54716 50.0980 12.8350 6.49132 50.6751 12.7724 6.43596 51.2589 12.7109 6.38107 51.8494 12.6461 6.32665 52.4467 12.5778 6.28605 53.0509 12.5184 6.25594 53.6620 12.4697 6.22597 54.2802 12.4252 6.19615 54.9055 12.3845 6.16647 55.5380 12.3470 6.13693 56.1778 12.3133 6.10754 56.8250 12.2850 6.07690 57.4796 12.2562 6.03398 58.1417 12.2205 5.99136 58.8115 12.1812 5.94905 59.4890 12.1383 5.90704 60.1743 12.0890 5.86532 60.8675 12.0350 5.82928 61.5687 11.9808 5.79689 62.2780 11.9242 5.76466 62.9954 11.8628 5.73263 63.7211 11.7949 5.70077 64.4552 11.7001 5.66908 65.1977 11.5946 5.67720 65.9488 11.5139 5.70848 66.7085 11.4472 5.73992 67.4770 11.3880 5.77155 68.2543 11.3337 5.80334 69.0406 11.2830 5.83532 69.8359 11.2347 5.86746 70.6404 11.1878 5.89979 71.4542 11.1413 5.93229 72.2774 11.0905 5.96497 73.1100 11.0353 6.00439 73.9522 10.9852 6.06099 74.8041 10.9457 6.11814 75.6659 10.9119 6.17581 76.5375 10.8826 6.23404 77.4192 10.8576 6.29280 78.3111 10.8367 6.35213 79.2132 10.8203 6.41201 80.1258 10.8089 6.47246 81.0488 10.8117 6.53348 81.9825 10.8210 6.57612 82.9269 10.8197 6.60881 83.8822 10.8133 6.64166 84.8485 10.8043 6.67467 85.8260 10.7939 6.70785 86.8147 10.7830 6.74119 87.8148 10.7723 6.77470 88.8264 10.7658 6.80837 89.8497 10.7655 6.83765 90.8847 10.7613 6.84384 91.9317 10.7428 6.85005 92.9908 10.7166 6.85625 94.0620 10.6841 6.86247 95.1456 10.6457 6.86869 96.2417 10.6016 6.87491 97.3503 10.5515 6.88114 98.4718 10.4954 6.88738 99.6062 10.4328 6.89362 100.754 10.3630 6.89987 101.914 10.2833 6.90782 103.088 10.1980 6.92311 104.276 10.1115 6.93843 105.477 10.0199 6.95380 106.692 9.92356 6.96918 107.921 9.82429 6.98461 109.165 9.72752 6.99174 110.422 9.61711 6.97723 111.694 9.48075 6.96276 112.981 9.32959 6.94831 114.282 9.17472 6.93389 115.599 9.00570 6.89460 116.931 8.79749 6.83946 118.278 8.55563 6.78475 119.640 8.28575 6.73049 121.019 8.00556 6.67665 122.413 7.68519 6.53341 123.823 7.25812 6.38700 125.249 6.75238 6.24387 126.692 6.16377 6.09458 128.152 5.46190 5.91569 129.628 4.61550 5.74204 131.121 3.64436 5.56359 132.632 2.42853 5.26234 134.160 0.760407 4.97742 135.705 -1.40968 4.77885 136.868 -3.59184 4.75615 138.069 -6.65208 5.16043 139.660 -10.3683 7.19859 139.970 -11.2473 7.67845 141.416 -14.6480 9.69578 143.045 -20.6122 12.2147 143.250 -21.8300 12.5724 144.354 -29.9321 18.3049 145.098 -35.9848 23.6190 145.846 -37.7647 37.7319 147.354 -28.4364 63.3645 149.052 1.46880 78.9176 150.769 25.0495 63.8690 152.505 32.8601 48.6843 154.262 33.3062 38.7647 156.039 31.2810 31.8826 157.837 29.5943 29.1981 159.655 28.6664 26.7397 161.494 27.8613 25.2119 163.355 27.3842 23.9251 165.237 26.9914 22.8194 167.140 26.6991 21.9706 169.066 26.5539 21.1534 171.013 26.4135 20.3837 172.983 26.2755 19.6637 174.976 26.1166 18.9692 176.992 25.8624 18.2992 179.031 25.4591 17.7315 181.093 25.1164 17.5601 183.179 24.9629 17.3903 185.289 24.8833 17.2222 187.424 24.8497 17.0557 189.583 24.8486 16.8908 191.767 24.8721 16.7275 193.976 24.9155 16.5658 196.211 24.9766 16.4057 198.471 25.0567 16.2471 200.757 25.1721 16.0900 203.070 25.2981 15.8622 205.410 25.3890 15.6230 207.776 25.4564 15.3875 210.169 25.5108 15.1554 212.591 25.5532 14.9269 215.040 25.5835 14.7018 217.517 25.6007 14.4801 220.023 25.6034 14.2618 222.557 25.5659 14.0507 225.121 25.5240 13.9016 227.714 25.5138 13.7540 230.338 25.5035 13.6080 232.991 25.4922 13.4635 235.675 25.4778 13.3205 238.390 25.4580 13.1791 241.136 25.4310 13.0392 243.914 25.3943 12.9007 246.724 25.3447 12.7638 249.566 25.2769 12.6282 252.441 25.1857 12.4941 255.349 24.9885 12.3693 258.291 24.7932 12.4343 261.266 24.7195 12.4996 264.276 24.6688 12.5653 267.321 24.6411 12.6313 270.400 24.6319 12.6977 273.515 24.6385 12.7644 276.666 24.6593 12.8315 279.853 24.6936 12.8990 283.077 24.7414 12.9667 286.338 24.8037 13.0349 289.637 24.8811 13.1034 292.973 25.0043 13.1723 296.348 25.1440 13.1793 299.762 25.2482 13.1607 303.215 25.3372 13.1421 306.708 25.4172 13.1235 310.242 25.4901 13.1049 313.816 25.5559 13.0864 317.431 25.6126 13.0679 321.088 25.6438 13.0575 324.786 25.6790 13.0933 328.528 25.7470 13.1292 332.313 25.8245 13.1652 336.141 25.9207 13.2014 340.013 26.0301 13.2208 343.930 26.1332 13.2191 347.892 26.2279 13.2174 351.900 26.3199 13.2157 355.954 26.4106 13.2139 360.054 26.5008 13.2122 364.202 26.5908 13.2105 368.398 26.6809 13.2088 372.642 26.7714 13.2071 376.934 26.8626 13.2054 381.277 26.9547 13.2036 385.669 27.0482 13.2019 390.112 27.1439 13.2002 394.606 27.2472 13.1967 399.152 27.3499 13.1791 403.750 27.4431 13.1615 408.401 27.5343 13.1440 413.106 27.6234 13.1265 417.865 27.7107 13.1090 422.678 27.7963 13.0915 427.548 27.8802 13.0740 432.473 27.9621 13.0566 437.455 28.0416 13.0392 442.494 28.1175 13.0218 447.592 28.1855 13.0045 452.748 28.2464 13.0048 457.964 28.3169 13.0173 463.239 28.3996 13.0299 468.576 28.4876 13.0425 473.974 28.5812 13.0552 479.434 28.6807 13.0678 484.957 28.7875 13.0804 490.544 28.9052 13.0931 496.195 29.0478 13.0943 501.911 29.1871 13.0528 507.693 29.2983 13.0114 513.541 29.4042 12.9701 519.457 29.5051 12.9290 525.441 29.6023 12.8880 531.495 29.6967 12.8471 537.617 29.7889 12.8064 543.811 29.8795 12.7658 550.075 29.9692 12.7253 556.412 30.0587 12.6849 562.822 30.1488 12.6447 569.305 30.2509 12.6046 575.864 30.3530 12.5398 582.498 30.4363 12.4734 589.208 30.5143 12.4063 595.996 30.5866 12.3394 602.861 30.6546 12.2729 609.806 30.7191 12.2068 616.831 30.7805 12.1410 623.937 30.8417 12.0756 631.125 30.9015 12.0062 638.395 30.9601 11.9340 645.750 31.0154 11.8534 653.188 31.0588 11.7649 660.713 31.0908 11.6771 668.324 31.1105 11.5901 676.023 31.1186 11.5097 683.811 31.1250 11.4465 691.689 31.1362 11.3841 699.657 31.1504 11.3236 707.717 31.1698 11.2613 715.870 31.1860 11.1789 724.116 31.1883 11.0971 732.458 31.1827 11.0160 740.896 31.1705 10.9354 749.431 31.1520 10.8554 758.064 31.1277 10.7760 766.797 31.0979 10.6960 775.631 31.0629 10.6163 784.566 31.0224 10.5318 793.604 30.9714 10.4448 802.746 30.9097 10.3586 811.994 30.8388 10.2731 821.348 30.7587 10.1882 830.810 30.6692 10.1040 840.381 30.5702 10.0202 850.062 30.4609 9.93610 859.854 30.3409 9.85223 869.760 30.2087 9.76689 879.779 30.0622 9.68229 889.914 29.9019 9.59833 900.166 29.7269 9.51510 910.536 29.5361 9.43260 921.025 29.3301 9.35082 931.635 29.1057 9.26598 942.368 28.8587 9.18104 953.224 28.5883 9.09519 964.205 28.2907 9.00961 975.312 27.9640 8.92500 986.548 27.6055 8.84126 997.913 27.2113 8.75767 1009.41 26.7767 8.67430 1021.04 26.2954 8.58957 1032.80 25.7576 8.50287 1044.70 25.1537 8.41650 1056.73 24.4712 8.32978 1068.91 23.6937 8.24394 1081.22 22.7998 8.15899 1093.67 21.7590 8.07491 1106.27 20.5269 7.99170 1119.02 19.0354 7.90935 1131.91 17.1732 7.82795 1144.95 14.7387 7.74740 1158.14 11.3077 7.66759 1171.48 5.70917 7.58858 1184.97 -8.77740 7.51040 1189.50 -50.9975 7.48456 1189.70 -50.9725 42.3407 1198.63 -0.450354 41.9093 1212.43 10.4118 41.2569 1226.40 16.1355 40.6146 1240.53 20.0834 39.9834 1254.82 23.1063 39.3628 1269.28 25.5541 38.7540 1283.90 27.6077 38.1574 1298.69 29.3710 37.5700 1313.65 30.9087 36.9916 1328.78 32.2646 36.4221 1344.09 33.4695 35.8612 1359.57 34.5452 35.3090 1375.23 35.5079 34.7652 1391.08 36.3688 34.2299 1407.10 37.1357 33.7027 1423.31 37.8130 33.1837 1439.71 38.4014 32.6728 1456.29 38.8975 32.1698 1473.07 39.2885 31.6708 1490.04 39.5451 31.1785 1507.20 39.6007 30.6855 1524.57 39.2379 30.1959 1542.13 36.3538 29.7142 1543.90 32.1401 29.6664 1544.10 32.1461 34.2371 1559.90 39.9565 33.7980 1577.87 41.4832 33.3106 1596.04 42.4738 32.8302 1614.43 43.2085 32.3567 1633.03 43.6373 31.8899 1651.84 43.7954 31.6343 1670.87 44.1335 32.1893 1688.20 45.1946 32.6976 1688.40 45.2256 32.6806 1690.12 45.3822 32.6354 1709.59 46.4974 32.1301 1729.28 47.2961 31.6326 1749.20 47.9640 31.1428 1769.35 48.5443 30.6605 1789.74 49.0534 30.1854 1810.35 49.4953 29.7175 1831.21 49.8629 29.2571 1852.30 50.1193 28.8038 1873.64 50.0302 28.3576 1880.70 48.5244 28.2127 1880.90 48.5388 29.4562 1895.23 50.7344 29.1548 1917.06 51.5004 28.7056 1939.14 52.0650 28.2633 1961.48 52.5479 27.8278 1984.08 52.9796 27.3990 2006.93 53.3748 26.9791 2030.05 53.7472 26.5694 2053.44 54.0985 26.1574 2077.10 54.4247 25.7498 2101.02 54.7313 25.3482 2125.23 55.0208 24.9520 2149.71 55.2943 24.5611 2174.47 55.5530 24.1755 2199.52 55.7981 23.7954 2224.86 56.0307 23.4206 2250.49 56.2513 23.0509 2276.42 56.4606 22.6863 2302.64 56.6594 22.3273 2329.17 56.8479 21.9726 2356. 57.0266 21.6243 2383.14 57.1976 21.2808 2410.59 57.3600 20.9413 2438.36 57.5132 20.6069 2466.45 57.6591 20.2783 2494.87 57.7976 19.9527 2523.61 57.9285 19.6337 2552.68 58.0534 19.3182 2582.09 58.1712 19.0079 2611.83 58.2829 18.7016 2641.92 58.3880 18.4002 2672.35 58.4877 18.1040 2703.14 58.5824 17.8122 2734.28 58.6721 17.5239 2765.78 58.7560 17.2396 2797.64 58.8348 16.9603 2829.87 58.9091 16.6849 2862.47 58.9784 16.4138 2895.44 59.0434 16.1472 2928.80 59.1047 15.8847 2962.54 59.1620 15.6258 2996.67 59.2150 15.3707 3031.19 59.2641 15.1197 3066.11 59.3097 14.8727 3101.43 59.3518 14.6292 3137.16 59.3905 14.3896 3173.30 59.4258 14.1531 3209.85 59.4571 13.9208 3246.83 59.4858 13.6928 3284.23 59.5121 13.4676 3322.07 59.5351 13.2455 3360.34 59.5551 13.0276 3399.05 59.5726 12.8121 3438.20 59.5867 12.6007 3477.81 59.5987 12.3925 3517.88 59.6080 12.1875 3558.40 59.6149 11.9858 3599.39 59.6194 11.7871 3640.86 59.6214 11.5915 3682.80 59.6212 11.3991 3725.23 59.6187 11.2095 3768.14 59.6139 11.0230 3811.55 59.6069 10.8394 3855.46 59.5978 10.6587 3899.87 59.5865 10.4809 3944.80 59.5733 10.3059 3990.24 59.5580 10.1335 4036.21 59.5406 9.96389 4082.71 59.5212 9.79686 4129.74 59.4998 9.63262 4177.31 59.4765 9.47075 4225.44 59.4509 9.31151 4274.11 59.4235 9.15483 4323.35 59.3940 9.00065 4373.15 59.3626 8.84892 4423.53 59.3292 8.69945 4474.49 59.2937 8.55241 4526.04 59.2561 8.40757 4578.18 59.2164 8.26512 4630.92 59.1746 8.12490 4684.27 59.1306 7.98688 4738.23 59.0844 7.85103 4792.81 59.0358 7.71730 4848.02 58.9849 7.58567 4903.87 58.9314 7.45615 4960.37 58.8755 7.32867 5017.51 58.8170 7.20307 5075.31 58.7556 7.07959 5133.78 58.6914 6.95792 5192.92 58.6239 6.83819 5252.74 58.5533 6.72043 5313.25 58.4793 6.60458 5374.46 58.4017 6.49051 5436.37 58.3203 6.37820 5499. 58.2347 6.26743 5562.35 58.1446 6.15876 5626.42 58.0498 6.05141 5691.24 57.9495 5.94592 5756.80 57.8435 5.84208 5823.12 57.7312 5.73985 5890.20 57.6121 5.63937 5958.06 57.4852 5.54018 6026.69 57.3497 5.44276 6096.12 57.2046 5.34683 6166.35 57.0486 5.25238 6237.38 56.8800 5.15936 6309.24 56.6969 5.06779 6381.92 56.4970 4.97767 6455.44 56.2770 4.88892 6529.80 56.0327 4.80152 6605.03 55.7588 4.71553 6681.11 55.4474 4.63083 6758.08 55.0874 4.54734 6835.93 54.6613 4.46527 6914.68 54.1406 4.38450 6994.34 53.4717 4.30490 7074.91 52.5360 4.22660 7156.42 50.9632 4.14961 7238.86 43.6743 4.07360 7242.70 34.9466 4.07010 7242.90 34.9476 11.5429 7322.25 50.8662 11.3109 7406.60 52.5199 11.0720 7491.92 53.3810 10.8383 7578.23 53.8784 10.6094 7665.53 54.1197 10.3852 7753.84 54.0994 10.1658 7843.16 53.6515 9.95124 7930.20 45.8175 9.74873 7930.40 45.8203 13.6269 7933.51 49.9824 13.6165 8024.91 54.3808 13.3181 8117.35 55.3822 13.0263 8210.86 55.9123 12.7406 8305.45 56.0290 12.4611 8375.50 52.6588 12.2600 8375.70 52.6596 14.0469 8401.13 55.9311 13.9843 8497.91 57.2413 13.7503 8595.80 57.9509 13.5196 8694.83 58.4996 13.2917 8794.99 58.9605 13.0668 8896.31 59.3624 12.8446 8998.79 59.7199 12.6248 9102.46 60.0421 12.4079 9207.32 60.3352 12.1939 9313.38 60.6037 11.9828 9420.67 60.8508 11.7747 9529.20 61.0795 11.5694 9638.97 61.2916 11.3668 9750.01 61.4887 11.1670 9862.33 61.6725 10.9702 9975.95 61.8440 10.7757 10090.9 62.0043 10.5843 10207.1 62.1543 10.3957 10324.7 62.2948 10.2098 10443.6 62.4265 10.0266 10563.9 62.5499 9.84621 10685.6 62.6658 9.66852 10808.7 62.7745 9.49353 10933.3 62.8766 9.32121 11059.2 62.9723 9.15156 11186.6 63.0622 8.98454 11315.5 63.1465 8.82015 11445.8 63.2256 8.65834 11577.7 63.2998 8.49911 11711.1 63.3693 8.34243 11846.0 63.4343 8.18827 11982.4 63.4952 8.03660 12120.5 63.5522 7.88742 12260.1 63.6053 7.74067 12401.3 63.6549 7.59635 12544.2 63.7011 7.45443 12688.7 63.7441 7.31487 12834.9 63.7840 7.17765 12982.7 63.8210 7.04274 13132.3 63.8552 6.91012 13283.6 63.8868 6.77976 13436.6 63.9159 6.65162 13591.4 63.9426 6.52569 13748.0 63.9669 6.40193 13906.3 63.9892 6.28031 14066.5 64.0093 6.16080 14228.6 64.0275 6.04339 14392.5 64.0437 5.92803 14558.3 64.0582 5.81471 14726.0 64.0710 5.70339 14895.6 64.0821 5.59404 15067.2 64.0917 5.48664 15240.8 64.0998 5.38115 15416.4 64.1065 5.27756 15594.0 64.1118 5.17582 15773.6 64.1158 5.07593 15955.3 64.1186 4.97784 16139.1 64.1203 4.88153 16325.1 64.1208 4.78697 16513.1 64.1202 4.69414 16703.4 64.1187 4.60300 16895.8 64.1161 4.51354 17090.4 64.1127 4.42573 17287.3 64.1083 4.33953 17486.4 64.1032 4.25493 17687.9 64.0972 4.17190 17891.7 64.0905 4.09041 18097.8 64.0830 4.01044 18306.2 64.0749 3.93196 18517.1 64.0661 3.85495 18730.4 64.0567 3.77938 18946.2 64.0467 3.70524 19164.5 64.0362 3.63249 19385.3 64.0251 3.56111 19608.6 64.0135 3.49108 19834.5 64.0014 3.42238 20062.9 63.9888 3.35498 20294.1 63.9758 3.28886 20527.9 63.9624 3.22400 20764.3 63.9486 3.16038 21003.5 63.9345 3.09798 21245.5 63.9199 3.03677 21490.2 63.9051 2.97673 21737.8 63.8899 2.91785 21988.2 63.8744 2.86009 22241.5 63.8586 2.80345 22497.8 63.8425 2.74790 22756.9 63.8262 2.69343 23019.1 63.8096 2.64000 23284.3 63.7927 2.58762 23552.5 63.7757 2.53624 23823.8 63.7584 2.48587 24098.3 63.7409 2.43647 24375.9 63.7232 2.38804 24656.7 63.7053 2.34055 24940.7 63.6872 2.29398 25228.0 63.6689 2.24833 25518.7 63.6504 2.20356 25812.6 63.6318 2.15967 26110.0 63.6130 2.11665 26410.8 63.5940 2.07446 26715.0 63.5749 2.03310 27022.8 63.5556 1.99256 27334.1 63.5361 1.95281 27649.0 63.5165 1.91384 27967.5 63.4966 1.87565 28289.7 63.4767 1.83820 28615.6 63.4565 1.80149 28945.2 63.4362 1.76551 29278.7 63.4157 1.73024 29615.9 63.3950 1.69566 29957.1 63.3743 1.66177 30000.0 63.3721 1.65758 periodictable-1.5.0/periodictable/xsf/ge.nff000066400000000000000000000317011310514471200210170ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.01183 10.1617 -9999. 3.05548 10.3261 -9999. 3.09976 10.4931 -9999. 3.14468 10.6628 -9999. 3.19025 10.8353 -9999. 3.21825 11.0106 -9999. 3.20755 11.1886 -9999. 3.19689 11.3696 -9999. 3.18626 11.5535 -9999. 3.17568 11.7404 -9999. 3.16687 11.9303 -9999. 3.15816 12.1232 -9999. 3.14947 12.3193 -9999. 3.14080 12.5186 -9999. 3.13216 12.7210 -9999. 3.11421 12.9268 -9999. 3.01683 13.1359 -9999. 2.92250 13.3483 -9999. 2.83112 13.5642 -9999. 2.74260 13.7836 -9999. 2.65685 14.0066 -9999. 2.57378 14.2331 -9999. 2.49330 14.4633 -9999. 2.41534 14.6973 -9999. 2.33982 14.9350 -9999. 2.26666 15.1765 -9999. 2.18698 15.4220 -9999. 2.10697 15.6714 -9999. 2.02987 15.9249 -9999. 1.95560 16.1825 -9999. 1.88405 16.4442 -9999. 1.81511 16.7102 -9999. 1.74870 16.9805 -9999. 1.68472 17.2551 -9999. 1.62308 17.5342 -9999. 1.56369 17.8178 -9999. 1.50648 18.1060 -9999. 1.45136 18.3989 -9999. 1.39825 18.6964 -9999. 1.34406 18.9988 -9999. 1.28586 19.3061 -9999. 1.23018 19.6184 -9999. 1.17690 19.9357 -9999. 1.12594 20.2582 -9999. 1.07718 20.5858 -9999. 1.03054 20.9188 -9999. 0.982739 21.2571 -9999. 0.923062 21.6009 -9999. 0.867009 21.9503 -9999. 0.814359 22.3053 -9999. 0.764906 22.6661 -9999. 0.718458 23.0327 -9999. 0.674829 23.4053 -9999. 0.633850 23.7838 -9999. 0.591594 24.1685 -9999. 0.548427 24.5594 -9999. 0.508410 24.9566 -9999. 0.473964 25.3603 -9999. 0.461030 25.7705 -9999. 0.448450 26.1873 -9999. 0.444589 26.6109 -9999. 0.450264 27.0413 -9999. 0.456011 27.4786 -9999. 0.461832 27.9231 -9999. 0.483682 28.3747 -9999. 0.538895 28.8337 -9999. 0.698676 29.3000 0.440124 0.905829 29.7739 0.272233 1.17440 30.2555 0.162958 1.52262 30.7449 0.217163 1.97406 31.2421 0.453769 2.22141 31.7475 0.682046 2.38416 32.2609 0.882264 2.50492 32.7827 1.13720 2.51621 33.3130 1.28150 2.45219 33.8518 1.37051 2.39089 34.3993 1.42861 2.33813 34.9557 1.46459 2.28654 35.5211 1.47891 2.23706 36.0956 1.47827 2.19667 36.6794 1.46483 2.15701 37.2727 1.43153 2.11806 37.8755 1.36477 2.09638 38.4882 1.30954 2.10723 39.1107 1.26061 2.11814 39.7432 1.20727 2.12910 40.3861 1.14217 2.14324 41.0393 1.07603 2.17356 41.7031 1.00925 2.20431 42.3776 0.930394 2.23549 43.0630 0.827077 2.29344 43.7595 0.745990 2.37463 44.4673 0.674834 2.45869 45.1865 0.604867 2.54573 45.9174 0.529002 2.63585 46.6600 0.452626 2.75745 47.4147 0.398433 2.89179 48.1816 0.367368 3.03269 48.9609 0.368932 3.15118 49.7528 0.351783 3.25097 50.5576 0.326497 3.35393 51.3753 0.299997 3.46014 52.2062 0.273877 3.56893 53.0506 0.246499 3.67975 53.9087 0.218209 3.79400 54.7806 0.188729 3.91180 55.6667 0.155599 4.03326 56.5670 0.124148 4.16976 57.4820 0.986014E-01 4.31092 58.4117 0.772277E-01 4.45687 59.3564 0.597239E-01 4.60775 60.3165 0.461093E-01 4.76374 61.2921 0.361662E-01 4.92594 62.2834 0.326300E-01 5.09471 63.2908 0.359316E-01 5.26925 64.3145 0.470171E-01 5.44978 65.3547 0.674639E-01 5.63649 66.4118 0.998144E-01 5.82960 67.4859 0.148377 6.02932 68.5775 0.234250 6.24339 69.6867 0.348107 6.38321 70.8138 0.430821 6.50992 71.9591 0.497067 6.63914 73.1230 0.558261 6.77093 74.3057 0.616580 6.90534 75.5076 0.673491 7.04241 76.7289 0.729977 7.18220 77.9699 0.786845 7.32477 79.2310 0.844725 7.47017 80.5125 0.904338 7.61845 81.8147 0.966540 7.76968 83.1380 1.03362 7.92391 84.4827 1.10337 8.07343 85.8491 1.17220 8.22490 87.2377 1.24154 8.37922 88.6487 1.31266 8.53643 90.0825 1.38605 8.69659 91.5395 1.46219 8.85976 93.0201 1.54154 9.02599 94.5246 1.62469 9.19533 96.0535 1.71230 9.36786 97.6071 1.80605 9.54362 99.1858 1.91220 9.71828 100.790 2.01653 9.88541 102.420 2.11982 10.0554 104.077 2.22529 10.2283 105.760 2.33371 10.4042 107.471 2.44578 10.5831 109.209 2.56195 10.7651 110.975 2.68284 10.9503 112.770 2.80893 11.1386 114.594 2.94092 11.3301 116.448 3.07946 11.5250 118.331 3.22554 11.7232 120.245 3.38036 11.9248 122.190 3.54595 12.1298 124.166 3.72626 12.3384 126.175 3.93605 12.5441 128.215 4.14322 12.7108 130.289 4.34297 12.8798 132.397 4.54134 13.0510 134.538 4.74284 13.2244 136.714 4.94919 13.4002 138.925 5.16203 13.5784 141.172 5.38294 13.7589 143.456 5.61394 13.9417 145.776 5.85763 14.1271 148.134 6.11865 14.3149 150.530 6.40872 14.5052 152.964 6.75914 14.6551 155.439 7.06766 14.7403 157.953 7.35360 14.8260 160.507 7.63003 14.9123 163.103 7.90170 14.9990 165.742 8.17130 15.0862 168.422 8.44065 15.1739 171.146 8.71121 15.2621 173.915 8.98432 15.3509 176.727 9.26121 15.4401 179.586 9.54331 15.5299 182.491 9.83225 15.6202 185.442 10.1302 15.7110 188.442 10.4402 15.8024 191.489 10.7677 15.8943 194.587 11.1270 15.9867 197.734 11.5612 16.0281 200.932 11.9347 15.9773 204.182 12.2704 15.9267 207.485 12.5866 15.8763 210.840 12.8900 15.8260 214.251 13.1838 15.7759 217.716 13.4704 15.7259 221.237 13.7513 15.6762 224.816 14.0278 15.6265 228.452 14.3010 15.5771 232.147 14.5718 15.5277 235.902 14.8411 15.4785 239.717 15.1099 15.4295 243.595 15.3791 15.3807 247.535 15.6498 15.3320 251.538 15.9236 15.2834 255.607 16.2024 15.2350 259.741 16.4890 15.1868 263.942 16.7887 15.1387 268.211 17.1284 15.0908 272.549 17.5025 14.9669 276.957 17.8168 14.7856 281.437 18.0944 14.6064 285.989 18.3504 14.4295 290.615 18.5905 14.2547 295.315 18.8179 14.0820 300.092 19.0344 13.9114 304.945 19.2417 13.7428 309.878 19.4409 13.5764 314.890 19.6328 13.4119 319.983 19.8182 13.2494 325.158 19.9977 13.0889 330.418 20.1721 12.9303 335.762 20.3417 12.7737 341.192 20.5073 12.6189 346.711 20.6694 12.4660 352.319 20.8287 12.3150 358.017 20.9862 12.1658 363.808 21.1439 12.0184 369.692 21.3099 11.8645 375.672 21.4642 11.6986 381.748 21.6066 11.5351 387.922 21.7434 11.3738 394.197 21.8757 11.2148 400.573 22.0044 11.0580 407.052 22.1305 10.9034 413.635 22.2551 10.7510 420.326 22.3795 10.6007 427.124 22.5055 10.4525 434.032 22.6486 10.3064 441.052 22.7953 10.1255 448.186 22.9146 9.92938 455.435 23.0164 9.73703 462.802 23.1067 9.54840 470.287 23.1881 9.36343 477.894 23.2619 9.18205 485.623 23.3290 9.00417 493.478 23.3902 8.82973 501.459 23.4461 8.65869 509.570 23.4971 8.49095 517.812 23.5436 8.32647 526.187 23.5860 8.16517 534.698 23.6248 8.00700 543.346 23.6604 7.85188 552.134 23.6934 7.69978 561.065 23.7248 7.55061 570.139 23.7577 7.40434 579.361 23.7926 7.24878 588.732 23.8162 7.08750 598.254 23.8284 6.92980 607.930 23.8342 6.77561 617.763 23.8342 6.62486 627.755 23.8290 6.47746 637.908 23.8189 6.33334 648.226 23.8043 6.19242 658.711 23.7854 6.05464 669.365 23.7622 5.91992 680.191 23.7350 5.78821 691.193 23.7038 5.65942 702.372 23.6690 5.53350 713.733 23.6304 5.41038 725.277 23.5922 5.29000 737.008 23.5481 5.16382 748.928 23.4950 5.04011 761.042 23.4351 4.91936 773.351 23.3689 4.80150 785.859 23.2965 4.68647 798.570 23.2177 4.57419 811.486 23.1325 4.46460 824.611 23.0406 4.35764 837.949 22.9417 4.25324 851.502 22.8355 4.15134 865.274 22.7219 4.05188 879.269 22.6038 3.95175 893.491 22.4717 3.84724 907.943 22.3231 3.74549 922.628 22.1594 3.64643 937.551 21.9777 3.54999 952.715 21.7725 3.46040 968.124 21.5556 3.38610 983.783 21.3242 3.31343 999.695 21.0720 3.24258 1015.86 20.7937 3.17352 1032.29 20.4853 3.10813 1048.99 20.1397 3.04357 1065.96 19.7462 2.97979 1083.20 19.2915 2.91735 1100.72 18.7562 2.85623 1118.52 18.1109 2.79642 1136.61 17.3071 2.73776 1155. 16.2561 2.68034 1173.68 14.7694 2.62413 1192.66 12.3113 2.56910 1211.95 5.36147 2.51522 1216.90 -12.3949 2.50172 1217.10 -12.3903 16.7824 1231.55 10.4277 16.6482 1251.47 14.5274 16.4675 1271.72 16.7825 16.2902 1292.29 18.3764 16.1167 1313.19 19.6267 15.9451 1334.43 20.6657 15.7754 1356.01 21.5628 15.6075 1377.94 22.3592 15.4412 1400.23 23.0821 15.2767 1414.50 23.5101 15.1736 1414.70 23.5159 15.1726 1422.88 23.7522 15.1143 1445.89 24.3891 14.9533 1469.28 25.0164 14.7768 1493.04 25.6447 14.5762 1517.19 26.2152 14.2699 1541.73 26.7087 13.9552 1566.67 27.1411 13.6474 1592.01 27.5330 13.3465 1617.76 27.8914 13.0523 1643.92 28.2214 12.7644 1670.51 28.5271 12.4830 1697.53 28.8116 12.2078 1724.99 29.0840 11.9387 1752.89 29.3384 11.6634 1781.24 29.5711 11.3904 1810.05 29.7845 11.1208 1839.32 29.9801 10.8575 1869.07 30.1611 10.6004 1899.30 30.3289 10.3494 1930.02 30.4849 10.1046 1961.24 30.6304 9.86546 1992.96 30.7643 9.63179 2025.20 30.8964 9.40909 2057.95 31.0213 9.18062 2091.24 31.1339 8.95641 2125.06 31.2378 8.73680 2159.43 31.3336 8.52180 2194.36 31.4223 8.31139 2229.85 31.5040 8.10488 2265.92 31.5791 7.90307 2302.57 31.6482 7.70557 2339.81 31.7117 7.51231 2377.66 31.7697 7.32319 2416.11 31.8229 7.13839 2455.19 31.8712 6.95735 2494.90 31.9148 6.78052 2535.26 31.9543 6.60779 2576.26 31.9898 6.43898 2617.93 32.0217 6.27408 2660.27 32.0501 6.11297 2703.30 32.0750 5.95529 2747.03 32.0967 5.80156 2791.46 32.1155 5.65125 2836.61 32.1313 5.50473 2882.49 32.1447 5.36177 2929.11 32.1558 5.22209 2976.48 32.1644 5.08564 3024.63 32.1707 4.95248 3073.55 32.1749 4.82268 3123.26 32.1772 4.69599 3173.78 32.1777 4.57240 3225.11 32.1764 4.45185 3277.27 32.1735 4.33429 3330.28 32.1691 4.21963 3384.15 32.1633 4.10784 3438.88 32.1561 3.99882 3494.50 32.1476 3.89254 3551.02 32.1380 3.78896 3608.46 32.1273 3.68797 3666.82 32.1155 3.58952 3726.13 32.1027 3.49358 3786.40 32.0890 3.40010 3847.64 32.0745 3.30901 3909.87 32.0592 3.22022 3973.11 32.0431 3.13369 4037.38 32.0263 3.04945 4102.68 32.0089 2.96733 4169.03 31.9909 2.88735 4236.46 31.9723 2.80945 4304.98 31.9532 2.73350 4374.62 31.9335 2.65960 4445.37 31.9134 2.58763 4517.27 31.8929 2.51751 4590.33 31.8719 2.44916 4664.58 31.8505 2.38268 4740.03 31.8288 2.31789 4816.69 31.8067 2.25489 4894.60 31.7843 2.19350 4973.77 31.7616 2.13369 5054.21 31.7385 2.07546 5135.96 31.7152 2.01882 5219.03 31.6916 1.96364 5303.44 31.6677 1.90987 5389.22 31.6434 1.85762 5476.39 31.6190 1.80674 5564.97 31.5943 1.75713 5654.98 31.5693 1.70888 5746.44 31.5440 1.66195 5839.39 31.5184 1.61620 5933.83 31.4925 1.57174 6029.81 31.4664 1.52841 6127.33 31.4399 1.48627 6226.44 31.4130 1.44521 6327.15 31.3857 1.40529 6429.48 31.3581 1.36645 6533.48 31.3301 1.32852 6639.15 31.3015 1.29169 6746.54 31.2724 1.25590 6855.65 31.2429 1.22103 6966.54 31.2127 1.18703 7079.22 31.1818 1.15398 7193.72 31.1503 1.12181 7310.07 31.1179 1.09049 7428.31 31.0846 1.06002 7548.45 31.0503 1.03036 7670.54 31.0150 1.00150 7794.61 30.9784 0.973404 7920.68 30.9404 0.946056 8048.79 30.9009 0.919435 8178.98 30.8596 0.893531 8311.26 30.8164 0.868318 8445.69 30.7708 0.843783 8582.29 30.7227 0.819886 8721.11 30.6715 0.796635 8862.16 30.6168 0.774005 9005.50 30.5581 0.751970 9151.16 30.4944 0.730529 9299.17 30.4249 0.709655 9449.58 30.3484 0.689338 9602.42 30.2630 0.669557 9757.73 30.1666 0.650313 9915.55 30.0560 0.631568 10075.9 29.9265 0.613322 10238.9 29.7705 0.595560 10404.5 29.5756 0.578268 10572.8 29.3184 0.561433 10743.8 28.9463 0.545044 10917.6 28.2956 0.529086 11094.2 25.1168 0.513550 11103.0 20.2986 0.512790 11103.2 20.2990 3.89712 11273.6 28.3851 3.80828 11455.9 29.2238 3.71689 11641.2 29.7193 3.62704 11829.5 30.0738 3.53874 12020.8 30.3497 3.45199 12215.3 30.5748 3.36682 12412.8 30.7642 3.28322 12613.6 30.9268 3.20119 12817.6 31.0685 3.12074 13025.0 31.1934 3.04186 13235.6 31.3045 2.96456 13449.7 31.4039 2.88881 13667.2 31.4933 2.81462 13888.3 31.5740 2.74198 14112.9 31.6472 2.67087 14341.2 31.7137 2.60128 14573.1 31.7743 2.53320 14808.9 31.8295 2.46661 15048.4 31.8800 2.40149 15291.8 31.9260 2.33783 15539.1 31.9682 2.27562 15790.4 32.0067 2.21482 16045.8 32.0420 2.15542 16305.4 32.0742 2.09741 16569.1 32.1037 2.04076 16837.1 32.1306 1.98544 17109.4 32.1551 1.93145 17386.1 32.1774 1.87875 17667.4 32.1977 1.82733 17953.1 32.2161 1.77716 18243.5 32.2328 1.72823 18538.6 32.2478 1.68050 18838.4 32.2613 1.63396 19143.1 32.2734 1.58858 19452.7 32.2842 1.54434 19767.4 32.2938 1.50122 20087.1 32.3022 1.45920 20412.0 32.3096 1.41825 20742.1 32.3160 1.37836 21077.6 32.3214 1.33949 21418.5 32.3260 1.30163 21765.0 32.3298 1.26476 22117.0 32.3329 1.22885 22474.7 32.3352 1.19389 22838.2 32.3369 1.15985 23207.6 32.3380 1.12672 23583.0 32.3385 1.09446 23964.4 32.3385 1.06307 24352.0 32.3381 1.03252 24745.9 32.3371 1.00279 25146.2 32.3358 0.973864 25552.9 32.3340 0.945722 25966.2 32.3319 0.918345 26386.1 32.3295 0.891714 26812.9 32.3268 0.865812 27246.6 32.3238 0.840620 27687.3 32.3205 0.816123 28135.1 32.3170 0.792300 28590.2 32.3133 0.769138 29052.6 32.3095 0.746618 29522.5 32.3076 0.724724 30000.0 32.2946 0.703442 periodictable-1.5.0/periodictable/xsf/h.nff000066400000000000000000000350211310514471200206520ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.239540E-16 10.1617 -9999. 0.243414E-16 10.3261 -9999. 0.247351E-16 10.4931 -9999. 0.251352E-16 10.6628 -9999. 0.255417E-16 10.8353 -9999. 0.259549E-16 11.0106 -9999. 0.263746E-16 11.1886 -9999. 0.268012E-16 11.3696 -9999. 0.272347E-16 11.5535 -9999. 0.276752E-16 11.7404 -9999. 0.281229E-16 11.9303 -9999. 0.285777E-16 12.1232 -9999. 0.290399E-16 12.3193 -9999. 0.295096E-16 12.5186 -9999. 0.299869E-16 12.7210 -9999. 0.304720E-16 12.9268 -9999. 0.309648E-16 13.1359 -9999. 0.314656E-16 13.3483 -9999. 0.319746E-16 13.5642 -9999. 0.324917E-16 13.7836 -9999. 0.330173E-16 14.0066 -9999. 0.335513E-16 14.2331 -9999. 0.340940E-16 14.4633 -9999. 0.346454E-16 14.6973 -9999. 0.352058E-16 14.9350 -9999. 0.357752E-16 15.1765 -9999. 0.363538E-16 15.4220 -9999. 0.369418E-16 15.6714 -9999. 0.375393E-16 15.9000 -9999. 0.380868E-16 16.1000 -9999. 0.611915E-14 16.1825 -9999. 0.392474E-12 16.4442 -9999. 0.185104E-06 16.7102 -9999. 0.873013E-01 16.9805 -9999. 0.960229 17.2551 -9999. 0.931364 17.5342 -9999. 0.903367 17.8178 -9999. 0.876211 18.1060 -9999. 0.849873 18.3989 -9999. 0.824325 18.6964 -9999. 0.799546 18.9988 -9999. 0.775511 19.3061 -9999. 0.752199 19.6184 -9999. 0.729131 19.9357 -9999. 0.705642 20.2582 -9999. 0.682908 20.5858 -9999. 0.660907 20.9188 -9999. 0.639615 21.2571 -9999. 0.619009 21.6009 -9999. 0.599067 21.9503 -9999. 0.579767 22.3053 -9999. 0.561089 22.6661 -9999. 0.543013 23.0327 -9999. 0.525519 23.4053 -9999. 0.508588 23.7838 -9999. 0.492203 24.1685 -9999. 0.476347 24.5594 -9999. 0.460795 24.9566 -9999. 0.445595 25.3603 -9999. 0.430897 25.7705 -9999. 0.416683 26.1873 -9999. 0.402938 26.6109 -9999. 0.389647 27.0413 -9999. 0.376794 27.4786 -9999. 0.364365 27.9231 -9999. 0.352346 28.3747 -9999. 0.340723 28.8337 -9999. 0.329484 29.3000 1.07342 0.318616 29.7739 1.07482 0.308106 30.2555 1.07577 0.298515 30.7449 1.07696 0.289718 31.2421 1.07825 0.281082 31.7475 1.07940 0.272600 32.2609 1.08039 0.264377 32.7827 1.08123 0.256403 33.3130 1.08195 0.248667 33.8518 1.08254 0.241163 34.3993 1.08300 0.233886 34.9557 1.08337 0.226829 35.5211 1.08362 0.219960 36.0956 1.08376 0.213297 36.6794 1.08380 0.206836 37.2727 1.08375 0.200567 37.8755 1.08362 0.194485 38.4882 1.08341 0.188585 39.1107 1.08312 0.182864 39.7432 1.08278 0.177319 40.3861 1.08238 0.171944 41.0393 1.08198 0.166725 41.7031 1.08151 0.161576 42.3776 1.08094 0.156586 43.0630 1.08032 0.151750 43.7595 1.07964 0.147051 44.4673 1.07892 0.142495 45.1865 1.07815 0.138078 45.9174 1.07735 0.133798 46.6600 1.07651 0.129650 47.4147 1.07564 0.125634 48.1816 1.07476 0.121741 48.9609 1.07386 0.117960 49.7528 1.07294 0.114297 50.5576 1.07201 0.110729 51.3753 1.07105 0.107265 52.2062 1.07008 0.103910 53.0506 1.06908 0.100659 53.9087 1.06808 0.975106E-01 54.7806 1.06708 0.944602E-01 55.6667 1.06607 0.915051E-01 56.5670 1.06505 0.886427E-01 57.4820 1.06404 0.858697E-01 58.4117 1.06302 0.831839E-01 59.3564 1.06202 0.805822E-01 60.3165 1.06102 0.780614E-01 61.2921 1.06005 0.756082E-01 62.2834 1.05907 0.732062E-01 63.2908 1.05809 0.708702E-01 64.3145 1.05711 0.685836E-01 65.3547 1.05611 0.663707E-01 66.4118 1.05511 0.642289E-01 67.4859 1.05411 0.621564E-01 68.5775 1.05312 0.601513E-01 69.6867 1.05213 0.582104E-01 70.8138 1.05114 0.563323E-01 71.9591 1.05017 0.545150E-01 73.1230 1.04920 0.527566E-01 74.3057 1.04825 0.510546E-01 75.5076 1.04730 0.494071E-01 76.7289 1.04637 0.478129E-01 77.9699 1.04544 0.462703E-01 79.2310 1.04453 0.447771E-01 80.5125 1.04364 0.433320E-01 81.8147 1.04276 0.419309E-01 83.1380 1.04190 0.405709E-01 84.4827 1.04105 0.392348E-01 85.8491 1.04020 0.379426E-01 87.2377 1.03936 0.366920E-01 88.6487 1.03853 0.354828E-01 90.0825 1.03770 0.343137E-01 91.5395 1.03689 0.331831E-01 93.0201 1.03609 0.320897E-01 94.5246 1.03531 0.310324E-01 96.0535 1.03453 0.300101E-01 97.6071 1.03377 0.290214E-01 99.1858 1.03302 0.280652E-01 100.790 1.03229 0.271368E-01 102.420 1.03156 0.262374E-01 104.077 1.03085 0.253737E-01 105.760 1.03015 0.245376E-01 107.471 1.02946 0.237290E-01 109.209 1.02879 0.229472E-01 110.975 1.02813 0.221911E-01 112.770 1.02749 0.214598E-01 114.594 1.02685 0.207528E-01 116.448 1.02623 0.200690E-01 118.331 1.02562 0.194077E-01 120.245 1.02503 0.187681E-01 122.190 1.02445 0.181496E-01 124.166 1.02389 0.175503E-01 126.175 1.02334 0.169580E-01 128.215 1.02279 0.163857E-01 130.289 1.02225 0.158328E-01 132.397 1.02172 0.152983E-01 134.538 1.02120 0.147820E-01 136.714 1.02069 0.142832E-01 138.925 1.02019 0.138012E-01 141.172 1.01970 0.133353E-01 143.456 1.01923 0.128851E-01 145.776 1.01876 0.124503E-01 148.134 1.01830 0.120301E-01 150.530 1.01785 0.116240E-01 152.964 1.01741 0.112318E-01 155.439 1.01698 0.108526E-01 157.953 1.01657 0.104863E-01 160.507 1.01616 0.101325E-01 163.103 1.01576 0.978989E-02 165.742 1.01537 0.945798E-02 168.422 1.01499 0.913121E-02 171.146 1.01462 0.881506E-02 173.915 1.01425 0.850979E-02 176.727 1.01390 0.821516E-02 179.586 1.01354 0.793080E-02 182.491 1.01320 0.765630E-02 185.442 1.01286 0.739119E-02 188.442 1.01253 0.713519E-02 191.489 1.01221 0.688805E-02 194.587 1.01190 0.664962E-02 197.734 1.01159 0.641948E-02 200.932 1.01129 0.619731E-02 204.182 1.01100 0.598257E-02 207.485 1.01071 0.577539E-02 210.840 1.01043 0.557553E-02 214.251 1.01016 0.538225E-02 217.716 1.00989 0.519584E-02 221.237 1.00963 0.501608E-02 224.816 1.00938 0.484241E-02 228.452 1.00913 0.467475E-02 232.147 1.00889 0.451287E-02 235.902 1.00866 0.435661E-02 239.717 1.00843 0.420577E-02 243.595 1.00821 0.406014E-02 247.535 1.00799 0.391955E-02 251.538 1.00777 0.378382E-02 255.607 1.00757 0.365277E-02 259.741 1.00737 0.352625E-02 263.942 1.00717 0.340413E-02 268.211 1.00698 0.328624E-02 272.549 1.00679 0.317240E-02 276.957 1.00661 0.306252E-02 281.437 1.00643 0.295645E-02 285.989 1.00626 0.285407E-02 290.615 1.00609 0.275523E-02 295.315 1.00592 0.265984E-02 300.092 1.00577 0.256773E-02 304.945 1.00561 0.247864E-02 309.878 1.00546 0.239241E-02 314.890 1.00531 0.230717E-02 319.983 1.00517 0.222440E-02 325.158 1.00503 0.214460E-02 330.418 1.00489 0.206767E-02 335.762 1.00476 0.199351E-02 341.192 1.00463 0.192206E-02 346.711 1.00450 0.185312E-02 352.319 1.00438 0.178664E-02 358.017 1.00426 0.172253E-02 363.808 1.00414 0.166075E-02 369.692 1.00402 0.160119E-02 375.672 1.00391 0.154377E-02 381.748 1.00380 0.148837E-02 387.922 1.00370 0.143498E-02 394.197 1.00359 0.138356E-02 400.573 1.00349 0.133393E-02 407.052 1.00340 0.128607E-02 413.635 1.00330 0.123994E-02 420.326 1.00321 0.119547E-02 427.124 1.00312 0.115259E-02 434.032 1.00303 0.111124E-02 441.052 1.00294 0.107134E-02 448.186 1.00286 0.103287E-02 455.435 1.00278 0.995812E-03 462.802 1.00270 0.960079E-03 470.287 1.00262 0.925627E-03 477.894 1.00255 0.892416E-03 485.623 1.00248 0.860393E-03 493.478 1.00241 0.829518E-03 501.459 1.00234 0.799751E-03 509.570 1.00227 0.771052E-03 517.812 1.00221 0.743383E-03 526.187 1.00214 0.716714E-03 534.698 1.00208 0.690999E-03 543.346 1.00202 0.666203E-03 552.134 1.00196 0.642299E-03 561.065 1.00191 0.619249E-03 570.139 1.00185 0.597026E-03 579.361 1.00180 0.575597E-03 588.732 1.00175 0.554945E-03 598.254 1.00170 0.535035E-03 607.930 1.00165 0.515832E-03 617.763 1.00160 0.497219E-03 627.755 1.00155 0.479195E-03 637.908 1.00151 0.461657E-03 648.226 1.00146 0.444758E-03 658.711 1.00142 0.428477E-03 669.365 1.00138 0.412792E-03 680.191 1.00134 0.397680E-03 691.193 1.00130 0.383120E-03 702.372 1.00126 0.369094E-03 713.733 1.00122 0.355582E-03 725.277 1.00119 0.342565E-03 737.008 1.00115 0.330026E-03 748.928 1.00112 0.317945E-03 761.042 1.00109 0.306305E-03 773.351 1.00105 0.295082E-03 785.859 1.00102 0.284275E-03 798.570 1.00099 0.273869E-03 811.486 1.00096 0.263852E-03 824.611 1.00093 0.254197E-03 837.949 1.00091 0.244890E-03 851.502 1.00088 0.235924E-03 865.274 1.00085 0.227288E-03 879.269 1.00083 0.218969E-03 893.491 1.00080 0.210948E-03 907.943 1.00078 0.203223E-03 922.628 1.00075 0.195782E-03 937.551 1.00073 0.188614E-03 952.715 1.00071 0.181709E-03 968.124 1.00069 0.175057E-03 983.783 1.00067 0.168649E-03 999.695 1.00065 0.162475E-03 1015.86 1.00063 0.156527E-03 1032.29 1.00061 0.150796E-03 1048.99 1.00059 0.145275E-03 1065.96 1.00057 0.139956E-03 1083.20 1.00055 0.134833E-03 1100.72 1.00054 0.129897E-03 1118.52 1.00052 0.125140E-03 1136.61 1.00050 0.120559E-03 1155. 1.00049 0.116145E-03 1173.68 1.00047 0.111894E-03 1192.66 1.00046 0.107798E-03 1211.95 1.00044 0.103851E-03 1231.55 1.00043 0.100048E-03 1251.47 1.00042 0.963431E-04 1271.72 1.00040 0.927658E-04 1292.29 1.00039 0.893136E-04 1313.19 1.00038 0.859897E-04 1334.43 1.00037 0.827890E-04 1356.01 1.00035 0.797065E-04 1377.94 1.00034 0.767399E-04 1400.23 1.00033 0.738845E-04 1422.88 1.00032 0.711367E-04 1445.89 1.00031 0.684890E-04 1469.28 1.00030 0.659394E-04 1493.04 1.00029 0.634846E-04 1517.19 1.00028 0.611222E-04 1541.73 1.00027 0.588497E-04 1566.67 1.00026 0.566648E-04 1592.01 1.00025 0.545650E-04 1617.76 1.00025 0.525439E-04 1643.92 1.00024 0.505984E-04 1670.51 1.00023 0.487229E-04 1697.53 1.00022 0.469171E-04 1724.99 1.00021 0.451791E-04 1752.89 1.00021 0.434988E-04 1781.24 1.00020 0.418788E-04 1810.05 1.00019 0.403175E-04 1839.32 1.00019 0.388144E-04 1869.07 1.00018 0.373672E-04 1899.30 1.00017 0.359738E-04 1930.02 1.00017 0.346325E-04 1961.24 1.00016 0.333413E-04 1992.96 1.00016 0.320983E-04 2025.20 1.00015 0.309117E-04 2057.95 1.00015 0.297548E-04 2091.24 1.00014 0.286399E-04 2125.06 1.00014 0.275656E-04 2159.43 1.00013 0.265311E-04 2194.36 1.00013 0.255340E-04 2229.85 1.00012 0.245737E-04 2265.92 1.00012 0.236488E-04 2302.57 1.00011 0.227578E-04 2339.81 1.00011 0.218996E-04 2377.66 1.00010 0.210728E-04 2416.11 1.00010 0.202763E-04 2455.19 1.00010 0.195099E-04 2494.90 1.00009 0.187711E-04 2535.26 1.00009 0.180601E-04 2576.26 1.00008 0.173752E-04 2617.93 1.00008 0.167157E-04 2660.27 1.00008 0.160808E-04 2703.30 1.00007 0.154691E-04 2747.03 1.00007 0.148806E-04 2791.46 1.00007 0.143137E-04 2836.61 1.00007 0.137685E-04 2882.49 1.00006 0.132435E-04 2929.11 1.00006 0.127377E-04 2976.48 1.00006 0.122510E-04 3024.63 1.00005 0.117831E-04 3073.55 1.00005 0.113326E-04 3123.26 1.00005 0.108987E-04 3173.78 1.00005 0.104815E-04 3225.11 1.00005 0.100803E-04 3277.27 1.00004 0.969407E-05 3330.28 1.00004 0.932280E-05 3384.15 1.00004 0.896570E-05 3438.88 1.00004 0.862159E-05 3494.50 1.00003 0.829117E-05 3551.02 1.00003 0.797348E-05 3608.46 1.00003 0.766792E-05 3666.82 1.00003 0.737417E-05 3726.13 1.00003 0.709177E-05 3786.40 1.00003 0.682040E-05 3847.64 1.00002 0.655955E-05 3909.87 1.00002 0.630887E-05 3973.11 1.00002 0.606802E-05 4037.38 1.00002 0.583417E-05 4102.68 1.00002 0.561182E-05 4169.03 1.00002 0.539804E-05 4236.46 1.00001 0.519262E-05 4304.98 1.00001 0.499505E-05 4374.62 1.00001 0.480512E-05 4445.37 1.00001 0.462252E-05 4517.27 1.00001 0.444693E-05 4590.33 1.00001 0.427824E-05 4664.58 1.00001 0.411592E-05 4740.03 1.00001 0.395980E-05 4816.69 1.00001 0.380971E-05 4894.60 1.00000 0.366534E-05 4973.77 1.00000 0.352656E-05 5054.21 1.00000 0.339308E-05 5135.96 1.00000 0.326467E-05 5219.03 1.00000 0.314122E-05 5303.44 1.00000 0.302240E-05 5389.22 0.999999 0.290811E-05 5476.39 0.999998 0.279820E-05 5564.97 0.999997 0.269252E-05 5654.98 0.999996 0.259080E-05 5746.44 0.999995 0.249292E-05 5839.39 0.999995 0.239878E-05 5933.83 0.999994 0.230825E-05 6029.81 0.999993 0.222111E-05 6127.33 0.999993 0.213725E-05 6226.44 0.999992 0.205662E-05 6327.15 0.999991 0.197895E-05 6429.48 0.999991 0.190427E-05 6533.48 0.999990 0.183248E-05 6639.15 0.999990 0.176329E-05 6746.54 0.999989 0.169670E-05 6855.65 0.999988 0.163268E-05 6966.54 0.999988 0.157105E-05 7079.22 0.999987 0.151173E-05 7193.72 0.999987 0.145464E-05 7310.07 0.999986 0.139970E-05 7428.31 0.999986 0.134683E-05 7548.45 0.999985 0.129594E-05 7670.54 0.999985 0.124696E-05 7794.61 0.999985 0.119981E-05 7920.68 0.999984 0.115443E-05 8048.79 0.999984 0.111076E-05 8178.98 0.999983 0.106872E-05 8311.26 0.999983 0.102826E-05 8445.69 0.999983 0.989303E-06 8582.29 0.999982 0.951814E-06 8721.11 0.999982 0.915734E-06 8862.16 0.999982 0.880992E-06 9005.50 0.999981 0.847563E-06 9151.16 0.999981 0.815359E-06 9299.17 0.999981 0.784388E-06 9449.58 0.999980 0.754553E-06 9602.42 0.999980 0.725847E-06 9757.73 0.999980 0.698223E-06 9915.55 0.999980 0.671626E-06 10075.9 0.999979 0.646075E-06 10238.9 0.999979 0.621481E-06 10404.5 0.999979 0.597806E-06 10572.8 0.999979 0.575016E-06 10743.8 0.999978 0.553081E-06 10917.6 0.999978 0.531965E-06 11094.2 0.999978 0.511641E-06 11273.6 0.999978 0.492077E-06 11455.9 0.999978 0.473248E-06 11641.2 0.999977 0.455123E-06 11829.5 0.999977 0.437678E-06 12020.8 0.999977 0.420889E-06 12215.3 0.999977 0.404728E-06 12412.8 0.999977 0.389176E-06 12613.6 0.999977 0.374207E-06 12817.6 0.999976 0.359802E-06 13025.0 0.999976 0.345939E-06 13235.6 0.999976 0.332598E-06 13449.7 0.999976 0.319760E-06 13667.2 0.999976 0.307406E-06 13888.3 0.999976 0.295519E-06 14112.9 0.999975 0.284081E-06 14341.2 0.999975 0.273076E-06 14573.1 0.999975 0.262488E-06 14808.9 0.999975 0.252302E-06 15048.4 0.999975 0.242502E-06 15291.8 0.999975 0.233075E-06 15539.1 0.999975 0.224007E-06 15790.4 0.999975 0.215284E-06 16045.8 0.999974 0.206894E-06 16305.4 0.999974 0.198825E-06 16569.1 0.999974 0.191065E-06 16837.1 0.999974 0.183603E-06 17109.4 0.999974 0.176428E-06 17386.1 0.999974 0.169528E-06 17667.4 0.999974 0.162895E-06 17953.1 0.999974 0.156518E-06 18243.5 0.999974 0.150387E-06 18538.6 0.999974 0.144495E-06 18838.4 0.999974 0.138831E-06 19143.1 0.999974 0.133389E-06 19452.7 0.999974 0.128159E-06 19767.4 0.999973 0.123133E-06 20087.1 0.999973 0.118381E-06 20412.0 0.999973 0.113744E-06 20742.1 0.999973 0.109292E-06 21077.6 0.999973 0.105019E-06 21418.5 0.999973 0.100917E-06 21765.0 0.999973 0.969783E-07 22117.0 0.999973 0.931972E-07 22474.7 0.999973 0.895669E-07 22838.2 0.999973 0.860810E-07 23207.6 0.999973 0.827338E-07 23583.0 0.999973 0.795195E-07 23964.4 0.999973 0.764328E-07 24352.0 0.999973 0.734683E-07 24745.9 0.999973 0.706213E-07 25146.2 0.999973 0.678867E-07 25552.9 0.999973 0.652602E-07 25966.2 0.999973 0.627372E-07 26386.1 0.999972 0.603136E-07 26812.9 0.999972 0.579854E-07 27246.6 0.999972 0.557487E-07 27687.3 0.999972 0.535999E-07 28135.1 0.999972 0.515352E-07 28590.2 0.999972 0.495516E-07 29052.6 0.999972 0.476455E-07 29522.5 0.999972 0.458139E-07 30000.0 0.999972 0.440539E-07 periodictable-1.5.0/periodictable/xsf/he.nff000066400000000000000000000342121310514471200210200ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.951230E-16 10.1617 -9999. 0.966615E-16 10.3261 -9999. 0.982249E-16 10.4931 -9999. 0.998136E-16 10.6628 -9999. 0.101428E-15 10.8353 -9999. 0.103069E-15 11.0106 -9999. 0.104736E-15 11.1886 -9999. 0.106430E-15 11.3696 -9999. 0.108151E-15 11.5535 -9999. 0.109900E-15 11.7404 -9999. 0.111678E-15 11.9303 -9999. 0.113484E-15 12.1232 -9999. 0.115320E-15 12.3193 -9999. 0.117185E-15 12.5186 -9999. 0.119080E-15 12.7210 -9999. 0.121006E-15 12.9268 -9999. 0.122964E-15 13.1359 -9999. 0.124952E-15 13.3483 -9999. 0.126973E-15 13.5642 -9999. 0.129027E-15 13.7836 -9999. 0.131114E-15 14.0066 -9999. 0.133235E-15 14.2331 -9999. 0.135390E-15 14.4633 -9999. 0.137579E-15 14.6973 -9999. 0.139805E-15 14.9350 -9999. 0.142066E-15 15.1765 -9999. 0.144364E-15 15.4220 -9999. 0.146699E-15 15.6714 -9999. 0.149071E-15 15.9249 -9999. 0.151483E-15 16.1825 -9999. 0.153933E-15 16.4442 -9999. 0.156422E-15 16.7102 -9999. 0.158952E-15 16.9805 -9999. 0.161523E-15 17.2551 -9999. 0.164136E-15 17.5342 -9999. 0.166791E-15 17.8178 -9999. 0.169488E-15 18.1060 -9999. 0.172230E-15 18.3989 -9999. 0.175015E-15 18.6964 -9999. 0.177846E-15 18.9988 -9999. 0.180723E-15 19.3061 -9999. 0.183646E-15 19.6184 -9999. 0.186616E-15 19.9357 -9999. 0.189634E-15 20.2582 -9999. 0.192702E-15 20.5858 -9999. 0.195818E-15 20.9188 -9999. 0.198986E-15 21.2571 -9999. 0.202204E-15 21.6009 -9999. 0.205474E-15 21.9503 -9999. 0.208798E-15 22.3053 -9999. 0.212175E-15 22.6661 -9999. 0.215607E-15 23.0327 -9999. 0.219094E-15 23.4053 -9999. 0.222638E-15 23.7838 -9999. 0.226239E-15 24.1685 -9999. 0.229898E-15 24.5000 -9999. 0.233051E-15 24.7000 -9999. 2.76823 24.9566 -9999. 2.74626 25.3603 -9999. 2.71250 25.7705 -9999. 2.67915 26.1873 -9999. 2.64621 26.6109 -9999. 2.61368 27.0413 -9999. 2.58155 27.4786 -9999. 2.54981 27.9231 -9999. 2.51846 28.3747 -9999. 2.48750 28.8337 -9999. 2.45692 29.3000 0.267470 2.42672 29.7739 0.362843 2.39689 30.2555 0.451234 2.36853 30.7449 0.534067 2.34051 31.2421 0.611945 2.31282 31.7475 0.685527 2.28545 32.2609 0.755443 2.25841 32.7827 0.822211 2.23169 33.3130 0.887846 2.20529 33.8518 0.951922 2.17643 34.3993 1.01126 2.14429 34.9557 1.06605 2.11264 35.5211 1.11755 2.08145 36.0956 1.16625 2.05072 36.6794 1.21249 2.02044 37.2727 1.25652 1.99061 37.8755 1.29857 1.96122 38.4882 1.33882 1.93227 39.1107 1.37746 1.90374 39.7432 1.41467 1.87564 40.3861 1.45070 1.84795 41.0393 1.48603 1.82066 41.7031 1.52089 1.79233 42.3776 1.55372 1.76283 43.0630 1.58406 1.73381 43.7595 1.61289 1.70527 44.4673 1.64032 1.67720 45.1865 1.66651 1.64959 45.9174 1.69154 1.62244 46.6600 1.71551 1.59573 47.4147 1.73847 1.56946 48.1816 1.76048 1.54363 48.9609 1.78155 1.51822 49.7528 1.80162 1.49323 50.5576 1.82066 1.46914 51.3753 1.83934 1.44608 52.2062 1.85796 1.42339 53.0506 1.87622 1.40105 53.9087 1.89417 1.37907 54.7806 1.91185 1.35743 55.6667 1.92933 1.33612 56.5670 1.94669 1.31516 57.4820 1.96406 1.29452 58.4117 1.98163 1.27420 59.3564 1.99969 1.25421 60.3165 2.01823 1.23453 61.2921 2.04407 1.21515 62.2834 2.06855 1.18262 63.2908 2.08356 1.15072 64.3145 2.09590 1.11968 65.3547 2.10574 1.08948 66.4118 2.11331 1.06009 67.4859 2.11846 1.03150 68.5775 2.11942 1.00367 69.6867 2.11942 0.984085 70.8138 2.12233 0.965555 71.9591 2.12643 0.947372 73.1230 2.13093 0.929534 74.3057 2.13567 0.912031 75.5076 2.14055 0.894858 76.7289 2.14552 0.878008 77.9699 2.15055 0.861474 79.2310 2.15565 0.845254 80.5125 2.16086 0.829337 81.8147 2.16625 0.813721 83.1380 2.17187 0.798399 84.4827 2.17877 0.783365 85.8491 2.18648 0.766782 87.2377 2.19271 0.747865 88.6487 2.19719 0.729416 90.0825 2.20071 0.711421 91.5395 2.20348 0.693871 93.0201 2.20554 0.676753 94.5246 2.20703 0.660057 96.0535 2.20503 0.643774 97.6071 2.20321 0.634306 99.1858 2.21029 0.626245 100.790 2.21897 0.610238 102.420 2.22247 0.592700 104.077 2.22456 0.576422 105.760 2.22622 0.560590 107.471 2.22730 0.545193 109.209 2.22795 0.530220 110.975 2.22825 0.515658 112.770 2.22826 0.501495 114.594 2.22802 0.487721 116.448 2.22759 0.474327 118.331 2.22699 0.461300 120.245 2.22627 0.448630 122.190 2.22547 0.436308 124.166 2.22468 0.424326 126.175 2.22415 0.412671 128.215 2.22353 0.400327 130.289 2.22227 0.388289 132.397 2.22070 0.376612 134.538 2.21894 0.365286 136.714 2.21702 0.354301 138.925 2.21502 0.343646 141.172 2.21300 0.333312 143.456 2.21116 0.323288 145.776 2.20922 0.312726 148.134 2.20672 0.302492 150.530 2.20396 0.292593 152.964 2.20099 0.283018 155.439 2.19784 0.273756 157.953 2.19452 0.264798 160.507 2.19093 0.256133 163.103 2.18694 0.247841 165.742 2.18298 0.240850 168.422 2.17956 0.234056 171.146 2.17636 0.227455 173.915 2.17331 0.221039 176.727 2.17038 0.214804 179.586 2.16759 0.208745 182.491 2.16507 0.202828 185.442 2.16258 0.196671 188.442 2.15987 0.190702 191.489 2.15714 0.184913 194.587 2.15442 0.179300 197.734 2.15170 0.173858 200.932 2.14900 0.168581 204.182 2.14632 0.163464 207.485 2.14366 0.158502 210.840 2.14103 0.153691 214.251 2.13843 0.149026 217.716 2.13587 0.144503 221.237 2.13334 0.140116 224.816 2.13086 0.135862 228.452 2.12841 0.131736 232.147 2.12601 0.127734 235.902 2.12366 0.123855 239.717 2.12136 0.120093 243.595 2.11912 0.116446 247.535 2.11695 0.112909 251.538 2.11487 0.109480 255.607 2.11291 0.106155 259.741 2.11132 0.102930 263.942 2.11022 0.994029E-01 268.211 2.10794 0.941967E-01 272.549 2.10459 0.908527E-01 276.957 2.10213 0.879361E-01 281.437 2.09979 0.850658E-01 285.989 2.09752 0.822728E-01 290.615 2.09531 0.795694E-01 295.315 2.09315 0.769556E-01 300.092 2.09103 0.744264E-01 304.945 2.08896 0.719808E-01 309.878 2.08693 0.696165E-01 314.890 2.08493 0.673286E-01 319.983 2.08298 0.651156E-01 325.158 2.08107 0.629754E-01 330.418 2.07919 0.609068E-01 335.762 2.07736 0.589059E-01 341.192 2.07556 0.569701E-01 346.711 2.07380 0.550978E-01 352.319 2.07207 0.532873E-01 358.017 2.07038 0.515374E-01 363.808 2.06873 0.498434E-01 369.692 2.06712 0.482049E-01 375.672 2.06554 0.466205E-01 381.748 2.06401 0.450888E-01 387.922 2.06252 0.435958E-01 394.197 2.06106 0.421268E-01 400.573 2.05962 0.406931E-01 407.052 2.05819 0.393032E-01 413.635 2.05679 0.379631E-01 420.326 2.05541 0.366677E-01 427.124 2.05405 0.354162E-01 434.032 2.05273 0.342073E-01 441.052 2.05142 0.330398E-01 448.186 2.05015 0.319128E-01 455.435 2.04890 0.308267E-01 462.802 2.04767 0.297797E-01 470.287 2.04648 0.287692E-01 477.894 2.04531 0.277928E-01 485.623 2.04417 0.268495E-01 493.478 2.04305 0.259383E-01 501.459 2.04196 0.250583E-01 509.570 2.04090 0.242080E-01 517.812 2.03986 0.233872E-01 526.187 2.03884 0.225968E-01 534.698 2.03785 0.218376E-01 543.346 2.03688 0.211062E-01 552.134 2.03595 0.203995E-01 561.065 2.03505 0.196897E-01 570.139 2.03415 0.189948E-01 579.361 2.03326 0.183411E-01 588.732 2.03239 0.177148E-01 598.254 2.03155 0.171129E-01 607.930 2.03074 0.165319E-01 617.763 2.02994 0.159706E-01 627.755 2.02918 0.154266E-01 637.908 2.02845 0.148835E-01 648.226 2.02772 0.143347E-01 658.711 2.02698 0.137903E-01 669.365 2.02624 0.132667E-01 680.191 2.02548 0.128070E-01 691.193 2.02476 0.123966E-01 702.372 2.02410 0.120090E-01 713.733 2.02347 0.116123E-01 725.277 2.02285 0.112146E-01 737.008 2.02224 0.108303E-01 748.928 2.02165 0.104593E-01 761.042 2.02107 0.101010E-01 773.351 2.02050 0.975343E-02 785.859 2.01995 0.941479E-02 798.570 2.01942 0.908546E-02 811.486 2.01889 0.876776E-02 824.611 2.01837 0.846090E-02 837.949 2.01787 0.816451E-02 851.502 2.01737 0.788252E-02 865.274 2.01689 0.761410E-02 879.269 2.01642 0.735815E-02 893.491 2.01597 0.711087E-02 907.943 2.01553 0.687187E-02 922.628 2.01510 0.664090E-02 937.551 2.01469 0.641889E-02 952.715 2.01429 0.620460E-02 968.124 2.01389 0.599768E-02 983.783 2.01351 0.579768E-02 999.695 2.01315 0.560349E-02 1015.86 2.01279 0.541492E-02 1032.29 2.01244 0.522484E-02 1048.99 2.01210 0.504261E-02 1065.96 2.01177 0.486804E-02 1083.20 2.01144 0.469946E-02 1100.72 2.01113 0.453673E-02 1118.52 2.01082 0.437964E-02 1136.61 2.01051 0.422801E-02 1155. 2.01022 0.408163E-02 1173.68 2.00994 0.394032E-02 1192.66 2.00966 0.380385E-02 1211.95 2.00939 0.367215E-02 1231.55 2.00912 0.354507E-02 1251.47 2.00886 0.342352E-02 1271.72 2.00861 0.330743E-02 1292.29 2.00837 0.319685E-02 1313.19 2.00813 0.308992E-02 1334.43 2.00790 0.298659E-02 1356.01 2.00768 0.288676E-02 1377.94 2.00747 0.279024E-02 1400.23 2.00726 0.269692E-02 1422.88 2.00705 0.260671E-02 1445.89 2.00686 0.251952E-02 1469.28 2.00667 0.243458E-02 1493.04 2.00649 0.235152E-02 1517.19 2.00631 0.226698E-02 1541.73 2.00613 0.218491E-02 1566.67 2.00596 0.210584E-02 1592.01 2.00579 0.202959E-02 1617.76 2.00563 0.195614E-02 1643.92 2.00547 0.188542E-02 1670.51 2.00531 0.181712E-02 1697.53 2.00516 0.175132E-02 1724.99 2.00501 0.168795E-02 1752.89 2.00487 0.162588E-02 1781.24 2.00473 0.156576E-02 1810.05 2.00460 0.150761E-02 1839.32 2.00446 0.145162E-02 1869.07 2.00433 0.139770E-02 1899.30 2.00421 0.134578E-02 1930.02 2.00408 0.129580E-02 1961.24 2.00396 0.124768E-02 1992.96 2.00385 0.120133E-02 2025.20 2.00374 0.115724E-02 2057.95 2.00363 0.111375E-02 2091.24 2.00352 0.107178E-02 2125.06 2.00342 0.103129E-02 2159.43 2.00331 0.992242E-03 2194.36 2.00322 0.954583E-03 2229.85 2.00312 0.918257E-03 2265.92 2.00303 0.883244E-03 2302.57 2.00294 0.849488E-03 2339.81 2.00285 0.816939E-03 2377.66 2.00276 0.785565E-03 2416.11 2.00268 0.755334E-03 2455.19 2.00260 0.726220E-03 2494.90 2.00252 0.698159E-03 2535.26 2.00244 0.671108E-03 2576.26 2.00237 0.645079E-03 2617.93 2.00229 0.619993E-03 2660.27 2.00222 0.595853E-03 2703.30 2.00215 0.572612E-03 2747.03 2.00209 0.550216E-03 2791.46 2.00202 0.528679E-03 2836.61 2.00196 0.507958E-03 2882.49 2.00190 0.488010E-03 2929.11 2.00184 0.468829E-03 2976.48 2.00178 0.450387E-03 3024.63 2.00172 0.432633E-03 3073.55 2.00167 0.415595E-03 3123.26 2.00161 0.399184E-03 3173.78 2.00156 0.383415E-03 3225.11 2.00151 0.368279E-03 3277.27 2.00146 0.353746E-03 3330.28 2.00141 0.339766E-03 3384.15 2.00137 0.326349E-03 3438.88 2.00132 0.313472E-03 3494.50 2.00128 0.301111E-03 3551.02 2.00124 0.289253E-03 3608.46 2.00119 0.277876E-03 3666.82 2.00115 0.266965E-03 3726.13 2.00111 0.256505E-03 3786.40 2.00108 0.246479E-03 3847.64 2.00104 0.236873E-03 3909.87 2.00100 0.227671E-03 3973.11 2.00097 0.218857E-03 4037.38 2.00094 0.210456E-03 4102.68 2.00090 0.202354E-03 4169.03 2.00087 0.194569E-03 4236.46 2.00084 0.187095E-03 4304.98 2.00081 0.179915E-03 4374.62 2.00078 0.173016E-03 4445.37 2.00075 0.166391E-03 4517.27 2.00073 0.160023E-03 4590.33 2.00070 0.153908E-03 4664.58 2.00068 0.148032E-03 4740.03 2.00065 0.142385E-03 4816.69 2.00063 0.136961E-03 4894.60 2.00060 0.131745E-03 4973.77 2.00058 0.126734E-03 5054.21 2.00056 0.121919E-03 5135.96 2.00054 0.117291E-03 5219.03 2.00052 0.112845E-03 5303.44 2.00050 0.108569E-03 5389.22 2.00048 0.104459E-03 5476.39 2.00046 0.100509E-03 5564.97 2.00044 0.967114E-04 5654.98 2.00042 0.930583E-04 5746.44 2.00040 0.895479E-04 5839.39 2.00039 0.861710E-04 5933.83 2.00037 0.829271E-04 6029.81 2.00036 0.798013E-04 6127.33 2.00034 0.768045E-04 6226.44 2.00033 0.739192E-04 6327.15 2.00031 0.711412E-04 6429.48 2.00030 0.684727E-04 6533.48 2.00028 0.659050E-04 6639.15 2.00027 0.634339E-04 6746.54 2.00026 0.610575E-04 6855.65 2.00025 0.587721E-04 6966.54 2.00023 0.565742E-04 7079.22 2.00022 0.544591E-04 7193.72 2.00021 0.524244E-04 7310.07 2.00020 0.504667E-04 7428.31 2.00019 0.485830E-04 7548.45 2.00018 0.467709E-04 7670.54 2.00017 0.450273E-04 7794.61 2.00016 0.433495E-04 7920.68 2.00015 0.417344E-04 8048.79 2.00014 0.401808E-04 8178.98 2.00013 0.386851E-04 8311.26 2.00012 0.372463E-04 8445.69 2.00012 0.358607E-04 8582.29 2.00011 0.345279E-04 8721.11 2.00010 0.332444E-04 8862.16 2.00009 0.320095E-04 9005.50 2.00008 0.308211E-04 9151.16 2.00008 0.296762E-04 9299.17 2.00007 0.285749E-04 9449.58 2.00006 0.275144E-04 9602.42 2.00006 0.264930E-04 9757.73 2.00005 0.255105E-04 9915.55 2.00005 0.245639E-04 10075.9 2.00004 0.236529E-04 10238.9 2.00003 0.227757E-04 10404.5 2.00003 0.219312E-04 10572.8 2.00002 0.211180E-04 10743.8 2.00002 0.203350E-04 10917.6 2.00001 0.195811E-04 11094.2 2.00001 0.188551E-04 11273.6 2.00000 0.181560E-04 11455.9 2.00000 0.174828E-04 11641.2 1.99999 0.168345E-04 11829.5 1.99999 0.162102E-04 12020.8 1.99999 0.156091E-04 12215.3 1.99998 0.150301E-04 12412.8 1.99998 0.144725E-04 12613.6 1.99997 0.139355E-04 12817.6 1.99997 0.134184E-04 13025.0 1.99997 0.129203E-04 13235.6 1.99996 0.124406E-04 13449.7 1.99996 0.119786E-04 13667.2 1.99996 0.115336E-04 13888.3 1.99995 0.111051E-04 14112.9 1.99995 0.106923E-04 14341.2 1.99995 0.102948E-04 14573.1 1.99994 0.991188E-05 14808.9 1.99994 0.954309E-05 15048.4 1.99994 0.918789E-05 15291.8 1.99994 0.884577E-05 15539.1 1.99993 0.851627E-05 15790.4 1.99993 0.819889E-05 16045.8 1.99993 0.789321E-05 16305.4 1.99993 0.759879E-05 16569.1 1.99992 0.731522E-05 16837.1 1.99992 0.704210E-05 17109.4 1.99992 0.677905E-05 17386.1 1.99992 0.652570E-05 17667.4 1.99992 0.628168E-05 17953.1 1.99991 0.604668E-05 18243.5 1.99991 0.582034E-05 18538.6 1.99991 0.560236E-05 18838.4 1.99991 0.539242E-05 19143.1 1.99991 0.519025E-05 19452.7 1.99990 0.499555E-05 19767.4 1.99990 0.480804E-05 20087.1 1.99990 0.474564E-05 20412.0 1.99990 0.455916E-05 20742.1 1.99990 0.438013E-05 21077.6 1.99990 0.420822E-05 21418.5 1.99989 0.404316E-05 21765.0 1.99989 0.388467E-05 22117.0 1.99989 0.373247E-05 22474.7 1.99989 0.358632E-05 22838.2 1.99989 0.344596E-05 23207.6 1.99989 0.331117E-05 23583.0 1.99989 0.318171E-05 23964.4 1.99989 0.305738E-05 24352.0 1.99989 0.293795E-05 24745.9 1.99988 0.282325E-05 25146.2 1.99988 0.271307E-05 25552.9 1.99988 0.260724E-05 25966.2 1.99988 0.250558E-05 26386.1 1.99988 0.240791E-05 26812.9 1.99988 0.231409E-05 27246.6 1.99988 0.222396E-05 27687.3 1.99988 0.213737E-05 28135.1 1.99988 0.205418E-05 28590.2 1.99988 0.197425E-05 29052.6 1.99988 0.189745E-05 29522.5 1.99987 0.182367E-05 30000.0 1.99987 0.175277E-05 periodictable-1.5.0/periodictable/xsf/hf.nff000066400000000000000000000320361310514471200210230ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.62338 10.1617 -9999. 2.71485 10.3261 -9999. 2.80951 10.4931 -9999. 2.90326 10.6628 -9999. 2.98247 10.8353 -9999. 3.06384 11.0106 -9999. 3.14744 11.1886 -9999. 3.21346 11.3696 -9999. 3.27509 11.5535 -9999. 3.33789 11.7404 -9999. 3.40189 11.9303 -9999. 3.44372 12.1232 -9999. 3.48479 12.3193 -9999. 3.52634 12.5186 -9999. 3.56167 12.7210 -9999. 3.59271 12.9268 -9999. 3.62402 13.1359 -9999. 3.65560 13.3483 -9999. 3.68534 13.5642 -9999. 3.66296 13.7836 -9999. 3.64071 14.0066 -9999. 3.61861 14.2331 -9999. 3.59964 14.4633 -9999. 3.58379 14.6973 -9999. 3.56801 14.9350 -9999. 3.55230 15.1765 -9999. 3.52965 15.4220 -9999. 3.49460 15.6714 -9999. 3.45989 15.9249 -9999. 3.42552 16.1825 -9999. 3.39150 16.4442 -9999. 3.34535 16.7102 -9999. 3.29249 16.9805 -9999. 3.24047 17.2551 -9999. 3.18926 17.5342 -9999. 3.13887 17.8178 -9999. 3.08551 18.1060 -9999. 3.03194 18.3989 -9999. 2.97930 18.6964 -9999. 2.92757 18.9988 -9999. 2.87674 19.3061 -9999. 2.82679 19.6184 -9999. 2.78143 19.9357 -9999. 2.73922 20.2582 -9999. 2.69766 20.5858 -9999. 2.65672 20.9188 -9999. 2.61641 21.2571 -9999. 2.57671 21.6009 -9999. 2.54242 21.9503 -9999. 2.51547 22.3053 -9999. 2.48881 22.6661 -9999. 2.46243 23.0327 -9999. 2.43633 23.4053 -9999. 2.41051 23.7838 -9999. 2.37896 24.1685 -9999. 2.34635 24.5594 -9999. 2.31419 24.9566 -9999. 2.28247 25.3603 -9999. 2.25223 25.7705 -9999. 2.22355 26.1873 -9999. 2.19523 26.6109 -9999. 2.17072 27.0413 -9999. 2.17899 27.4786 -9999. 2.18728 27.9231 -9999. 2.19560 28.3747 -9999. 2.25787 28.8337 -9999. 2.32848 29.3000 0.444621 2.40129 29.7739 0.136828 2.48223 30.2555 -0.175772 2.62642 30.7449 -0.489729 2.77897 31.2421 -0.830563 2.94039 31.7475 -1.20335 3.13207 32.2609 -1.61428 3.34849 32.7827 -2.15398 3.61110 33.3130 -2.66961 4.11070 33.8518 -3.11582 4.67942 34.3993 -3.52368 5.32683 34.9557 -3.88103 6.06380 35.5211 -4.15032 6.90274 36.0956 -4.33237 7.79922 36.6794 -4.38125 8.80157 37.2727 -4.20669 9.83051 37.8755 -3.95876 10.7254 38.4882 -3.54368 11.7018 39.1107 -3.07773 12.4003 39.7432 -2.63696 13.1330 40.3861 -2.12652 13.9090 41.0393 -1.42390 14.6792 41.7031 -0.705816 15.1893 42.3776 -0.307145E-01 15.7172 43.0630 0.756410 16.2633 43.7595 1.67962 16.6980 44.4673 2.55865 16.8896 45.1865 3.38604 17.0834 45.9174 4.28753 17.1928 46.6600 5.12897 17.1213 47.4147 5.84506 17.0502 48.1816 6.53590 16.9793 48.9609 7.32181 16.9088 49.7528 8.09054 16.6215 50.5576 8.69181 16.2898 51.3753 9.22398 15.9647 52.2062 9.72145 15.6432 53.0506 10.1736 15.2898 53.9087 10.5636 14.9443 54.7806 10.9189 14.6067 55.6667 11.2450 14.2767 56.5670 11.5490 13.9542 57.4820 11.8398 13.6390 58.4117 12.1419 13.3308 59.3564 12.4529 12.9371 60.3165 12.6828 12.4922 61.2921 12.8271 12.0625 62.2834 12.9247 11.6477 63.2908 12.9781 11.2471 64.3145 12.9888 10.8603 65.3547 12.9397 10.4868 66.4118 12.8262 10.1476 67.4859 12.6986 9.94532 68.5775 12.6164 9.74703 69.6867 12.5379 9.55270 70.8138 12.4526 9.36225 71.9591 12.3530 9.17558 73.1230 12.2320 8.99264 74.3057 12.0512 8.81335 75.5076 11.8132 8.69542 76.7289 11.6039 8.72200 77.9699 11.4632 8.74866 79.2310 11.3477 8.77540 80.5125 11.2453 8.80223 81.8147 11.1478 8.82913 83.1380 11.0428 8.85611 84.4827 10.9246 8.92483 85.8491 10.8390 9.01283 87.2377 10.7717 9.10170 88.6487 10.7137 9.19145 90.0825 10.6579 9.28207 91.5395 10.6014 9.37946 93.0201 10.5539 9.50007 94.5246 10.5225 9.62221 96.0535 10.5006 9.74594 97.6071 10.4861 9.87125 99.1858 10.4778 9.99817 100.790 10.4749 10.1267 102.420 10.4764 10.2569 104.077 10.4817 10.3888 105.760 10.4898 10.5224 107.471 10.4989 10.6577 109.209 10.5051 10.7988 110.975 10.5172 10.9554 112.770 10.5406 11.1143 114.594 10.5705 11.2755 116.448 10.6061 11.4390 118.331 10.6469 11.6049 120.245 10.6928 11.7732 122.190 10.7435 11.9439 124.166 10.7991 12.1171 126.175 10.8595 12.2929 128.215 10.9248 12.4711 130.289 10.9950 12.6520 132.397 11.0703 12.8355 134.538 11.1511 13.0216 136.714 11.2388 13.2105 138.925 11.3345 13.4010 141.172 11.4345 13.5850 143.456 11.5352 13.7715 145.776 11.6390 13.9605 148.134 11.7465 14.1522 150.530 11.8582 14.3465 152.964 11.9744 14.5434 155.439 12.0953 14.7431 157.953 12.2213 14.9455 160.507 12.3531 15.1506 163.103 12.4911 15.3576 165.742 12.6340 15.5667 168.422 12.7829 15.7788 171.146 12.9384 15.9937 173.915 13.1012 16.2115 176.727 13.2722 16.4323 179.586 13.4527 16.6562 182.491 13.6460 16.8830 185.442 13.8585 17.1130 188.442 14.0881 17.3137 191.489 14.3058 17.5074 194.587 14.5229 17.7034 197.734 14.7430 17.9015 200.932 14.9682 18.1018 204.182 15.2004 18.3044 207.485 15.4420 18.5093 210.840 15.6977 18.7164 214.251 15.9811 18.9126 217.716 16.2564 19.0757 221.237 16.5231 19.2403 224.816 16.7883 19.4063 228.452 17.0555 19.5738 232.147 17.3265 19.7427 235.902 17.6030 19.9130 239.717 17.8867 20.0848 243.595 18.1821 20.2581 247.535 18.5011 20.4246 251.538 18.8152 20.5652 255.607 19.1240 20.7067 259.741 19.4351 20.8493 263.942 19.7514 20.9928 268.211 20.0754 21.1373 272.549 20.4101 21.2828 276.957 20.7600 21.4293 281.437 21.1338 21.5768 285.989 21.5626 21.7254 290.615 22.0191 21.7478 295.315 22.4143 21.7390 300.092 22.7696 21.7302 304.945 23.1066 21.7213 309.878 23.4290 21.7125 314.890 23.7388 21.7037 319.983 24.0361 21.6948 325.158 24.3152 21.6860 330.418 24.5872 21.7043 335.762 24.8654 21.7265 341.192 25.1473 21.7486 346.711 25.4291 21.7708 352.319 25.7106 21.7930 358.017 25.9914 21.8152 363.808 26.2713 21.8374 369.692 26.5492 21.8597 375.672 26.8250 21.8863 381.748 27.1038 21.9158 387.922 27.3856 21.9454 394.197 27.6690 21.9750 400.573 27.9542 22.0047 407.052 28.2410 22.0344 413.635 28.5300 22.0652 420.326 28.8223 22.0965 427.124 29.1185 22.1278 434.032 29.4190 22.1591 441.052 29.7252 22.1905 448.186 30.0389 22.2219 455.435 30.3750 22.2534 462.802 30.7244 22.2492 470.287 31.0507 22.2209 477.894 31.3621 22.1925 485.623 31.6644 22.1643 493.478 31.9585 22.1360 501.459 32.2424 22.1078 509.570 32.5006 22.0796 517.812 32.7595 22.1109 526.187 33.0463 22.1548 534.698 33.3598 22.1987 543.346 33.6922 22.2428 552.134 34.0461 22.2870 561.065 34.4258 22.3312 570.139 34.8928 22.3444 579.361 35.3327 22.2563 588.732 35.7209 22.1686 598.254 36.1021 22.0811 607.930 36.4832 21.9941 617.763 36.8676 21.9073 627.755 37.3257 21.8165 637.908 37.7646 21.6054 648.226 38.1403 21.3754 658.711 38.4779 21.1340 669.365 38.7649 20.8953 680.191 39.0275 20.6906 691.193 39.3011 20.5117 702.372 39.5959 20.3357 713.733 39.9013 20.1177 725.277 40.1795 19.8723 737.008 40.4248 19.6297 748.928 40.6544 19.3900 761.042 40.8715 19.1529 773.351 41.0781 18.9172 785.859 41.2741 18.6793 798.570 41.4567 18.4402 811.486 41.6257 18.2041 824.611 41.7841 17.9709 837.949 41.9338 17.7407 851.502 42.0748 17.5112 865.274 42.2063 17.2825 879.269 42.3278 17.0547 893.491 42.4394 16.8298 907.943 42.5428 16.6078 922.628 42.6458 16.3886 937.551 42.7408 16.1574 952.715 42.8183 15.9254 968.124 42.8831 15.6933 983.783 42.9358 15.4646 999.695 42.9783 15.2369 1015.86 43.0169 15.0102 1032.29 43.0425 14.7673 1048.99 43.0423 14.5251 1065.96 43.0237 14.2837 1083.20 42.9855 14.0463 1100.72 42.9294 13.8125 1118.52 42.8552 13.5824 1136.61 42.7623 13.3560 1155. 42.6502 13.1332 1173.68 42.5177 12.9140 1192.66 42.3636 12.6982 1211.95 42.1863 12.4860 1231.55 41.9839 12.2773 1251.47 41.7541 12.0718 1271.72 41.4939 11.8698 1292.29 41.2003 11.6715 1313.19 40.8694 11.4765 1334.43 40.4959 11.2846 1356.01 40.0734 11.0956 1377.94 39.5939 10.9097 1400.23 39.0473 10.7269 1422.88 38.4203 10.5469 1445.89 37.6961 10.3695 1469.28 36.8494 10.1923 1493.04 35.8461 10.0139 1517.19 34.6260 9.82077 1541.73 33.0844 9.62888 1566.67 31.0787 9.44066 1592.01 28.3031 9.25604 1617.76 23.9987 9.07494 1643.92 15.1224 8.89728 1661.60 -39.1499 8.78076 1661.80 -39.1317 42.1283 1670.51 8.82000 41.8085 1697.53 24.4693 40.8422 1724.99 31.0186 39.8982 1752.89 35.2660 38.9760 1781.24 38.4069 38.0751 1810.05 40.8814 37.1949 1839.32 42.9009 36.3345 1869.07 44.5822 35.4936 1899.30 45.9949 34.6715 1930.02 47.1807 33.8685 1961.24 48.1606 33.0838 1992.96 48.9349 32.3171 2025.20 49.4740 31.5755 2057.95 49.6651 30.8439 2091.24 48.8733 30.1281 2107.50 41.5636 29.7885 2107.70 41.5701 34.5581 2125.06 49.8487 34.1337 2159.43 52.2226 33.3186 2194.36 53.6142 32.5246 2229.85 54.6430 31.7482 2265.92 55.4335 30.9911 2302.57 55.9999 30.2522 2339.81 56.1951 29.5308 2365.30 53.2227 29.0536 2365.50 53.2264 30.9997 2377.66 56.4192 30.7670 2416.11 57.8893 30.0500 2455.19 58.7481 29.3500 2494.90 59.3913 28.6664 2535.26 59.8598 27.9999 2576.26 60.0311 27.3485 2600.80 57.9226 26.9707 2601. 57.9340 28.4250 2617.93 60.4478 28.1514 2660.27 61.5416 27.4859 2703.30 62.2551 26.8371 2747.03 62.8372 26.2043 2791.46 63.3404 25.5865 2836.61 63.7856 24.9850 2882.49 64.1862 24.3974 2929.11 64.5482 23.8242 2976.48 64.8781 23.2658 3024.63 65.1794 22.7206 3073.55 65.4555 22.1893 3123.26 65.7090 21.6703 3173.78 65.9411 21.1647 3225.11 66.1556 20.6707 3277.27 66.3519 20.1898 3330.28 66.5326 19.7199 3384.15 66.6993 19.2620 3438.88 66.8524 18.8142 3494.50 66.9924 18.3779 3551.02 67.1210 17.9519 3608.46 67.2386 17.5362 3666.82 67.3461 17.1310 3726.13 67.4445 16.7341 3786.40 67.5334 16.3479 3847.64 67.6144 15.9706 3909.87 67.6881 15.6017 3973.11 67.7536 15.2415 4037.38 67.8122 14.8898 4102.68 67.8643 14.5463 4169.03 67.9101 14.2107 4236.46 67.9500 13.8830 4304.98 67.9844 13.5626 4374.62 68.0133 13.2495 4445.37 68.0371 12.9435 4517.27 68.0560 12.6445 4590.33 68.0703 12.3523 4664.58 68.0800 12.0664 4740.03 68.0854 11.7871 4816.69 68.0867 11.5139 4894.60 68.0839 11.2468 4973.77 68.0771 10.9854 5054.21 68.0666 10.7299 5135.96 68.0523 10.4800 5219.03 68.0343 10.2354 5303.44 68.0126 9.99621 5389.22 67.9874 9.76219 5476.39 67.9587 9.53315 5564.97 67.9264 9.30914 5654.98 67.8905 9.08989 5746.44 67.8513 8.87535 5839.39 67.8083 8.66531 5933.83 67.7618 8.45977 6029.81 67.7115 8.25876 6127.33 67.6574 8.06172 6226.44 67.5995 7.86908 6327.15 67.5374 7.68027 6429.48 67.4711 7.49571 6533.48 67.4004 7.31465 6639.15 67.3249 7.13757 6746.54 67.2444 6.96430 6855.65 67.1586 6.79446 6966.54 67.0669 6.62820 7079.22 66.9693 6.46550 7193.72 66.8647 6.30591 7310.07 66.7525 6.14973 7428.31 66.6319 5.99681 7548.45 66.5021 5.84708 7670.54 66.3618 5.70037 7794.61 66.2095 5.55671 7920.68 66.0433 5.41588 8048.79 65.8607 5.27766 8178.98 65.6587 5.14266 8311.26 65.4334 5.01013 8445.69 65.1790 4.88046 8582.29 64.8879 4.75328 8721.11 64.5482 4.62863 8862.16 64.1419 4.50669 9005.50 63.6376 4.38709 9151.16 62.9744 4.26994 9299.17 62.0057 4.15494 9449.58 60.1331 4.04230 9560.60 45.0829 3.96223 9560.80 45.0842 10.8083 9602.42 58.1544 10.7228 9757.73 61.5285 10.4129 9915.55 62.7092 10.1118 10075.9 63.3372 9.81947 10238.9 63.6503 9.53559 10404.5 63.6830 9.25992 10572.8 63.2845 8.99220 10739.3 55.3780 8.73891 10739.5 55.3795 12.2261 10743.8 59.5710 12.2172 10917.6 63.8637 11.8640 11094.2 64.5662 11.5210 11270.6 61.1117 11.1934 11270.8 61.1124 12.9423 11273.6 62.9999 12.9374 11455.9 65.8754 12.6256 11641.2 66.7244 12.3198 11829.5 67.3476 12.0198 12020.8 67.8535 11.7258 12215.3 68.2819 11.4377 12412.8 68.6534 11.1554 12613.6 68.9803 10.8789 12817.6 69.2708 10.6082 13025.0 69.5309 10.3432 13235.6 69.7650 10.0838 13449.7 69.9765 9.83001 13667.2 70.1682 9.58173 13888.3 70.3423 9.33890 14112.9 70.5007 9.10144 14341.2 70.6448 8.86930 14573.1 70.7762 8.64238 14808.9 70.8959 8.42063 15048.4 71.0050 8.20395 15291.8 71.1043 7.99227 15539.1 71.1947 7.78552 15790.4 71.2769 7.58359 16045.8 71.3514 7.38642 16305.4 71.4189 7.19392 16569.1 71.4799 7.00601 16837.1 71.5349 6.82260 17109.4 71.5842 6.64362 17386.1 71.6283 6.46897 17667.4 71.6676 6.29857 17953.1 71.7023 6.13235 18243.5 71.7328 5.97021 18538.6 71.7594 5.81208 18838.4 71.7824 5.65787 19143.1 71.8019 5.50751 19452.7 71.8182 5.36091 19767.4 71.8316 5.21799 20087.1 71.8421 5.07867 20412.0 71.8501 4.94287 20742.1 71.8556 4.81053 21077.6 71.8589 4.68155 21418.5 71.8600 4.55587 21765.0 71.8592 4.43341 22117.0 71.8565 4.31410 22474.7 71.8521 4.19787 22838.2 71.8461 4.08464 23207.6 71.8386 3.97435 23583.0 71.8297 3.86692 23964.4 71.8195 3.76229 24352.0 71.8081 3.66039 24745.9 71.7955 3.56116 25146.2 71.7819 3.46453 25552.9 71.7673 3.37045 25966.2 71.7518 3.27884 26386.1 71.7354 3.18965 26812.9 71.7182 3.10281 27246.6 71.7003 3.01828 27687.3 71.6818 2.93599 28135.1 71.6626 2.85588 28590.2 71.6429 2.77791 29052.6 71.6231 2.70201 29522.5 71.6099 2.62814 30000.0 71.5581 2.55624 periodictable-1.5.0/periodictable/xsf/hg.nff000066400000000000000000000321051310514471200210210ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.07253 10.1617 -9999. 3.05926 10.3261 -9999. 3.04605 10.4931 -9999. 3.03290 10.6628 -9999. 3.01980 10.8353 -9999. 3.00676 11.0106 -9999. 3.02448 11.1886 -9999. 3.04517 11.3696 -9999. 3.06600 11.5535 -9999. 3.08698 11.7404 -9999. 3.10809 11.9303 -9999. 3.12935 12.1232 -9999. 3.15076 12.3193 -9999. 3.17232 12.5186 -9999. 3.19402 12.7210 -9999. 3.21587 12.9268 -9999. 3.23787 13.1359 -9999. 3.26085 13.3483 -9999. 3.31333 13.5642 -9999. 3.36666 13.7836 -9999. 3.42084 14.0066 -9999. 3.47590 14.2331 -9999. 3.53184 14.4633 -9999. 3.58869 14.6973 -9999. 3.65454 14.9350 -9999. 3.73332 15.1765 -9999. 3.81379 15.4220 -9999. 3.89600 15.6714 -9999. 3.97997 15.9249 -9999. 4.06576 16.1825 -9999. 4.15340 16.4442 -9999. 4.24293 16.7102 -9999. 4.33519 16.9805 -9999. 4.45018 17.2551 -9999. 4.56822 17.5342 -9999. 4.68938 17.8178 -9999. 4.81377 18.1060 -9999. 4.94145 18.3989 -9999. 5.07252 18.6964 -9999. 5.20707 18.9988 -9999. 5.34518 19.3061 -9999. 5.51386 19.6184 -9999. 5.69102 19.9357 -9999. 5.87388 20.2582 -9999. 6.06261 20.5858 -9999. 6.25741 20.9188 -9999. 6.45846 21.2571 -9999. 6.66597 21.6009 -9999. 6.87867 21.9503 -9999. 7.08674 22.3053 -9999. 7.30111 22.6661 -9999. 7.52194 23.0327 -9999. 7.74947 23.4053 -9999. 7.98388 23.7838 -9999. 8.22538 24.1685 -9999. 8.47418 24.5594 -9999. 8.70989 24.9566 -9999. 8.94366 25.3603 -9999. 9.18369 25.7705 -9999. 9.43017 26.1873 -9999. 9.68326 26.6109 -9999. 9.94314 27.0413 -9999. 10.2100 27.4786 -9999. 10.4840 27.9231 -9999. 10.6960 28.3747 -9999. 10.8885 28.8337 -9999. 11.0844 29.3000 -2.93636 11.2839 29.7739 -2.82752 11.4869 30.2555 -2.72514 11.6937 30.7449 -2.63802 11.9041 31.2421 -2.55260 12.1628 31.7475 -2.44187 12.4307 32.2609 -2.31430 12.7044 32.7827 -2.17221 12.9842 33.3130 -2.01396 13.2702 33.8518 -1.83052 13.5624 34.3993 -1.60296 13.8400 34.9557 -1.38915 14.0749 35.5211 -1.18659 14.3138 36.0956 -0.983485 14.5567 36.6794 -0.776467 14.8038 37.2727 -0.563204 15.0550 37.8755 -0.341447 15.3105 38.4882 -0.106965 15.5704 39.1107 0.137915 15.8220 39.7432 0.387243 16.0766 40.3861 0.645140 16.3352 41.0393 0.914610 16.5980 41.7031 1.19814 16.8650 42.3776 1.49891 17.1363 43.0630 1.82133 17.4120 43.7595 2.18172 17.6921 44.4673 2.61967 17.9286 45.1865 3.01355 18.0966 45.9174 3.38479 18.2661 46.6600 3.75367 18.4373 47.4147 4.12552 18.6101 48.1816 4.50445 18.7845 48.9609 4.89454 18.9605 49.7528 5.30093 19.1381 50.5576 5.73231 19.3175 51.3753 6.21753 19.4985 52.2062 6.74634 19.5662 53.0506 7.21448 19.5987 53.9087 7.65316 19.6312 54.7806 8.08237 19.6638 55.6667 8.50732 19.6964 56.5670 8.93235 19.7291 57.4820 9.36215 19.7618 58.4117 9.80141 19.7869 59.3564 10.2413 19.8062 60.3165 10.6888 19.8256 61.2921 11.1503 19.8450 62.2834 11.6344 19.8644 63.2908 12.1598 19.8838 64.3145 12.7887 19.8664 65.3547 13.3718 19.6566 66.4118 13.8844 19.4490 67.4859 14.3651 19.2436 68.5775 14.8534 19.0404 69.6867 15.3342 18.7511 70.8138 15.7500 18.4478 71.9591 16.1220 18.1495 73.1230 16.4617 17.8608 74.3057 16.7907 17.5907 75.5076 17.1141 17.3247 76.7289 17.4366 17.0627 77.9699 17.7770 16.8047 79.2310 18.1279 16.4741 80.5125 18.4198 16.1232 81.8147 18.6727 15.7799 83.1380 18.9035 15.4438 84.4827 19.1171 15.1149 85.8491 19.3178 14.7930 87.2377 19.5115 14.4779 88.6487 19.7142 14.1521 90.0825 19.8816 13.8075 91.5395 20.0262 13.4713 93.0201 20.1549 13.1433 94.5246 20.2718 12.8233 96.0535 20.3804 12.5110 97.6071 20.4879 12.2064 99.1858 20.6145 11.8844 100.790 20.7020 11.5402 102.420 20.7619 11.2059 104.077 20.8080 10.8813 105.760 20.8450 10.5661 107.471 20.8787 10.2601 109.209 20.9207 9.96286 110.975 21.0150 9.65744 112.770 21.0519 9.21341 114.594 21.0107 8.78980 116.448 20.9153 8.38567 118.331 20.7797 8.00013 120.245 20.5986 7.63230 122.190 20.3655 7.32570 124.166 20.1586 7.07301 126.175 19.9579 6.82902 128.215 19.7529 6.59344 130.289 19.5389 6.36601 132.397 19.3067 6.15042 134.538 19.0705 5.95480 136.714 18.8285 5.76540 138.925 18.5740 5.58202 141.172 18.3009 5.40449 143.456 18.0078 5.24183 145.776 17.6951 5.08750 148.134 17.3370 4.93772 150.530 16.9642 4.87215 152.964 16.5968 4.81343 155.439 16.1891 4.75541 157.953 15.7585 4.80074 160.507 15.3789 4.88434 163.103 15.0170 4.96941 165.742 14.6506 5.05595 168.422 14.2446 5.14401 171.146 13.8178 5.34539 173.915 13.4428 5.58662 176.727 13.1055 5.83872 179.586 12.7850 6.10221 182.491 12.4721 6.38004 185.442 12.1747 6.67888 188.442 11.8911 6.99172 191.489 11.6185 7.31920 194.587 11.3553 7.66203 197.734 11.1006 8.02090 200.932 10.8491 8.39660 204.182 10.6018 8.80498 207.485 10.3776 9.24485 210.840 10.1755 9.70670 214.251 9.99568 10.1916 217.716 9.84241 10.7008 221.237 9.72237 11.2353 224.816 9.65744 11.7966 228.452 9.67730 12.3066 232.147 9.66648 12.7670 235.902 9.63102 13.2447 239.717 9.60004 13.7403 243.595 9.57798 14.2544 247.535 9.56982 14.7877 251.538 9.57959 15.3410 255.607 9.61587 15.9149 259.741 9.68755 16.4896 263.942 9.76880 17.0667 268.211 9.86372 17.6640 272.549 9.98487 18.2821 276.957 10.1389 18.9220 281.437 10.3368 19.5842 285.989 10.6552 20.2337 290.615 10.9558 20.7994 295.315 11.2374 21.3809 300.092 11.5394 21.9786 304.945 11.8723 22.5931 309.878 12.2504 23.2247 314.890 12.7374 23.8741 319.983 13.2999 24.3855 325.158 13.7962 24.8196 330.418 14.2648 25.2616 335.762 14.7313 25.7113 341.192 15.2081 26.1691 346.711 15.7048 26.6351 352.319 16.2323 27.1093 358.017 16.8589 27.5920 363.808 17.4985 27.9279 369.692 18.0880 28.2467 375.672 18.6661 28.5691 381.748 19.2505 28.8953 387.922 19.8580 29.2252 394.197 20.5309 29.5132 400.573 21.1741 29.7341 407.052 21.7883 29.9566 413.635 22.4086 30.1808 420.326 23.0509 30.4067 427.124 23.7740 30.6163 434.032 24.4563 30.6744 441.052 25.0869 30.7327 448.186 25.6884 30.7910 455.435 26.2794 30.8495 462.802 26.8671 30.8918 470.287 27.4354 30.9212 477.894 27.9875 30.9511 485.623 28.5320 30.9803 493.478 29.0712 31.0094 501.459 29.6101 31.0394 509.570 30.1554 31.0701 517.812 30.7290 31.0901 526.187 31.3162 31.0700 534.698 31.8882 30.9759 543.346 32.3903 30.8452 552.134 32.8361 30.7141 561.065 33.2198 30.5774 570.139 33.4591 30.4685 579.361 33.7198 30.5723 588.732 34.0402 30.7373 598.254 34.4509 30.9423 607.930 34.9281 31.1481 617.763 35.4674 31.3552 627.755 36.0980 31.5566 637.908 36.8035 31.6736 648.226 37.5388 31.6805 658.711 38.2116 31.6143 669.365 38.8603 31.5474 680.191 39.5124 31.4605 691.193 40.1714 31.3544 702.372 40.8575 31.2131 713.733 41.5432 30.9675 725.277 42.1324 30.6518 737.008 42.6508 30.3390 748.928 43.1150 30.0291 761.042 43.5166 29.7256 773.351 43.8360 29.4628 785.859 44.1141 29.3232 798.570 44.4848 29.2847 811.486 44.9270 29.2459 824.611 45.4263 29.2069 837.949 46.0113 29.1677 851.502 46.6760 29.0223 865.274 47.3675 28.7464 879.269 47.9452 28.3570 893.491 48.4459 27.9725 907.943 48.9030 27.5928 922.628 49.3287 27.2178 937.551 49.7291 26.8459 952.715 50.1088 26.4782 968.124 50.4715 26.1148 983.783 50.8222 25.7560 999.695 51.1671 25.3966 1015.86 51.5171 25.0362 1032.29 51.8379 24.6260 1048.99 52.1235 24.2223 1065.96 52.3824 23.8254 1083.20 52.6210 23.4346 1100.72 52.8415 23.0498 1118.52 53.0454 22.6709 1136.61 53.2341 22.2982 1155. 53.4086 21.9311 1173.68 53.5691 21.5694 1192.66 53.7165 21.2137 1211.95 53.8517 20.8634 1231.55 53.9746 20.5183 1251.47 54.0854 20.1785 1271.72 54.1847 19.8441 1292.29 54.2724 19.5146 1313.19 54.3488 19.1907 1334.43 54.4145 18.8717 1356.01 54.4691 18.5574 1377.94 54.5127 18.2481 1400.23 54.5456 17.9437 1422.88 54.5678 17.6439 1445.89 54.5800 17.3489 1469.28 54.5839 17.0567 1493.04 54.5797 16.7661 1517.19 54.5589 16.4667 1541.73 54.5183 16.1707 1566.67 54.4587 15.8797 1592.01 54.3815 15.5938 1617.76 54.2865 15.3129 1643.92 54.1734 15.0371 1670.51 54.0415 14.7659 1697.53 53.8893 14.4994 1724.99 53.7206 14.2373 1752.89 53.5270 13.9699 1781.24 53.3017 13.7038 1810.05 53.0420 13.4398 1839.32 52.7442 13.1809 1869.07 52.4057 12.9270 1899.30 52.0210 12.6778 1930.02 51.5831 12.4336 1961.24 51.0832 12.1941 1992.96 50.5065 11.9589 2025.20 49.8471 11.7349 2057.95 49.0744 11.5020 2091.24 48.1461 11.2713 2125.06 47.0124 11.0446 2159.43 45.5838 10.8203 2194.36 43.6910 10.5992 2229.85 40.9486 10.3814 2265.92 36.0137 10.1666 2294.80 4.47859 10.0002 2295. 4.48259 27.3119 2302.57 28.0765 27.1770 2339.81 36.1542 26.5292 2377.66 33.2392 25.8985 2384.80 17.9606 25.7823 2385. 17.9772 37.4002 2416.11 41.1985 36.7442 2455.19 46.0133 35.9479 2494.90 49.0628 35.1690 2535.26 51.3245 34.4084 2576.26 53.1038 33.6654 2617.93 54.5369 32.9389 2660.27 55.6914 32.2297 2703.30 56.5898 31.5355 2747.03 57.2059 30.8580 2791.46 57.3883 30.1958 2836.61 55.9116 29.5479 2847. 49.2960 29.4022 2847.20 49.3010 34.0195 2882.49 58.6253 33.4451 2929.11 60.6396 32.7114 2976.48 61.9905 31.9945 3024.63 63.0513 31.2940 3073.55 63.9245 30.6098 3123.26 64.6466 29.9407 3173.78 65.2194 29.2878 3225.11 65.5799 28.6498 3277.27 64.3315 28.0253 3278.40 63.0838 28.0121 3278.60 63.0866 29.5921 3330.28 66.8045 28.9393 3384.15 67.6547 28.2846 3438.88 68.2680 27.6458 3494.50 68.6972 27.0222 3551.02 68.6258 26.4112 3561.50 67.1150 26.3005 3561.70 67.1168 27.3823 3608.46 69.6498 26.9033 3666.82 70.4013 26.3256 3726.13 70.9957 25.7572 3786.40 71.5108 25.1948 3847.64 71.9710 24.6429 3909.87 72.3896 24.0991 3973.11 72.7736 23.5643 4037.38 73.1265 23.0364 4102.68 73.4511 22.5185 4169.03 73.7511 22.0090 4236.46 74.0282 21.5088 4304.98 74.2847 21.0175 4374.62 74.5222 20.5352 4445.37 74.7416 20.0608 4517.27 74.9438 19.5963 4590.33 75.1308 19.1400 4664.58 75.3026 18.6925 4740.03 75.4606 18.2538 4816.69 75.6054 17.8237 4894.60 75.7379 17.4022 4973.77 75.8587 16.9891 5054.21 75.9684 16.5845 5135.96 76.0676 16.1884 5219.03 76.1570 15.8005 5303.44 76.2369 15.4207 5389.22 76.3078 15.0491 5476.39 76.3703 14.6855 5564.97 76.4249 14.3298 5654.98 76.4716 13.9818 5746.44 76.5112 13.6416 5839.39 76.5438 13.3089 5933.83 76.5699 12.9836 6029.81 76.5896 12.6656 6127.33 76.6032 12.3550 6226.44 76.6112 12.0514 6327.15 76.6137 11.7549 6429.48 76.6109 11.4651 6533.48 76.6029 11.1820 6639.15 76.5902 10.9058 6746.54 76.5728 10.6360 6855.65 76.5509 10.3725 6966.54 76.5245 10.1153 7079.22 76.4940 9.86417 7193.72 76.4592 9.61900 7310.07 76.4203 9.37981 7428.31 76.3774 9.14631 7548.45 76.3304 8.91864 7670.54 76.2797 8.69658 7794.61 76.2251 8.47975 7920.68 76.1665 8.26849 8048.79 76.1041 8.06206 8178.98 76.0374 7.86075 8311.26 75.9666 7.66473 8445.69 75.8919 7.47362 8582.29 75.8126 7.28674 8721.11 75.7284 7.10497 8862.16 75.6398 6.92776 9005.50 75.5459 6.75475 9151.16 75.4463 6.58634 9299.17 75.3410 6.42200 9449.58 75.2289 6.26186 9602.42 75.1098 6.10574 9757.73 74.9829 5.95350 9915.55 74.8478 5.80493 10075.9 74.7019 5.65634 10238.9 74.5409 5.51188 10404.5 74.3644 5.37147 10572.8 74.1699 5.23498 10743.8 73.9534 5.10236 10917.6 73.7098 4.97348 11094.2 73.4312 4.84827 11273.6 73.1060 4.72664 11455.9 72.7147 4.60849 11641.2 72.2226 4.49375 11829.5 71.5569 4.38232 12020.8 70.5173 4.27413 12215.3 67.9670 4.16909 12283.8 55.3552 4.13308 12284.0 55.3557 10.2207 12412.8 69.3063 10.0367 12613.6 71.1192 9.76032 12817.6 71.9849 9.49152 13025.0 72.5012 9.23011 13235.6 72.8108 8.97592 13449.7 72.9582 8.72873 13667.2 72.9382 8.48834 13888.3 72.6709 8.25459 14112.9 71.6735 8.02726 14208.6 64.9078 7.93341 14208.8 64.9081 11.0648 14341.2 72.1631 10.9036 14573.1 73.2426 10.6301 14808.9 73.3770 10.3636 14839.2 73.7230 10.3301 14839.4 73.7211 11.8309 15048.4 73.5579 11.5967 15291.8 74.7972 11.3337 15539.1 75.4312 11.0746 15790.4 75.9158 10.8193 16045.8 76.3168 10.5681 16305.4 76.6606 10.3209 16569.1 76.9613 10.0778 16837.1 77.2279 9.83877 17109.4 77.4663 9.60395 17386.1 77.6809 9.37331 17667.4 77.8749 9.14687 17953.1 78.0509 8.92464 18243.5 78.2111 8.70661 18538.6 78.3570 8.49278 18838.4 78.4901 8.28314 19143.1 78.6116 8.07768 19452.7 78.7225 7.87637 19767.4 78.8238 7.67918 20087.1 78.9162 7.48608 20412.0 79.0005 7.29705 20742.1 79.0772 7.11204 21077.6 79.1469 6.93101 21418.5 79.2102 6.75393 21765.0 79.2675 6.58074 22117.0 79.3192 6.41141 22474.7 79.3657 6.24587 22838.2 79.4073 6.08408 23207.6 79.4444 5.92598 23583.0 79.4773 5.77152 23964.4 79.5062 5.62065 24352.0 79.5315 5.47331 24745.9 79.5533 5.32944 25146.2 79.5718 5.18898 25552.9 79.5873 5.05189 25966.2 79.6000 4.91808 26386.1 79.6100 4.78752 26812.9 79.6176 4.66013 27246.6 79.6228 4.53586 27687.3 79.6259 4.41466 28135.1 79.6270 4.29645 28590.2 79.6264 4.18118 29052.6 79.6246 4.06880 29522.5 79.6317 3.95924 30000.0 79.5807 3.85244 periodictable-1.5.0/periodictable/xsf/ho.nff000066400000000000000000000321021310514471200210260ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.167624 10.1617 -9999. 0.171642 10.3261 -9999. 0.175757 10.4931 -9999. 0.179971 10.6628 -9999. 0.184286 10.8353 -9999. 0.188704 11.0106 -9999. 0.193658 11.1886 -9999. 0.200859 11.3696 -9999. 0.208329 11.5535 -9999. 0.216076 11.7404 -9999. 0.223826 11.9303 -9999. 0.231364 12.1232 -9999. 0.239156 12.3193 -9999. 0.247210 12.5186 -9999. 0.255856 12.7210 -9999. 0.265033 12.9268 -9999. 0.274538 13.1359 -9999. 0.284211 13.3483 -9999. 0.293582 13.5642 -9999. 0.303262 13.7836 -9999. 0.313261 14.0066 -9999. 0.323589 14.2331 -9999. 0.333375 14.4633 -9999. 0.343298 14.6973 -9999. 0.353517 14.9350 -9999. 0.364353 15.1765 -9999. 0.375936 15.4220 -9999. 0.387886 15.6714 -9999. 0.400031 15.9249 -9999. 0.408584 16.1825 -9999. 0.417320 16.4442 -9999. 0.426243 16.7102 -9999. 0.437477 16.9805 -9999. 0.455184 17.2551 -9999. 0.473608 17.5342 -9999. 0.486864 17.8178 -9999. 0.499004 18.1060 -9999. 0.511445 18.3989 -9999. 0.524229 18.6964 -9999. 0.538388 18.9988 -9999. 0.552929 19.3061 -9999. 0.567862 19.6184 -9999. 0.584048 19.9357 -9999. 0.600706 20.2582 -9999. 0.617839 20.5858 -9999. 0.638919 20.9188 -9999. 0.661735 21.2571 -9999. 0.685366 21.6009 -9999. 0.713229 21.9503 -9999. 0.748039 22.3053 -9999. 0.790689 22.6661 -9999. 0.881858 23.0327 -9999. 0.970660 23.4053 -9999. 1.06118 23.7838 -9999. 1.30727 24.1685 -9999. 1.44952 24.5594 -9999. 1.61295 24.9566 -9999. 1.86820 25.3603 -9999. 2.28008 25.7705 -9999. 2.56526 26.1873 -9999. 2.97313 26.6109 -9999. 3.47041 27.0413 -9999. 4.00771 27.4786 -9999. 4.57972 27.9231 -9999. 5.13553 28.3747 -9999. 5.65403 28.8337 -9999. 6.19349 29.3000 -3.12960 6.78490 29.7739 -3.14392 7.45822 30.2555 -3.07757 8.19836 30.7449 -2.86773 9.01194 31.2421 -2.52286 9.71268 31.7475 -2.09761 10.4420 32.2609 -1.41577 11.0399 32.7827 -0.856388 11.4515 33.3130 -0.293774 11.8785 33.8518 0.306621 12.1795 34.3993 0.872409 12.4602 34.9557 1.49192 12.6984 35.5211 2.07923 12.8560 36.0956 2.69930 13.0155 36.6794 3.31575 12.9818 37.2727 3.82927 12.9322 37.8755 4.29050 12.8828 38.4882 4.72734 12.8335 39.1107 5.15670 12.7844 39.7432 5.61256 12.6901 40.3861 5.99779 12.5442 41.0393 6.34077 12.3999 41.7031 6.65443 12.2572 42.3776 6.94492 12.1163 43.0630 7.21658 11.9769 43.7595 7.47201 11.8351 44.4673 7.70805 11.6928 45.1865 7.92774 11.5523 45.9174 8.13273 11.4135 46.6600 8.32411 11.2764 47.4147 8.50262 11.1409 48.1816 8.66877 11.0070 48.9609 8.82274 10.8747 49.7528 8.96378 10.7440 50.5576 9.08877 10.6149 51.3753 9.20409 10.5025 52.2062 9.31703 10.3925 53.0506 9.42389 10.2836 53.9087 9.52333 10.1759 54.7806 9.61449 10.0693 55.6667 9.69640 9.96382 56.5670 9.76752 9.85946 57.4820 9.82431 9.75618 58.4117 9.85440 9.65936 59.3564 9.88623 9.60720 60.3165 9.92935 9.55532 61.2921 9.97592 9.50373 62.2834 10.0212 9.45241 63.2908 10.0634 9.40138 64.3145 10.1007 9.35062 65.3547 10.1312 9.30013 66.4118 10.1488 9.24992 67.4859 10.1348 9.21580 68.5775 10.1393 9.22008 69.6867 10.1595 9.22434 70.8138 10.1846 9.22862 71.9591 10.2122 9.23289 73.1230 10.2406 9.23717 74.3057 10.2684 9.24146 75.5076 10.2945 9.24574 76.7289 10.3175 9.25003 77.9699 10.3354 9.25431 79.2310 10.3439 9.25861 80.5125 10.3281 9.27368 81.8147 10.3258 9.32917 83.1380 10.3388 9.38501 84.4827 10.3604 9.44117 85.8491 10.3871 9.49767 87.2377 10.4176 9.55451 88.6487 10.4510 9.61169 90.0825 10.4869 9.66921 91.5395 10.5250 9.72708 93.0201 10.5651 9.78529 94.5246 10.6072 9.84385 96.0535 10.6515 9.90276 97.6071 10.6988 9.96202 99.1858 10.7509 10.0216 100.790 10.8153 10.0816 102.420 10.8817 10.1098 104.077 10.9326 10.1333 105.760 10.9726 10.1569 107.471 11.0063 10.1805 109.209 11.0346 10.2041 110.975 11.0587 10.2278 112.770 11.0806 10.2516 114.594 11.1081 10.2691 116.448 11.1208 10.2686 118.331 11.1213 10.2681 120.245 11.1147 10.2676 122.190 11.1126 10.2671 124.166 11.1766 10.2500 126.175 11.1696 10.0642 128.215 11.0535 9.88183 130.289 10.8645 9.70275 132.397 10.6159 9.52691 134.538 10.2843 9.31956 136.714 9.84480 9.11352 138.925 9.29614 8.91203 141.172 8.68411 8.71501 143.456 7.84485 8.24218 145.776 6.42588 7.70452 148.134 4.40734 7.30426 150.530 1.61720 6.92494 152.964 -3.88245 6.31943 155.439 -26.3497 11.4015 157.953 -5.66441 49.4228 160.507 12.1987 41.0236 163.103 18.9197 33.0111 165.742 19.1029 26.5826 168.422 18.5942 25.1963 171.146 18.9623 23.8824 173.915 19.2737 22.6370 176.727 19.0917 21.5454 179.586 19.0393 21.2141 182.491 19.2310 20.8879 185.442 19.4731 20.5668 188.442 19.7225 20.2506 191.489 19.9575 19.9392 194.587 20.1615 19.6327 197.734 20.3028 19.3308 200.932 20.3399 19.1531 204.182 20.4603 19.0853 207.485 20.6470 19.0178 210.840 20.8529 18.9504 214.251 21.0717 18.8834 217.716 21.2995 18.8165 221.237 21.5347 18.7499 224.816 21.7777 18.6835 228.452 22.0320 18.6174 232.147 22.3192 18.5502 235.902 22.5911 18.4014 239.717 22.8300 18.2538 243.595 23.0434 18.1074 247.535 23.2389 17.9621 251.538 23.4165 17.8180 255.607 23.5741 17.6751 259.741 23.7032 17.5333 263.942 23.7734 17.4249 268.211 23.8784 17.3847 272.549 24.0046 17.3445 276.957 24.1383 17.3044 281.437 24.2743 17.2645 285.989 24.4089 17.2246 290.615 24.5387 17.1848 295.315 24.6410 17.1450 300.092 24.7510 17.1600 304.945 24.8841 17.1759 309.878 25.0276 17.1918 314.890 25.1777 17.2078 319.983 25.3323 17.2237 325.158 25.4899 17.2397 330.418 25.6491 17.2557 335.762 25.8025 17.2717 341.192 25.9565 17.3052 346.711 26.1242 17.3459 352.319 26.3014 17.3867 358.017 26.4858 17.4276 363.808 26.6768 17.4686 369.692 26.8744 17.5096 375.672 27.0789 17.5508 381.748 27.2911 17.5921 387.922 27.5123 17.6335 394.197 27.7601 17.6736 400.573 28.0052 17.6757 407.052 28.2382 17.6778 413.635 28.4690 17.6799 420.326 28.7000 17.6820 427.124 28.9330 17.6841 434.032 29.1693 17.6863 441.052 29.4112 17.6884 448.186 29.6620 17.6905 455.435 29.9364 17.6926 462.802 30.2112 17.6447 470.287 30.4692 17.5904 477.894 30.7148 17.5362 485.623 30.9559 17.4822 493.478 31.1949 17.4284 501.459 31.4335 17.3747 509.570 31.6734 17.3213 517.812 31.9170 17.2680 526.187 32.1672 17.2148 534.698 32.4273 17.1618 543.346 32.7462 17.1090 552.134 33.0555 16.9488 561.065 33.3095 16.7753 570.139 33.5354 16.6035 579.361 33.7423 16.4335 588.732 33.9343 16.2652 598.254 34.1138 16.0987 607.930 34.2823 15.9339 617.763 34.4408 15.7707 627.755 34.5894 15.6092 637.908 34.7348 15.4536 648.226 34.8762 15.2891 658.711 35.0003 15.1178 669.365 35.1043 14.9486 680.191 35.1910 14.8033 691.193 35.2857 14.6761 702.372 35.4048 14.5510 713.733 35.5302 14.3965 725.277 35.6307 14.2227 737.008 35.7130 14.0511 748.928 35.7828 13.8816 761.042 35.8424 13.7139 773.351 35.8935 13.5467 785.859 35.9351 13.3766 798.570 35.9622 13.2048 811.486 35.9761 13.0353 824.611 35.9782 12.8678 837.949 35.9687 12.7023 851.502 35.9474 12.5379 865.274 35.9139 12.3741 879.269 35.8662 12.2113 893.491 35.8044 12.0505 907.943 35.7286 11.8918 922.628 35.6409 11.7354 937.551 35.5363 11.5727 952.715 35.4117 11.4102 968.124 35.2644 11.2481 983.783 35.0945 11.0881 999.695 34.9016 10.9294 1015.86 34.6855 10.7719 1032.29 34.4376 10.6061 1048.99 34.1529 10.4408 1065.96 33.8260 10.2761 1083.20 33.4531 10.1136 1100.72 33.0286 9.95392 1118.52 32.5450 9.79687 1136.61 31.9920 9.64205 1155. 31.3560 9.48972 1173.68 30.6192 9.33987 1192.66 29.7561 9.19220 1211.95 28.7310 9.04699 1231.55 27.4903 8.90430 1251.47 25.9489 8.76416 1271.72 23.9597 8.62668 1292.29 21.2354 8.49190 1313.19 17.0871 8.35957 1334.43 8.98271 8.22934 1351.30 -46.1470 8.12876 1351.50 -46.1240 42.3878 1356.01 -4.04580 42.1847 1377.94 15.9027 41.2201 1400.23 23.1187 40.2775 1422.88 27.6897 39.3565 1445.89 31.0397 38.4564 1469.28 33.6685 37.5774 1493.04 35.8122 36.7194 1517.19 37.6013 35.8824 1541.73 39.1139 35.0647 1566.67 40.3977 34.2654 1592.01 41.4821 33.4848 1617.76 42.3812 32.7219 1643.92 43.0910 31.9759 1670.51 43.5796 31.2471 1697.53 43.7409 30.5353 1724.99 42.9718 29.8402 1741.10 36.1969 29.4446 1741.30 36.2186 34.2020 1752.89 43.3580 33.8881 1781.24 45.8694 33.1406 1810.05 47.2454 32.4095 1839.32 48.2316 31.6952 1869.07 48.9462 30.9967 1899.30 49.2404 30.3136 1922.70 46.8679 29.8025 1922.90 46.8880 31.8540 1930.02 49.3636 31.6870 1961.24 51.1004 30.9726 1992.96 52.0849 30.2743 2025.20 52.8428 29.5980 2057.95 53.4437 28.9312 2091.24 53.8621 28.2786 2125.06 53.5480 27.6414 2128.20 52.3233 27.5836 2128.40 52.3261 28.7312 2159.43 54.9001 28.1975 2194.36 55.6749 27.6175 2229.85 56.3016 27.0453 2265.92 56.8517 26.4812 2302.57 57.3493 25.9259 2339.81 57.8051 25.3775 2377.66 58.2244 24.8373 2416.11 58.6129 24.3062 2455.19 58.9736 23.7827 2494.90 59.3091 23.2682 2535.26 59.6212 22.7618 2576.26 59.9123 22.2642 2617.93 60.1830 21.7746 2660.27 60.4357 21.2945 2703.30 60.6708 20.8213 2747.03 60.8892 20.3575 2791.46 61.0919 19.9021 2836.61 61.2817 19.4567 2882.49 61.4566 19.0159 2929.11 61.6176 18.5862 2976.48 61.7678 18.1647 3024.63 61.9063 17.7506 3073.55 62.0336 17.3452 3123.26 62.1503 16.9473 3173.78 62.2575 16.5583 3225.11 62.3555 16.1759 3277.27 62.4433 15.8014 3330.28 62.5230 15.4359 3384.15 62.5951 15.0770 3438.88 62.6590 14.7258 3494.50 62.7155 14.3823 3551.02 62.7656 14.0466 3608.46 62.8092 13.7166 3666.82 62.8457 13.3940 3726.13 62.8759 13.0785 3786.40 62.9004 12.7699 3847.64 62.9191 12.4680 3909.87 62.9325 12.1728 3973.11 62.9406 11.8841 4037.38 62.9437 11.6017 4102.68 62.9419 11.3256 4169.03 62.9355 11.0557 4236.46 62.9246 10.7918 4304.98 62.9092 10.5338 4374.62 62.8895 10.2816 4445.37 62.8655 10.0351 4517.27 62.8374 9.79422 4590.33 62.8055 9.55897 4664.58 62.7695 9.32871 4740.03 62.7293 9.10391 4816.69 62.6854 8.88447 4894.60 62.6377 8.66984 4973.77 62.5859 8.46002 5054.21 62.5301 8.25528 5135.96 62.4702 8.05510 5219.03 62.4061 7.85980 5303.44 62.3380 7.66888 5389.22 62.2654 7.48225 5476.39 62.1880 7.30013 5564.97 62.1059 7.12237 5654.98 62.0189 6.94875 5746.44 61.9266 6.77900 5839.39 61.8282 6.61311 5933.83 61.7234 6.45123 6029.81 61.6121 6.29348 6127.33 61.4935 6.13907 6226.44 61.3664 5.98829 6327.15 61.2302 5.84119 6429.48 61.0836 5.69737 6533.48 60.9250 5.55712 6639.15 60.7531 5.42016 6746.54 60.5653 5.28628 6855.65 60.3587 5.15571 6966.54 60.1297 5.02842 7079.22 59.8731 4.90361 7193.72 59.5817 4.78220 7310.07 59.2456 4.66342 7428.31 58.8486 4.54724 7548.45 58.3651 4.43426 7670.54 57.7484 4.32377 7794.61 56.8966 4.21560 7920.68 55.5111 4.11014 8048.79 51.1934 4.00761 8071. 38.8400 3.99026 8071.20 38.8409 11.1883 8178.98 54.8890 10.9134 8311.26 56.6276 10.5900 8445.69 57.4368 10.2757 8582.29 57.7983 9.97106 8721.11 57.7456 9.67521 8862.16 56.7304 9.38827 8917.70 49.5830 9.27885 8917.90 49.5851 12.9497 9005.50 57.6303 12.7105 9151.16 58.9313 12.3273 9299.17 59.3281 11.9554 9394.10 56.0601 11.7257 9394.30 56.0608 13.4166 9449.58 59.6769 13.3031 9602.42 60.9199 12.9977 9757.73 61.6743 12.6979 9915.55 62.2640 12.4034 10075.9 62.7575 12.1129 10238.9 63.1827 11.8273 10404.5 63.5564 11.5465 10572.8 63.8886 11.2706 10743.8 64.1864 10.9997 10917.6 64.4551 10.7337 11094.2 64.6985 10.4726 11273.6 64.9198 10.2165 11455.9 65.1215 9.96535 11641.2 65.3056 9.71913 11829.5 65.4740 9.47781 12020.8 65.6281 9.24138 12215.3 65.7691 9.00979 12412.8 65.8983 8.78303 12613.6 66.0165 8.56104 12817.6 66.1247 8.34378 13025.0 66.2236 8.13120 13235.6 66.3139 7.92326 13449.7 66.3962 7.71990 13667.2 66.4712 7.52105 13888.3 66.5393 7.32668 14112.9 66.6010 7.13670 14341.2 66.6568 6.95107 14573.1 66.7070 6.76971 14808.9 66.7520 6.59257 15048.4 66.7921 6.41956 15291.8 66.8277 6.25064 15539.1 66.8591 6.08573 15790.4 66.8865 5.92475 16045.8 66.9102 5.76765 16305.4 66.9304 5.61435 16569.1 66.9474 5.46478 16837.1 66.9613 5.31887 17109.4 66.9723 5.17656 17386.1 66.9807 5.03776 17667.4 66.9866 4.90242 17953.1 66.9901 4.77047 18243.5 66.9914 4.64182 18538.6 66.9907 4.51643 18838.4 66.9881 4.39421 19143.1 66.9836 4.27510 19452.7 66.9775 4.15904 19767.4 66.9698 4.04595 20087.1 66.9606 3.93578 20412.0 66.9501 3.82845 20742.1 66.9383 3.72392 21077.6 66.9253 3.62209 21418.5 66.9111 3.52294 21765.0 66.8960 3.42638 22117.0 66.8798 3.33236 22474.7 66.8627 3.24082 22838.2 66.8448 3.15169 23207.6 66.8262 3.06494 23583.0 66.8067 2.98048 23964.4 66.7866 2.89829 24352.0 66.7658 2.81828 24745.9 66.7445 2.74042 25146.2 66.7226 2.66465 25552.9 66.7001 2.59092 25966.2 66.6772 2.51918 26386.1 66.6538 2.44938 26812.9 66.6299 2.38147 27246.6 66.6057 2.31541 27687.3 66.5810 2.25114 28135.1 66.5560 2.18862 28590.2 66.5307 2.12780 29052.6 66.5055 2.06865 29522.5 66.4852 2.01112 30000.0 66.4355 1.95517 periodictable-1.5.0/periodictable/xsf/i.nff000066400000000000000000000316271310514471200206630ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 7.81670 10.1617 -9999. 7.56781 10.3261 -9999. 7.32685 10.4931 -9999. 7.08081 10.6628 -9999. 6.83320 10.8353 -9999. 6.78435 11.0106 -9999. 6.80888 11.1886 -9999. 7.27334 11.3696 -9999. 7.86775 11.5535 -9999. 8.52786 11.7404 -9999. 9.24335 11.9303 -9999. 10.0092 12.1232 -9999. 10.7896 12.3193 -9999. 11.0623 12.5186 -9999. 11.3418 12.7210 -9999. 11.4253 12.9268 -9999. 11.3727 13.1359 -9999. 11.3203 13.3483 -9999. 11.2681 13.5642 -9999. 11.2095 13.7836 -9999. 11.1155 14.0066 -9999. 11.0223 14.2331 -9999. 10.9300 14.4633 -9999. 10.8383 14.6973 -9999. 10.7475 14.9350 -9999. 10.6574 15.1765 -9999. 10.4573 15.4220 -9999. 10.1905 15.6714 -9999. 9.93056 15.9249 -9999. 9.67721 16.1825 -9999. 9.43034 16.4442 -9999. 9.18976 16.7102 -9999. 8.95532 16.9805 -9999. 8.72686 17.2551 -9999. 8.50423 17.5342 -9999. 8.28728 17.8178 -9999. 8.07586 18.1060 -9999. 7.86984 18.3989 -9999. 7.66907 18.6964 -9999. 7.42175 18.9988 -9999. 7.14799 19.3061 -9999. 6.88433 19.6184 -9999. 6.63039 19.9357 -9999. 6.38583 20.2582 -9999. 6.15028 20.5858 -9999. 5.92343 20.9188 -9999. 5.70494 21.2571 -9999. 5.49451 21.6009 -9999. 5.29184 21.9503 -9999. 5.09665 22.3053 -9999. 4.90865 22.6661 -9999. 4.68919 23.0327 -9999. 4.44107 23.4053 -9999. 4.20609 23.7838 -9999. 3.98353 24.1685 -9999. 3.77276 24.5594 -9999. 3.57313 24.9566 -9999. 3.38407 25.3603 -9999. 3.20501 25.7705 -9999. 3.03543 26.1873 -9999. 2.87482 26.6109 -9999. 2.72270 27.0413 -9999. 2.57864 27.4786 -9999. 2.44220 27.9231 -9999. 2.31298 28.3747 -9999. 2.19332 28.8337 -9999. 2.08206 29.3000 8.60390 1.97645 29.7739 8.48945 1.87619 30.2555 8.37226 1.78101 30.7449 8.25130 1.69067 31.2421 8.12476 1.60815 31.7475 7.99986 1.53269 32.2609 7.87412 1.46076 32.7827 7.74628 1.39221 33.3130 7.61584 1.32688 33.8518 7.48238 1.26462 34.3993 7.34562 1.20527 34.9557 7.20568 1.14784 35.5211 7.05951 1.09115 36.0956 6.90638 1.03727 36.6794 6.74544 0.986041 37.2727 6.57312 0.937347 37.8755 6.38740 0.903753 38.4882 6.20463 0.877899 39.1107 6.01751 0.852786 39.7432 5.81973 0.828390 40.3861 5.60378 0.804693 41.0393 5.37609 0.806253 41.7031 5.14580 0.810089 42.3776 4.90062 0.813942 43.0630 4.62757 0.823425 43.7595 4.33466 0.847795 44.4673 4.00705 0.872888 45.1865 3.60324 0.902866 45.9174 3.07850 0.977345 46.6600 2.35422 1.31670 47.4147 1.73260 2.00134 48.1816 1.27760 3.04198 48.9609 1.29574 4.62369 49.7528 3.17649 7.02792 50.5576 5.89873 4.83265 51.3753 5.93686 2.81967 52.2062 4.95233 1.64518 53.0506 3.76698 1.34657 53.9087 2.97006 1.36268 54.7806 2.13977 1.43819 55.6667 1.44322 1.93061 56.5670 1.19607 2.59163 57.4820 1.23617 2.49683 58.4117 0.800734 2.24931 59.3564 -0.147580 2.19230 60.3165 -0.995416 2.58873 61.2921 -1.73890 3.05686 62.2834 -2.46034 3.60962 63.2908 -3.16539 4.26232 64.3145 -3.82932 5.03308 65.3547 -4.40672 5.87252 66.4118 -4.98989 6.78790 67.4859 -5.54052 7.84598 68.5775 -5.99773 9.06897 69.6867 -6.26717 10.4826 70.8138 -6.04553 11.8131 71.9591 -5.98907 12.8675 73.1230 -5.96129 14.0160 74.3057 -5.86799 15.2670 75.5076 -5.61508 16.5375 76.7289 -5.34793 17.8058 77.9699 -4.99390 19.1713 79.2310 -4.47498 20.6415 80.5125 -3.59753 22.2245 81.8147 -2.56194 23.2596 83.1380 -1.62484 24.3108 84.4827 -0.675598 25.4095 85.8491 0.421517 26.5578 87.2377 1.71087 27.5394 88.6487 2.98865 28.4517 90.0825 4.35036 29.3941 91.5395 5.98692 30.3677 93.0201 7.74100 30.8583 94.5246 9.44366 31.3227 96.0535 11.3136 31.7941 97.6071 13.2351 31.8194 99.1858 15.0560 31.7940 100.790 17.0547 31.7686 102.420 18.9728 31.0869 104.077 20.6491 30.4158 105.760 22.2140 29.7593 107.471 23.8175 29.1169 109.209 25.7738 28.4884 110.975 27.8087 26.8173 112.770 29.0270 24.8686 114.594 29.8169 23.0614 116.448 30.3470 21.3857 118.331 30.6920 19.8317 120.245 30.8990 18.3906 122.190 30.9995 17.0543 124.166 31.0194 15.8151 126.175 30.9796 14.6658 128.215 30.9057 13.6001 130.289 30.8581 12.5697 132.397 30.6890 11.4908 134.538 30.4278 10.5045 136.714 30.1107 9.60285 138.925 29.7580 8.77859 141.172 29.3817 8.02511 143.456 28.9896 7.33627 145.776 28.5894 6.70659 148.134 28.1879 6.13095 150.530 27.7972 5.60470 152.964 27.4579 5.12362 155.439 27.0954 4.50919 157.953 26.6200 3.93609 160.507 26.0686 3.43468 163.103 25.4568 2.99581 165.742 24.7464 2.71715 168.422 24.1357 2.57603 171.146 23.5918 2.48845 173.915 23.1039 2.42940 176.727 22.6237 2.38967 179.586 22.1910 2.39376 182.491 21.7807 2.39786 185.442 21.3868 2.44337 188.442 21.0176 2.50095 191.489 20.6681 2.59423 194.587 20.3584 2.70521 197.734 20.0769 2.82093 200.932 19.8169 2.94182 204.182 19.5761 3.06831 207.485 19.3522 3.20023 210.840 19.1441 3.33783 214.251 18.9508 3.48134 217.716 18.7722 3.63102 221.237 18.6083 3.78714 224.816 18.4606 3.94997 228.452 18.3375 4.11247 232.147 18.2198 4.26871 235.902 18.1080 4.43088 239.717 18.0073 4.59922 243.595 17.9190 4.77395 247.535 17.8453 4.95531 251.538 17.7897 5.14357 255.607 17.7647 5.33898 259.741 17.7640 5.49854 263.942 17.7565 5.64678 268.211 17.7464 5.79902 272.549 17.7440 5.95538 276.957 17.7528 6.11594 281.437 17.7777 6.28084 285.989 17.8472 6.45017 290.615 17.9205 6.55562 295.315 17.9794 6.66107 300.092 18.0464 6.76823 304.945 18.1297 6.84572 309.878 18.1940 6.90162 314.890 18.2423 6.95797 319.983 18.2860 7.01478 325.158 18.3282 7.07206 330.418 18.3717 7.12981 335.762 18.4219 7.18802 341.192 18.5004 7.23740 346.711 18.5575 7.23201 352.319 18.5910 7.22663 358.017 18.6087 7.22125 363.808 18.6154 7.21587 369.692 18.6124 7.21050 375.672 18.6009 7.20513 381.748 18.5816 7.19977 387.922 18.5557 7.19441 394.197 18.5253 7.18905 400.573 18.5011 7.18158 407.052 18.4584 7.13971 413.635 18.3921 7.09809 420.326 18.3053 7.05671 427.124 18.2007 7.01558 434.032 18.0782 6.97468 441.052 17.9373 6.93402 448.186 17.7774 6.89360 455.435 17.5976 6.85341 462.802 17.4026 6.81346 470.287 17.1876 6.75741 477.894 16.9291 6.68752 485.623 16.6273 6.61836 493.478 16.2811 6.54990 501.459 15.8858 6.48216 509.570 15.4349 6.41513 517.812 14.9191 6.34833 526.187 14.3260 6.28195 534.698 13.6396 6.21627 543.346 12.8378 6.15128 552.134 11.8894 6.08696 561.065 10.7484 6.02332 570.139 9.34070 5.96034 579.361 7.55512 5.91282 588.732 5.18532 5.87023 598.254 1.76651 5.82814 607.930 -4.05496 5.78634 617.763 -21.9139 5.74484 619.900 -56.4870 5.73595 620.100 -56.4286 41.0545 627.755 -6.49421 40.1753 637.908 3.68249 39.0540 648.226 9.30876 37.9640 658.711 13.1979 36.9043 669.365 16.0906 35.8732 680.191 18.3507 34.9667 691.193 20.2378 34.1577 702.372 21.8610 33.3985 713.733 23.2741 32.6604 725.277 24.5079 31.9415 737.008 25.5853 31.2364 748.928 26.5221 30.5481 761.042 27.3222 29.8770 773.351 27.9945 29.2340 785.859 28.5448 28.6540 798.570 29.0214 28.1256 811.486 29.4208 27.6085 824.611 29.7105 27.0998 837.949 29.6802 26.5996 851.502 29.5116 26.4824 865.274 29.2739 26.7842 879.269 29.3738 27.4750 893.491 29.8774 28.1846 907.943 30.6169 28.9130 922.628 32.0426 29.6607 937.551 33.5319 29.5134 952.715 34.7961 29.1400 968.124 35.8226 28.5769 983.783 36.6192 28.0236 999.695 37.3058 27.4875 1015.86 37.8835 26.9684 1032.29 38.4062 26.5169 1048.99 38.8978 26.0924 1065.96 39.3726 25.6951 1083.20 39.8370 25.3041 1100.72 40.2830 24.9191 1118.52 40.7121 24.5398 1136.61 41.1257 24.1663 1155. 41.5258 23.7984 1173.68 41.9141 23.4360 1192.66 42.2934 23.0794 1211.95 42.6661 22.7281 1231.55 43.0512 22.3822 1251.47 43.4350 22.0112 1271.72 43.8164 21.6137 1292.29 44.1595 21.1837 1313.19 44.4581 20.7624 1334.43 44.7336 20.3494 1356.01 44.9897 19.9446 1377.94 45.2288 19.5476 1400.23 45.4530 19.1587 1422.88 45.6641 18.7776 1445.89 45.8646 18.4040 1469.28 46.0551 18.0362 1493.04 46.2392 17.6733 1517.19 46.4111 17.3080 1541.73 46.5673 16.9489 1566.67 46.7120 16.5972 1592.01 46.8464 16.2527 1617.76 46.9717 15.9154 1643.92 47.0888 15.5853 1670.51 47.1984 15.2617 1697.53 47.3012 14.9449 1724.99 47.3994 14.6348 1752.89 47.4913 14.3258 1781.24 47.5752 14.0217 1810.05 47.6509 13.7229 1839.32 47.7196 13.4301 1869.07 47.7816 13.1435 1899.30 47.8377 12.8632 1930.02 47.8886 12.5888 1961.24 47.9346 12.3204 1992.96 47.9745 12.0579 2025.20 48.0140 11.8050 2057.95 48.0509 11.5499 2091.24 48.0815 11.2994 2125.06 48.1068 11.0536 2159.43 48.1277 10.8127 2194.36 48.1444 10.5763 2229.85 48.1569 10.3440 2265.92 48.1650 10.1165 2302.57 48.1694 9.89337 2339.81 48.1699 9.67430 2377.66 48.1667 9.45950 2416.11 48.1596 9.24862 2455.19 48.1488 9.04206 2494.90 48.1342 8.83919 2535.26 48.1161 8.64043 2576.26 48.0943 8.44526 2617.93 48.0688 8.25386 2660.27 48.0393 8.06607 2703.30 48.0062 7.88234 2747.03 47.9695 7.70179 2791.46 47.9288 7.52474 2836.61 47.8842 7.35110 2882.49 47.8354 7.18070 2929.11 47.7823 7.01362 2976.48 47.7248 6.84971 3024.63 47.6626 6.68903 3073.55 47.5956 6.53139 3123.26 47.5234 6.37671 3173.78 47.4457 6.22507 3225.11 47.3622 6.07632 3277.27 47.2723 5.93040 3330.28 47.1756 5.78727 3384.15 47.0715 5.64690 3438.88 46.9592 5.50920 3494.50 46.8379 5.37413 3551.02 46.7065 5.24167 3608.46 46.5638 5.11168 3666.82 46.4082 4.98418 3726.13 46.2379 4.85918 3786.40 46.0506 4.73645 3847.64 45.8431 4.61609 3909.87 45.6118 4.49810 3973.11 45.3515 4.38229 4037.38 45.0551 4.26868 4102.68 44.7128 4.15724 4169.03 44.3099 4.04789 4236.46 43.8230 3.94061 4304.98 43.2119 3.83546 4374.62 42.3967 3.73217 4445.37 41.1771 3.63082 4517.27 38.7032 3.53148 4557. 24.5846 3.47842 4557.20 24.5863 10.8948 4590.33 38.2162 10.7676 4664.58 40.7492 10.4912 4740.03 41.5098 10.2219 4816.69 41.1320 9.95960 4852. 34.8390 9.84242 4852.20 34.8434 13.4276 4894.60 41.9824 13.2369 4973.77 43.6261 12.8921 5054.21 44.4398 12.5565 5135.96 44.7661 12.2295 5188. 41.4945 12.0285 5188.20 41.4989 13.9623 5219.03 45.0657 13.8381 5303.44 46.4440 13.5072 5389.22 47.2785 13.1822 5476.39 47.9296 12.8636 5564.97 48.4736 12.5511 5654.98 48.9426 12.2445 5746.44 49.3542 11.9440 5839.39 49.7198 11.6495 5933.83 50.0472 11.3610 6029.81 50.3423 11.0785 6127.33 50.6095 10.8017 6226.44 50.8520 10.5308 6327.15 51.0729 10.2657 6429.48 51.2745 10.0063 6533.48 51.4587 9.75257 6639.15 51.6272 9.50438 6746.54 51.7814 9.26173 6855.65 51.9226 9.02454 6966.54 52.0520 8.79265 7079.22 52.1703 8.56596 7193.72 52.2786 8.34462 7310.07 52.3776 8.12824 7428.31 52.4679 7.91697 7548.45 52.5502 7.71078 7670.54 52.6253 7.50938 7794.61 52.6935 7.31274 7920.68 52.7553 7.12084 8048.79 52.8112 6.93336 8178.98 52.8613 6.75046 8311.26 52.9063 6.57225 8445.69 52.9468 6.39830 8582.29 52.9826 6.22836 8721.11 53.0140 6.06286 8862.16 53.0416 5.90149 9005.50 53.0657 5.74410 9151.16 53.0862 5.59036 9299.17 53.1034 5.44083 9449.58 53.1177 5.29493 9602.42 53.1292 5.15276 9757.73 53.1381 5.01412 9915.55 53.1444 4.87897 10075.9 53.1484 4.74737 10238.9 53.1502 4.61915 10404.5 53.1501 4.49423 10572.8 53.1481 4.37252 10743.8 53.1443 4.25397 10917.6 53.1389 4.13850 11094.2 53.1319 4.02603 11273.6 53.1235 3.91650 11455.9 53.1138 3.80983 11641.2 53.1028 3.70596 11829.5 53.0907 3.60482 12020.8 53.0775 3.50635 12215.3 53.0633 3.41047 12412.8 53.0481 3.31714 12613.6 53.0321 3.22627 12817.6 53.0152 3.13782 13025.0 52.9976 3.05172 13235.6 52.9792 2.96792 13449.7 52.9602 2.88636 13667.2 52.9406 2.80698 13888.3 52.9204 2.72972 14112.9 52.8997 2.65454 14341.2 52.8785 2.58138 14573.1 52.8568 2.51018 14808.9 52.8346 2.44090 15048.4 52.8121 2.37349 15291.8 52.7892 2.30791 15539.1 52.7658 2.24409 15790.4 52.7422 2.18200 16045.8 52.7182 2.12160 16305.4 52.6939 2.06283 16569.1 52.6692 2.00566 16837.1 52.6443 1.95003 17109.4 52.6191 1.89593 17386.1 52.5935 1.84329 17667.4 52.5677 1.79209 17953.1 52.5416 1.74228 18243.5 52.5151 1.69383 18538.6 52.4884 1.64670 18838.4 52.4613 1.60086 19143.1 52.4338 1.55626 19452.7 52.4060 1.51289 19767.4 52.3778 1.47070 20087.1 52.3492 1.42967 20412.0 52.3201 1.38975 20742.1 52.2905 1.35093 21077.6 52.2604 1.31317 21418.5 52.2297 1.27645 21765.0 52.1983 1.24073 22117.0 52.1662 1.20598 22474.7 52.1334 1.17219 22838.2 52.0996 1.13932 23207.6 52.0648 1.10735 23583.0 52.0289 1.07626 23964.4 51.9917 1.04602 24352.0 51.9531 1.01660 24745.9 51.9129 0.987992 25146.2 51.8708 0.960164 25552.9 51.8266 0.933098 25966.2 51.7799 0.906772 26386.1 51.7304 0.881165 26812.9 51.6775 0.856258 27246.6 51.6205 0.832031 27687.3 51.5588 0.808466 28135.1 51.4913 0.785544 28590.2 51.4167 0.763247 29052.6 51.3331 0.741559 29522.5 51.2379 0.720461 30000.0 51.1274 0.699939 periodictable-1.5.0/periodictable/xsf/in.nff000066400000000000000000000317531310514471200210410ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.16244 10.1617 -9999. 2.07002 10.3261 -9999. 1.98155 10.4931 -9999. 1.89686 10.6628 -9999. 1.81579 10.8353 -9999. 1.72844 11.0106 -9999. 1.54985 11.1886 -9999. 1.35731 11.3696 -9999. 0.993252 11.5535 -9999. 0.742018 11.7404 -9999. 0.658180 11.9303 -9999. 0.612667 12.1232 -9999. 0.573696 12.3193 -9999. 0.537374 12.5186 -9999. 0.509773 12.7210 -9999. 0.491373 12.9268 -9999. 0.473638 13.1359 -9999. 0.456589 13.3483 -9999. 0.440370 13.5642 -9999. 0.424728 13.7836 -9999. 0.414034 14.0066 -9999. 0.404843 14.2331 -9999. 0.396113 14.4633 -9999. 0.388198 14.6973 -9999. 0.385980 14.9350 -9999. 0.387391 15.1765 -9999. 0.396152 15.4220 -9999. 0.410419 15.6714 -9999. 0.431951 15.9249 -9999. 0.455912 16.1825 -9999. 0.489651 16.4442 -9999. 0.691634 16.7102 -9999. 1.08283 16.9805 -9999. 1.49226 17.2551 -9999. 1.78423 17.5342 -9999. 1.92144 17.8178 -9999. 1.94167 18.1060 -9999. 1.95766 18.3989 -9999. 1.96600 18.6964 -9999. 1.95605 18.9988 -9999. 1.92465 19.3061 -9999. 1.90352 19.6184 -9999. 1.88557 19.9357 -9999. 1.82853 20.2582 -9999. 1.76749 20.5858 -9999. 1.75409 20.9188 -9999. 1.74106 21.2571 -9999. 1.72812 21.6009 -9999. 1.73515 21.9503 -9999. 1.77156 22.3053 -9999. 1.80874 22.6661 -9999. 1.86471 23.0327 -9999. 1.95371 23.4053 -9999. 2.04696 23.7838 -9999. 2.14466 24.1685 -9999. 2.25579 24.5594 -9999. 2.37578 24.9566 -9999. 2.50216 25.3603 -9999. 2.63526 25.7705 -9999. 2.76576 26.1873 -9999. 2.93943 26.6109 -9999. 3.13348 27.0413 -9999. 3.34034 27.4786 -9999. 3.50223 27.9231 -9999. 3.66764 28.3747 -9999. 3.84087 28.8337 -9999. 4.06669 29.3000 -1.51987 4.32792 29.7739 -1.54706 4.56695 30.2555 -1.58334 4.75454 30.7449 -1.64752 4.94983 31.2421 -1.74136 5.16036 31.7475 -1.83332 5.42475 32.2609 -1.89419 5.70269 32.7827 -1.93995 5.99488 33.3130 -1.96255 6.30145 33.8518 -1.94319 6.62114 34.3993 -1.90687 6.87184 34.9557 -1.89740 7.13204 35.5211 -1.89168 7.40209 36.0956 -1.88415 7.68236 36.6794 -1.87242 7.97325 37.2727 -1.85346 8.27515 37.8755 -1.82528 8.58848 38.4882 -1.78472 8.91368 39.1107 -1.71506 9.25118 39.7432 -1.62506 9.57113 40.3861 -1.54115 9.88020 41.0393 -1.45722 10.1993 41.7031 -1.36657 10.5286 42.3776 -1.26484 10.8686 43.0630 -1.14874 11.2196 43.7595 -1.01435 11.5819 44.4673 -0.827350 11.9559 45.1865 -0.617621 12.2735 45.9174 -0.436164 12.5863 46.6600 -0.250289 12.9071 47.4147 -0.550070E-01 13.2361 48.1816 0.157037 13.5734 48.9609 0.408463 13.9094 49.7528 0.668244 14.1975 50.5576 0.903882 14.4915 51.3753 1.14556 14.7916 52.2062 1.39512 15.0980 53.0506 1.65814 15.4106 53.9087 1.93838 15.7207 54.7806 2.22861 16.0272 55.6667 2.52847 16.3396 56.5670 2.84821 16.6582 57.4820 3.19594 16.9829 58.4117 3.59613 17.3140 59.3564 4.07115 17.5669 60.3165 4.51316 17.7093 61.2921 4.87293 17.8528 62.2834 5.20917 17.9975 63.2908 5.47784 18.1434 64.3145 5.71312 18.3801 65.3547 6.01602 18.7146 66.4118 6.39303 19.0551 67.4859 6.96027 19.4018 68.5775 7.55437 19.4426 69.6867 7.89693 19.4471 70.8138 8.09900 19.4661 71.9591 8.25154 19.7810 73.1230 8.51743 20.1009 74.3057 8.68780 20.4261 75.5076 8.85727 21.0189 76.7289 9.27382 21.7901 77.9699 9.89802 22.5897 79.2310 10.8442 23.4186 80.5125 12.0436 24.0119 81.8147 13.2334 24.3235 83.1380 14.4128 24.6392 84.4827 15.9636 24.9589 85.8491 17.6504 24.6610 87.2377 18.9234 24.0900 88.6487 20.0231 23.5323 90.0825 21.0400 22.9874 91.5395 22.0277 22.4552 93.0201 23.0747 21.9352 94.5246 24.3349 21.4124 96.0535 25.5304 20.0346 97.6071 26.2006 18.7454 99.1858 26.6544 17.5392 100.790 26.9621 16.4105 102.420 27.1630 15.3546 104.077 27.2812 14.3665 105.760 27.3359 13.4421 107.471 27.3408 12.5771 109.209 27.3287 11.7675 110.975 27.2772 10.9499 112.770 27.1511 10.1891 114.594 26.9928 9.48115 116.448 26.8092 8.82241 118.331 26.6063 8.20945 120.245 26.3905 7.63905 122.190 26.1664 7.10830 124.166 25.9399 6.61442 126.175 25.7178 6.15485 128.215 25.5129 5.72721 130.289 25.3659 5.32929 132.397 25.2858 4.79050 134.538 25.0639 4.10820 136.714 24.6395 3.52310 138.925 24.1500 3.02132 141.172 23.6030 2.63553 143.456 23.0693 2.37563 145.776 22.5780 2.15004 148.134 22.0825 1.97681 150.530 21.5930 1.86588 152.964 21.1290 1.81419 155.439 20.7009 1.81256 157.953 20.3192 1.84702 160.507 19.9783 1.88800 163.103 19.6640 1.94576 165.742 19.3783 2.00529 168.422 19.1071 2.06792 171.146 18.8516 2.14723 173.915 18.6169 2.22959 176.727 18.3966 2.31511 179.586 18.1872 2.40391 182.491 17.9882 2.50249 185.442 17.8035 2.60565 188.442 17.6302 2.71306 191.489 17.4678 2.82490 194.587 17.3171 2.94135 197.734 17.1771 3.05935 200.932 17.0445 3.18022 204.182 16.9205 3.30587 207.485 16.8059 3.43648 210.840 16.7019 3.57226 214.251 16.6106 3.71340 217.716 16.5397 3.86012 221.237 16.4849 3.98186 224.816 16.4229 4.10237 228.452 16.3626 4.22653 232.147 16.3079 4.35445 235.902 16.2606 4.48624 239.717 16.2224 4.62201 243.595 16.2096 4.76190 247.535 16.2092 4.87200 251.538 16.1923 4.97950 255.607 16.1785 5.08938 259.741 16.1693 5.20168 263.942 16.1677 5.31645 268.211 16.1855 5.43376 272.549 16.2257 5.53876 276.957 16.2643 5.59146 281.437 16.2791 5.64465 285.989 16.2866 5.69836 290.615 16.2914 5.75257 295.315 16.2977 5.80731 300.092 16.3144 5.86256 304.945 16.3509 5.88879 309.878 16.3676 5.87070 314.890 16.3456 5.85266 319.983 16.3086 5.83467 325.158 16.2580 5.81675 330.418 16.1986 5.79887 335.762 16.1290 5.76451 341.192 16.0338 5.72340 346.711 15.9148 5.68258 352.319 15.7748 5.64204 358.017 15.6134 5.60180 363.808 15.4305 5.56184 369.692 15.2236 5.51516 375.672 14.9827 5.46471 381.748 14.7037 5.41473 387.922 14.3835 5.36520 394.197 14.0088 5.31613 400.573 13.5727 5.27970 407.052 13.0832 5.27535 413.635 12.5374 5.27101 420.326 11.8846 5.26666 427.124 11.1169 5.31364 434.032 10.2736 5.41613 441.052 9.47596 5.52059 443.800 10.6734 5.56157 444.000 10.5639 3.58563 448.186 6.68163 4.49251 455.435 3.96074 6.60583 462.802 2.52924 9.71329 470.287 2.21022 12.5187 477.894 1.97589 15.3206 485.623 2.71371 18.7498 493.478 4.82660 20.8571 501.459 6.67054 22.3283 509.570 8.30000 23.2112 517.812 9.80035 24.1291 526.187 11.4742 24.7386 534.698 12.9700 24.9583 543.346 14.3294 25.1800 552.134 15.6461 25.0704 561.065 16.6175 24.8845 570.139 17.4461 24.6999 579.361 18.1230 24.5167 588.732 18.6809 24.3966 598.254 19.2051 24.3595 607.930 19.7052 24.3223 617.763 20.2164 24.2853 627.755 20.6751 24.1094 637.908 20.6129 23.7562 648.226 20.1002 23.9302 658.711 19.8932 25.1601 669.365 20.3338 26.4532 680.191 21.4247 27.8128 691.193 23.1840 28.8952 702.372 25.0064 28.6033 713.733 26.2436 28.3143 725.277 27.3650 28.0282 737.008 28.3850 27.5828 748.928 29.1658 27.0982 761.042 29.7932 26.6222 773.351 30.1958 26.2179 785.859 30.5723 26.1563 798.570 31.1509 26.0949 811.486 31.7727 26.0337 824.611 32.5186 25.9725 837.949 33.2978 25.6803 851.502 33.9336 25.3864 865.274 34.5536 25.0957 879.269 35.2118 24.8084 893.491 35.8707 24.4025 907.943 36.4108 23.9705 922.628 36.9053 23.5460 937.551 37.3634 23.1322 952.715 37.7949 22.7266 968.124 38.2053 22.3289 983.783 38.6003 21.9382 999.695 38.9878 21.5485 1015.86 39.3699 21.1599 1032.29 39.7347 20.7214 1048.99 40.0516 20.2914 1065.96 40.3410 19.8702 1083.20 40.6079 19.4578 1100.72 40.8556 19.0539 1118.52 41.0860 18.6584 1136.61 41.3008 18.2712 1155. 41.5014 17.8919 1173.68 41.6887 17.5204 1192.66 41.8637 17.1569 1211.95 42.0276 16.8008 1231.55 42.1810 16.4521 1251.47 42.3243 16.1105 1271.72 42.4582 15.7760 1292.29 42.5833 15.4486 1313.19 42.7002 15.1281 1334.43 42.8094 14.8142 1356.01 42.9113 14.5067 1377.94 43.0062 14.2056 1400.23 43.0945 13.9107 1422.88 43.1765 13.6219 1445.89 43.2525 13.3392 1469.28 43.3231 13.0623 1493.04 43.3883 12.7911 1517.19 43.4485 12.5254 1541.73 43.5038 12.2650 1566.67 43.5544 12.0100 1592.01 43.6006 11.7604 1617.76 43.6427 11.5159 1643.92 43.6811 11.2766 1670.51 43.7160 11.0421 1697.53 43.7477 10.8125 1724.99 43.7788 10.5876 1752.89 43.8079 10.3619 1781.24 43.8295 10.1389 1810.05 43.8460 9.91898 1839.32 43.8570 9.70402 1869.07 43.8638 9.49377 1899.30 43.8668 9.28813 1930.02 43.8662 9.08683 1961.24 43.8620 8.88990 1992.96 43.8541 8.69729 2025.20 43.8453 8.51216 2057.95 43.8364 8.32445 2091.24 43.8207 8.13978 2125.06 43.8010 7.95855 2159.43 43.7774 7.78050 2194.36 43.7497 7.60617 2229.85 43.7185 7.43484 2265.92 43.6831 7.26657 2302.57 43.6436 7.10168 2339.81 43.6001 6.93958 2377.66 43.5521 6.78093 2416.11 43.4998 6.62507 2455.19 43.4429 6.47223 2494.90 43.3812 6.32231 2535.26 43.3143 6.17519 2576.26 43.2420 6.03090 2617.93 43.1641 5.88943 2660.27 43.0800 5.75061 2703.30 42.9892 5.61447 2747.03 42.8913 5.48100 2791.46 42.7855 5.35007 2836.61 42.6710 5.22170 2882.49 42.5469 5.09578 2929.11 42.4121 4.97234 2976.48 42.2651 4.85124 3024.63 42.1043 4.73253 3073.55 41.9276 4.61615 3123.26 41.7323 4.50194 3173.78 41.5150 4.39002 3225.11 41.2712 4.28029 3277.27 40.9951 4.17270 3330.28 40.6781 4.06717 3384.15 40.3084 3.96369 3438.88 39.8676 3.86230 3494.50 39.3256 3.76282 3551.02 38.6274 3.66533 3608.46 37.6541 3.56968 3666.82 36.0539 3.47592 3726.13 29.5173 3.38402 3730. 21.0532 3.37816 3730.20 21.0550 10.6791 3786.40 35.5004 10.4378 3847.64 36.7290 10.1850 3909.87 36.4537 9.93807 3937.90 30.3105 9.83012 3938.10 30.3160 13.5004 3973.11 37.5132 13.3113 4037.38 39.2653 12.9752 4102.68 40.1923 12.6475 4169.03 40.7033 12.3288 4236.46 39.0790 12.0185 4237.40 37.9036 12.0143 4237.60 37.9089 13.8395 4304.98 41.9828 13.5217 4374.62 42.9091 13.2059 4445.37 43.6018 12.8955 4517.27 44.1731 12.5906 4590.33 44.6635 12.2910 4664.58 45.0929 11.9967 4740.03 45.4743 11.7078 4816.69 45.8161 11.4243 4894.60 46.1245 11.1464 4973.77 46.4040 10.8737 5054.21 46.6582 10.6064 5135.96 46.8902 10.3445 5219.03 47.1024 10.0879 5303.44 47.2967 9.83652 5389.22 47.4747 9.59033 5476.39 47.6380 9.34942 5564.97 47.7881 9.11368 5654.98 47.9259 8.88285 5746.44 48.0522 8.65718 5839.39 48.1683 8.43646 5933.83 48.2747 8.22062 6029.81 48.3723 8.00956 6127.33 48.4615 7.80330 6226.44 48.5431 7.60180 6327.15 48.6177 7.40489 6429.48 48.6855 7.21256 6533.48 48.7471 7.02470 6639.15 48.8030 6.84120 6746.54 48.8535 6.66207 6855.65 48.8989 6.48721 6966.54 48.9397 6.31649 7079.22 48.9759 6.14986 7193.72 49.0080 5.98724 7310.07 49.0362 5.82870 7428.31 49.0609 5.67408 7548.45 49.0822 5.52315 7670.54 49.1003 5.37591 7794.61 49.1154 5.23241 7920.68 49.1277 5.09244 8048.79 49.1374 4.95604 8178.98 49.1446 4.82305 8311.26 49.1497 4.69338 8445.69 49.1525 4.56687 8582.29 49.1532 4.44387 8721.11 49.1522 4.32375 8862.16 49.1493 4.20679 9005.50 49.1447 4.09286 9151.16 49.1386 3.98194 9299.17 49.1312 3.87390 9449.58 49.1224 3.76859 9602.42 49.1124 3.66588 9757.73 49.1009 3.56601 9915.55 49.0885 3.46895 10075.9 49.0753 3.37423 10238.9 49.0610 3.28199 10404.5 49.0458 3.19219 10572.8 49.0298 3.10476 10743.8 49.0130 3.01965 10917.6 48.9955 2.93680 11094.2 48.9773 2.85615 11273.6 48.9585 2.77765 11455.9 48.9391 2.70125 11641.2 48.9191 2.62689 11829.5 48.8987 2.55452 12020.8 48.8777 2.48410 12215.3 48.8563 2.41557 12412.8 48.8345 2.34889 12613.6 48.8123 2.28400 12817.6 48.7898 2.22087 13025.0 48.7668 2.15945 13235.6 48.7436 2.09969 13449.7 48.7200 2.04155 13667.2 48.6961 1.98498 13888.3 48.6719 1.92996 14112.9 48.6474 1.87643 14341.2 48.6226 1.82436 14573.1 48.5976 1.77371 14808.9 48.5722 1.72444 15048.4 48.5465 1.67652 15291.8 48.5206 1.62990 15539.1 48.4943 1.58457 15790.4 48.4677 1.54047 16045.8 48.4408 1.49758 16305.4 48.4135 1.45587 16569.1 48.3858 1.41530 16837.1 48.3577 1.37585 17109.4 48.3292 1.33747 17386.1 48.3002 1.30016 17667.4 48.2706 1.26386 17953.1 48.2405 1.22857 18243.5 48.2097 1.19424 18538.6 48.1782 1.16086 18838.4 48.1459 1.12840 19143.1 48.1128 1.09683 19452.7 48.0786 1.06613 19767.4 48.0434 1.03628 20087.1 48.0069 1.00725 20412.0 47.9691 0.979015 20742.1 47.9297 0.951560 21077.6 47.8884 0.924860 21418.5 47.8451 0.898896 21765.0 47.7994 0.873646 22117.0 47.7509 0.849092 22474.7 47.6992 0.825214 22838.2 47.6437 0.801993 23207.6 47.5835 0.779411 23583.0 47.5179 0.757449 23964.4 47.4455 0.736093 24352.0 47.3646 0.715322 24745.9 47.2730 0.695124 25146.2 47.1672 0.675479 25552.9 47.0422 0.656375 25966.2 46.8897 0.637795 26386.1 46.6953 0.619724 26812.9 46.4295 0.602150 27246.6 46.0168 0.585057 27687.3 45.1261 0.568432 27939.8 37.8125 0.559235 27940.0 37.8127 3.51485 28135.1 44.9797 3.47697 28590.2 46.1704 3.39119 29052.6 46.7166 3.30702 29522.5 47.0865 3.22447 30000.0 47.3215 3.14355 periodictable-1.5.0/periodictable/xsf/ir.nff000066400000000000000000000320301310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.22753 10.1617 -9999. 2.30683 10.3261 -9999. 2.38895 10.4931 -9999. 2.47400 10.6628 -9999. 2.56207 10.8353 -9999. 2.65417 11.0106 -9999. 2.75003 11.1886 -9999. 2.84935 11.3696 -9999. 2.94781 11.5535 -9999. 3.01180 11.7404 -9999. 3.07717 11.9303 -9999. 3.14397 12.1232 -9999. 3.21221 12.3193 -9999. 3.26205 12.5186 -9999. 3.30439 12.7210 -9999. 3.34729 12.9268 -9999. 3.39074 13.1359 -9999. 3.43476 13.3483 -9999. 3.47696 13.5642 -9999. 3.51962 13.7836 -9999. 3.56281 14.0066 -9999. 3.61496 14.2331 -9999. 3.70069 14.4633 -9999. 3.78846 14.6973 -9999. 3.87831 14.9350 -9999. 3.97029 15.1765 -9999. 4.07172 15.4220 -9999. 4.19560 15.6714 -9999. 4.32325 15.9249 -9999. 4.45478 16.1825 -9999. 4.60711 16.4442 -9999. 4.77331 16.7102 -9999. 4.94550 16.9805 -9999. 5.12391 17.2551 -9999. 5.30875 17.5342 -9999. 5.50602 17.8178 -9999. 5.74269 18.1060 -9999. 5.98954 18.3989 -9999. 6.24699 18.6964 -9999. 6.51552 18.9988 -9999. 6.74800 19.3061 -9999. 6.97561 19.6184 -9999. 7.21091 19.9357 -9999. 7.45414 20.2582 -9999. 7.68496 20.5858 -9999. 7.89057 20.9188 -9999. 8.10168 21.2571 -9999. 8.31844 21.6009 -9999. 8.52534 21.9503 -9999. 8.68506 22.3053 -9999. 8.84777 22.6661 -9999. 9.01353 23.0327 -9999. 9.18240 23.4053 -9999. 9.26201 23.7838 -9999. 9.32872 24.1685 -9999. 9.39591 24.5594 -9999. 9.46360 24.9566 -9999. 9.52948 25.3603 -9999. 9.59091 25.7705 -9999. 9.65272 26.1873 -9999. 9.71494 26.6109 -9999. 9.77755 27.0413 -9999. 9.79801 27.4786 -9999. 9.75976 27.9231 -9999. 9.72165 28.3747 -9999. 9.68369 28.8337 -9999. 9.64587 29.3000 6.72334 9.60821 29.7739 6.99072 9.55265 30.2555 7.24352 9.41385 30.7449 7.45180 9.27707 31.2421 7.64444 9.14228 31.7475 7.84077 9.00945 32.2609 8.06846 8.83057 32.7827 8.23692 8.54247 33.3130 8.30087 8.26376 33.8518 8.29295 7.99415 34.3993 8.20921 7.81682 34.9557 8.16140 7.67421 35.5211 8.10373 7.53419 36.0956 8.01446 7.39673 36.6794 7.87488 7.32637 37.2727 7.77655 7.30348 37.8755 7.69669 7.28067 38.4882 7.61697 7.25791 39.1107 7.52223 7.23524 39.7432 7.40242 7.22018 40.3861 7.28098 7.27384 41.0393 7.18442 7.32791 41.7031 7.09193 7.38238 42.3776 6.99550 7.43725 43.0630 6.88132 7.49253 43.7595 6.74127 7.57126 44.4673 6.60653 7.66543 45.1865 6.45295 7.76077 45.9174 6.25263 7.85729 46.6600 5.97893 7.98694 47.4147 5.48975 8.13775 48.1816 4.66401 8.82385 48.9609 4.55534 10.0722 49.7528 5.15089 11.5471 50.5576 6.13179 11.6384 51.3753 6.66397 11.7304 52.2062 7.05904 11.8232 53.0506 7.38759 11.9167 53.9087 7.67541 12.0109 54.7806 7.93458 12.1059 55.6667 8.17061 12.2016 56.5670 8.38449 12.2980 57.4820 8.57160 12.3953 58.4117 8.71295 12.4933 59.3564 8.75019 12.6564 60.3165 8.84789 13.0205 61.2921 9.03126 13.3950 62.2834 9.23405 13.8208 63.2908 9.58538 14.4146 64.3145 10.1685 15.0340 65.3547 11.0860 15.4537 66.4118 11.9541 15.6977 67.4859 13.0309 15.8904 68.5775 14.0673 15.5224 69.6867 14.9278 15.1628 70.8138 15.8426 14.6264 71.9591 16.4360 13.8968 73.1230 16.8343 13.2036 74.3057 17.1096 12.5450 75.5076 17.2948 11.9467 76.7289 17.4220 11.3800 77.9699 17.4918 10.8402 79.2310 17.5039 10.3259 80.5125 17.4509 9.83611 81.8147 17.2939 9.38831 83.1380 17.1432 9.13335 84.4827 17.0462 8.88532 85.8491 16.9673 8.64404 87.2377 16.8886 8.40929 88.6487 16.8042 8.18092 90.0825 16.7060 7.95875 91.5395 16.5772 7.74263 93.0201 16.4456 7.59762 94.5246 16.3386 7.45957 96.0535 16.2389 7.32402 97.6071 16.1407 7.19093 99.1858 16.0410 7.06026 100.790 15.9382 6.93197 102.420 15.8332 6.80446 104.077 15.7165 6.66951 105.760 15.5842 6.53724 107.471 15.4346 6.40758 109.209 15.2603 6.28051 110.975 15.0366 6.18486 112.770 14.8316 6.12755 114.594 14.6295 6.07076 116.448 14.4061 6.01451 118.331 14.1093 5.99740 120.245 13.8573 6.05809 122.190 13.6358 6.11939 124.166 13.4142 6.18130 126.175 13.1651 6.24385 128.215 12.9041 6.37948 130.289 12.6851 6.54412 132.397 12.4878 6.71301 134.538 12.3018 6.88626 136.714 12.1216 7.06398 138.925 11.9399 7.24629 141.172 11.7345 7.45043 143.456 11.5582 7.70210 145.776 11.4050 7.96227 148.134 11.2679 8.23123 150.530 11.1449 8.50927 152.964 11.0376 8.79571 155.439 10.9412 9.08733 157.953 10.8554 9.38862 160.507 10.7827 9.69990 163.103 10.7248 10.0215 165.742 10.6856 10.3538 168.422 10.6978 10.6887 171.146 10.7035 10.9707 173.915 10.6900 11.2602 176.727 10.6726 11.5573 179.586 10.6520 11.8622 182.491 10.6221 12.1752 185.442 10.5812 12.5300 188.442 10.5699 12.9193 191.489 10.5947 13.3208 194.587 10.6559 13.7199 197.734 10.7189 14.1025 200.932 10.7874 14.4957 204.182 10.8674 14.8999 207.485 10.9628 15.3154 210.840 11.0766 15.7425 214.251 11.2129 16.1815 217.716 11.3904 16.6328 221.237 11.6075 17.0582 224.816 11.8192 17.4581 228.452 12.0354 17.8674 232.147 12.2671 18.2863 235.902 12.5226 18.7150 239.717 12.8111 19.1538 243.595 13.1472 19.6029 247.535 13.6293 19.9962 251.538 14.0632 20.2299 255.607 14.4124 20.4664 259.741 14.7453 20.7057 263.942 15.0683 20.9477 268.211 15.3871 21.1925 272.549 15.7120 21.4371 276.957 16.0338 21.6732 281.437 16.3522 21.9118 285.989 16.6780 22.1530 290.615 17.0212 22.3776 295.315 17.3511 22.5766 300.092 17.6603 22.7774 304.945 17.9606 22.9800 309.878 18.2496 23.1844 314.890 18.5087 23.3906 319.983 18.7731 23.6654 325.158 19.0664 23.9509 330.418 19.3837 24.2400 335.762 19.7185 24.5325 341.192 20.0713 24.8285 346.711 20.4447 25.1281 352.319 20.8441 25.4313 358.017 21.2946 25.7382 363.808 21.7691 25.9671 369.692 22.2230 26.1695 375.672 22.6578 26.3735 381.748 23.0929 26.5790 387.922 23.5321 26.7862 394.197 23.9789 26.9950 400.573 24.4367 27.2053 407.052 24.9102 27.4174 413.635 25.4067 27.6311 420.326 25.9490 27.8464 427.124 26.5448 27.9861 434.032 27.1105 28.0449 441.052 27.6193 28.1038 448.186 28.1155 28.1628 455.435 28.6025 28.2219 462.802 29.0838 28.2811 470.287 29.5622 28.3405 477.894 30.0397 28.4000 485.623 30.5183 28.4596 493.478 30.9996 28.5193 501.459 31.4855 28.5792 509.570 31.9782 28.6392 517.812 32.4801 28.6994 526.187 32.9947 28.7596 534.698 33.5267 28.8200 543.346 34.0827 28.8805 552.134 34.7042 28.9411 561.065 35.3983 28.9457 570.139 36.0692 28.7507 579.361 36.6365 28.5570 588.732 37.1613 28.3645 598.254 37.6574 28.1734 607.930 38.1314 27.9835 617.763 38.5876 27.7950 627.755 39.0286 27.6077 637.908 39.4568 27.4217 648.226 39.8737 27.2369 658.711 40.2807 27.0534 669.365 40.6791 26.8711 680.191 41.0696 26.6900 691.193 41.4534 26.5101 702.372 41.8313 26.3315 713.733 42.2041 26.1541 725.277 42.5727 25.9778 737.008 42.9380 25.8028 748.928 43.3010 25.6289 761.042 43.6627 25.4562 773.351 44.0245 25.2847 785.859 44.3881 25.1143 798.570 44.7555 24.9451 811.486 45.1300 24.7770 824.611 45.5162 24.6100 837.949 45.9217 24.4442 851.502 46.3525 24.2795 865.274 47.0374 24.1159 879.269 47.7299 23.1760 893.491 47.6502 22.8917 907.943 47.8377 22.6104 922.628 48.0699 22.3323 937.551 48.3145 22.0307 952.715 48.5452 21.7261 968.124 48.7641 21.4195 983.783 48.9726 21.1168 999.695 49.1744 20.8156 1015.86 49.3725 20.5158 1032.29 49.5617 20.1959 1048.99 49.7269 19.8775 1065.96 49.8750 19.5605 1083.20 50.0074 19.2482 1100.72 50.1261 18.9404 1118.52 50.2318 18.6372 1136.61 50.3254 18.3388 1155. 50.4077 18.0448 1173.68 50.4785 17.7550 1192.66 50.5384 17.4697 1211.95 50.5880 17.1886 1231.55 50.6283 16.9115 1251.47 50.6593 16.6345 1271.72 50.6793 16.3572 1292.29 50.6826 16.0786 1313.19 50.6692 15.8041 1334.43 50.6405 15.5341 1356.01 50.5968 15.2685 1377.94 50.5379 15.0070 1400.23 50.4632 14.7497 1422.88 50.3721 14.4967 1445.89 50.2644 14.2476 1469.28 50.1392 14.0016 1493.04 49.9948 13.7584 1517.19 49.8288 13.5142 1541.73 49.6354 13.2737 1566.67 49.4148 13.0375 1592.01 49.1647 12.8046 1617.76 48.8815 12.5757 1643.92 48.5614 12.3508 1670.51 48.1997 12.1300 1697.53 47.7910 11.9127 1724.99 47.3275 11.6986 1752.89 46.7982 11.4807 1781.24 46.1826 11.2642 1810.05 45.4617 11.0495 1839.32 44.6082 10.8384 1869.07 43.5809 10.6314 1899.30 42.3152 10.4286 1930.02 40.6977 10.2293 1961.24 38.5034 10.0336 1992.96 35.1665 9.84134 2025.20 28.0964 9.65784 2040.30 -0.661999 9.57403 2040.50 -0.662121 27.3304 2057.95 27.9204 27.0332 2091.24 31.1926 26.4821 2116. 12.3218 26.0849 2116.20 12.3531 38.4468 2125.06 30.7428 38.2183 2159.43 39.3349 37.3539 2194.36 43.4216 36.5093 2229.85 46.2669 35.6836 2265.92 48.4512 34.8774 2302.57 50.1998 34.0887 2339.81 51.6236 33.3195 2377.66 52.7806 32.5676 2416.11 53.6903 31.8326 2455.19 54.3294 31.1154 2494.90 54.5727 30.4148 2535.26 53.6177 29.7302 2550.60 46.3715 29.4768 2550.80 46.3776 34.2272 2576.26 55.3436 33.7198 2617.93 57.5958 32.9158 2660.27 59.0087 32.1309 2703.30 60.0854 31.3671 2747.03 60.9473 30.6217 2791.46 61.6302 29.8949 2836.61 62.1188 29.1861 2882.49 62.2280 28.4950 2908.60 59.4369 28.1138 2908.80 59.4396 29.8860 2929.11 62.6994 29.5896 2976.48 63.9144 28.9171 3024.63 64.6814 28.2609 3073.55 65.2621 27.6210 3123.26 65.6628 26.9958 3173.60 64.2909 26.3869 3173.80 64.2928 27.3502 3225.11 66.7040 26.7731 3277.27 67.3825 26.2048 3330.28 67.9414 25.6446 3384.15 68.4346 25.0927 3438.88 68.8797 24.5489 3494.50 69.2867 24.0139 3551.02 69.6604 23.4860 3608.46 70.0058 22.9681 3666.82 70.3260 22.4579 3726.13 70.6223 21.9572 3786.40 70.8967 21.4634 3847.64 71.1510 20.9795 3909.87 71.3872 20.5046 3973.11 71.6066 20.0382 4037.38 71.8088 19.5793 4102.68 71.9969 19.1308 4169.03 72.1711 18.6892 4236.46 72.3310 18.2562 4304.98 72.4781 17.8316 4374.62 72.6135 17.4155 4445.37 72.7374 17.0075 4517.27 72.8504 16.6077 4590.33 72.9533 16.2161 4664.58 73.0465 15.8322 4740.03 73.1304 15.4564 4816.69 73.2056 15.0885 4894.60 73.2725 14.7282 4973.77 73.3314 14.3754 5054.21 73.3829 14.0303 5135.96 73.4270 13.6926 5219.03 73.4644 13.3622 5303.44 73.4951 13.0389 5389.22 73.5196 12.7228 5476.39 73.5380 12.4137 5564.97 73.5507 12.1116 5654.98 73.5580 11.8162 5746.44 73.5601 11.5274 5839.39 73.5570 11.2452 5933.83 73.5491 10.9694 6029.81 73.5363 10.6999 6127.33 73.5191 10.4367 6226.44 73.4974 10.1796 6327.15 73.4714 9.92852 6429.48 73.4413 9.68345 6533.48 73.4071 9.44395 6639.15 73.3690 9.21018 6746.54 73.3269 8.98196 6855.65 73.2810 8.75918 6966.54 73.2310 8.54146 7079.22 73.1772 8.32915 7193.72 73.1194 8.12195 7310.07 73.0577 7.91989 7428.31 72.9920 7.72256 7548.45 72.9222 7.53009 7670.54 72.8481 7.34241 7794.61 72.7697 7.15912 7920.68 72.6866 6.98032 8048.79 72.5986 6.80599 8178.98 72.5052 6.63582 8311.26 72.4063 6.46999 8445.69 72.3011 6.30817 8582.29 72.1896 6.15055 8721.11 72.0705 5.99655 8862.16 71.9433 5.84659 9005.50 71.8067 5.70018 9151.16 71.6597 5.55755 9299.17 71.5003 5.41839 9449.58 71.3267 5.28280 9602.42 71.1361 5.15050 9757.73 70.9248 5.02171 9915.55 70.6895 4.89611 10075.9 70.4205 4.77048 10238.9 70.1059 4.64835 10404.5 69.7302 4.52961 10572.8 69.2641 4.41418 10743.8 68.6503 4.30200 10917.6 67.7469 4.19296 11094.2 65.9800 4.08700 11215.1 51.9627 4.01691 11215.3 51.9638 10.3030 11273.6 64.6650 10.2052 11455.9 67.5139 9.90830 11641.2 68.5918 9.62008 11829.5 69.1967 9.34025 12020.8 69.5442 9.06856 12215.3 69.6942 8.80476 12412.8 69.6329 8.54866 12613.6 69.2139 8.29999 12817.6 65.8472 8.05857 12824.0 61.5660 8.05120 12824.2 61.5663 11.2792 13025.0 69.5017 11.0047 13235.6 70.2243 10.7282 13418.4 67.7144 10.4973 13418.6 67.7161 11.9016 13449.7 70.0605 11.8614 13667.2 71.4638 11.5862 13888.3 72.1629 11.3157 14112.9 72.6906 11.0499 14341.2 73.1237 10.7889 14573.1 73.4929 10.5326 14808.9 73.8143 10.2810 15048.4 74.0982 10.0342 15291.8 74.3512 9.79217 15539.1 74.5783 9.55482 15790.4 74.7832 9.32215 16045.8 74.9687 9.09416 16305.4 75.1372 8.87080 16569.1 75.2905 8.65203 16837.1 75.4303 8.43782 17109.4 75.5577 8.22812 17386.1 75.6740 8.02289 17667.4 75.7802 7.82207 17953.1 75.8771 7.62561 18243.5 75.9654 7.43346 18538.6 76.0459 7.24557 18838.4 76.1192 7.06186 19143.1 76.1858 6.88229 19452.7 76.2462 6.70679 19767.4 76.3008 6.53530 20087.1 76.3500 6.36775 20412.0 76.3943 6.20408 20742.1 76.4339 6.04423 21077.6 76.4692 5.88813 21418.5 76.5005 5.73571 21765.0 76.5280 5.58691 22117.0 76.5519 5.44167 22474.7 76.5726 5.29991 22838.2 76.5902 5.16156 23207.6 76.6049 5.02658 23583.0 76.6170 4.89487 23964.4 76.6265 4.76639 24352.0 76.6337 4.64107 24745.9 76.6386 4.51884 25146.2 76.6415 4.39963 25552.9 76.6425 4.28340 25966.2 76.6417 4.17006 26386.1 76.6391 4.05956 26812.9 76.6350 3.95184 27246.6 76.6295 3.84683 27687.3 76.6226 3.74448 28135.1 76.6144 3.64473 28590.2 76.6051 3.54751 29052.6 76.5953 3.45278 29522.5 76.5935 3.36047 30000.0 76.5426 3.27053 periodictable-1.5.0/periodictable/xsf/k.nff000066400000000000000000000320001310514471200206470ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.342643E-01 10.1617 -9999. 0.352921E-01 10.3261 -9999. 0.363507E-01 10.4931 -9999. 0.374410E-01 10.6628 -9999. 0.385641E-01 10.8353 -9999. 0.397209E-01 11.0106 -9999. 0.409123E-01 11.1886 -9999. 0.421395E-01 11.3696 -9999. 0.434035E-01 11.5535 -9999. 0.447054E-01 11.7404 -9999. 0.458918E-01 11.9303 -9999. 0.467761E-01 12.1232 -9999. 0.476775E-01 12.3193 -9999. 0.485962E-01 12.5186 -9999. 0.495326E-01 12.7210 -9999. 0.505034E-01 12.9268 -9999. 0.515183E-01 13.1359 -9999. 0.525536E-01 13.3483 -9999. 0.536097E-01 13.5642 -9999. 0.547076E-01 13.7836 -9999. 0.558610E-01 14.0066 -9999. 0.570387E-01 14.2331 -9999. 0.582413E-01 14.4633 -9999. 0.594692E-01 14.6973 -9999. 0.608386E-01 14.9350 -9999. 0.623585E-01 15.1765 -9999. 0.639162E-01 15.4220 -9999. 0.655129E-01 15.6714 -9999. 0.667297E-01 15.9249 -9999. 0.698655E-01 16.1825 -9999. 0.778034E-01 16.4442 -9999. 0.927407E-01 16.7102 -9999. 0.101038 16.9805 -9999. 0.100077 17.2551 -9999. 0.991247E-01 17.5342 -9999. 0.972030E-01 17.8178 -9999. 0.101597 18.1060 -9999. 0.125934 18.3989 -9999. 0.169815 18.6964 -9999. 0.232685 18.9988 -9999. 0.316999 19.3061 -9999. 0.445772 19.6184 -9999. 0.695715 19.9357 -9999. 1.36743 20.2582 -9999. 4.67523 20.5858 -9999. 5.53876 20.9188 -9999. 6.01936 21.2571 -9999. 6.54165 21.6009 -9999. 7.10926 21.9503 -9999. 7.72612 22.3053 -9999. 8.21083 22.6661 -9999. 8.65970 23.0327 -9999. 9.13312 23.4053 -9999. 9.63242 23.7838 -9999. 10.1590 24.1685 -9999. 10.7136 24.5594 -9999. 11.2607 24.9566 -9999. 11.8358 25.3603 -9999. 12.4402 25.7705 -9999. 13.0756 26.1873 -9999. 13.6526 26.6109 -9999. 13.9461 27.0413 -9999. 14.2459 27.4786 -9999. 14.5521 27.9231 -9999. 14.8649 28.3747 -9999. 15.1844 28.8337 -9999. 15.4706 29.3000 2.17828 15.5477 29.7739 2.89939 15.6251 30.2555 3.60817 15.7029 30.7449 4.33571 15.7812 31.2421 5.11707 15.8598 31.7475 6.03373 15.8136 32.2609 6.83119 15.6376 32.7827 7.59044 15.4635 33.3130 8.35387 15.2914 33.8518 9.18461 15.1212 34.3993 10.1988 14.9437 34.9557 11.1641 14.2499 35.5211 11.9451 13.5883 36.0956 12.6035 12.7896 36.6794 13.1354 12.0324 37.2727 13.6803 11.2669 37.8755 14.0504 10.2831 38.4882 14.2223 9.38513 39.1107 14.2816 8.58297 39.7432 14.2982 7.85498 40.3861 14.3079 7.15591 41.0393 14.2245 6.45992 41.7031 14.0687 5.83162 42.3776 13.8619 5.30530 43.0630 13.6892 4.85617 43.7595 13.5444 4.44507 44.4673 13.4567 4.02366 45.1865 13.3321 3.58281 45.9174 13.2702 3.08053 46.6600 12.9741 2.51309 47.4147 12.6173 2.14018 48.1816 12.2824 1.81928 48.9609 11.9613 1.54490 49.7528 11.6417 1.28830 50.5576 11.3082 1.07234 51.3753 10.9768 0.896454 52.2062 10.6439 0.757394 53.0506 10.3154 0.680178 53.9087 10.0364 0.632986 54.7806 9.78031 0.595014 55.6667 9.52988 0.567394 56.5670 9.30251 0.563239 57.4820 9.08725 0.559115 58.4117 8.88646 0.580718 59.3564 8.70392 0.603395 60.3165 8.53101 0.632560 61.2921 8.36576 0.665632 62.2834 8.21156 0.717531 63.2908 8.07110 0.775782 64.3145 7.95287 0.845525 65.3547 7.85046 0.900273 66.4118 7.75086 0.956547 67.4859 7.65588 1.01634 68.5775 7.56768 1.08251 69.6867 7.49048 1.15442 70.8138 7.42753 1.22789 71.9591 7.37201 1.30013 73.1230 7.32952 1.37551 74.3057 7.29481 1.44167 75.5076 7.26818 1.51100 76.7289 7.25548 1.57080 77.9699 7.23965 1.62391 79.2310 7.22539 1.67882 80.5125 7.21927 1.73393 81.8147 7.21605 1.78266 83.1380 7.21683 1.83276 84.4827 7.22962 1.87923 85.8491 7.23996 1.91557 87.2377 7.24975 1.95261 88.6487 7.26385 1.99038 90.0825 7.28835 2.02887 91.5395 7.32647 2.04612 93.0201 7.34617 2.04724 94.5246 7.35113 2.05287 96.0535 7.35863 2.06874 97.6071 7.36896 2.08473 99.1858 7.38203 2.10085 100.790 7.40104 2.11708 102.420 7.42005 2.11875 104.077 7.43219 2.11934 105.760 7.44000 2.12303 107.471 7.44795 2.12778 109.209 7.45588 2.13254 110.975 7.46350 2.13731 112.770 7.47092 2.14210 114.594 7.47826 2.14689 116.448 7.48564 2.15169 118.331 7.49328 2.15651 120.245 7.50143 2.16134 122.190 7.51077 2.16617 124.166 7.52417 2.17102 126.175 7.53841 2.16638 128.215 7.54694 2.15912 130.289 7.55225 2.15189 132.397 7.55533 2.14468 134.538 7.55656 2.13750 136.714 7.55614 2.13034 138.925 7.55417 2.12321 141.172 7.55074 2.11610 143.456 7.54589 2.10901 145.776 7.53966 2.10195 148.134 7.53209 2.09491 150.530 7.52324 2.08789 152.964 7.51323 2.08090 155.439 7.50233 2.07393 157.953 7.49164 2.06698 160.507 7.48139 2.05512 163.103 7.46576 2.04042 165.742 7.44542 2.02582 168.422 7.42167 2.01133 171.146 7.39460 1.99694 173.915 7.36422 1.98265 176.727 7.33048 1.96847 179.586 7.29328 1.95439 182.491 7.25250 1.94040 185.442 7.20801 1.92652 188.442 7.15973 1.91274 191.489 7.10773 1.89906 194.587 7.05416 1.88350 197.734 6.99268 1.86442 200.932 6.92322 1.84554 204.182 6.84662 1.82685 207.485 6.76249 1.80835 210.840 6.67029 1.79004 214.251 6.56932 1.77191 217.716 6.45876 1.75396 221.237 6.33761 1.73620 224.816 6.20474 1.71862 228.452 6.05931 1.70121 232.147 5.89900 1.68210 235.902 5.71985 1.66224 239.717 5.51965 1.64263 243.595 5.29526 1.62324 247.535 5.04239 1.60408 251.538 4.75543 1.58514 255.607 4.42684 1.56643 259.741 4.04630 1.54794 263.942 3.59913 1.52967 268.211 3.06355 1.51162 272.549 2.40521 1.49378 276.957 1.56542 1.47615 281.437 0.431087 1.45872 285.989 -1.26306 1.44151 290.615 -4.44727 1.42449 294.500 -20.3956 1.41056 294.700 -20.3757 15.1908 295.315 -11.6988 15.1664 300.092 -2.52151 14.9798 304.945 0.431010 14.7956 309.878 2.28661 14.6136 314.890 3.65714 14.4338 319.983 4.77056 14.2533 325.158 5.67861 14.0256 330.418 6.38330 13.8016 335.762 6.97894 13.6815 341.192 7.55127 13.5912 346.711 8.09103 13.5014 352.319 8.59859 13.4122 358.017 9.07834 13.3237 363.808 9.53481 13.2357 369.692 9.97229 13.1483 375.672 10.3950 13.0614 381.748 10.8073 12.9752 387.922 11.2153 12.8895 394.197 11.6332 12.8044 400.573 12.0738 12.6680 407.052 12.4681 12.4871 413.635 12.8177 12.3088 420.326 13.1462 12.1331 427.124 13.4581 11.9598 434.032 13.7573 11.7891 441.052 14.0477 11.6208 448.186 14.3341 11.4549 455.435 14.6450 11.2717 462.802 14.9211 11.0479 470.287 15.1597 10.8286 477.894 15.3801 10.6137 485.623 15.5850 10.4030 493.478 15.7769 10.1965 501.459 15.9574 9.99408 509.570 16.1280 9.79571 517.812 16.2904 9.60126 526.187 16.4479 9.41067 534.698 16.5981 9.21457 543.346 16.7364 9.01953 552.134 16.8636 8.82863 561.065 16.9827 8.64175 570.139 17.0945 8.45884 579.361 17.1996 8.27979 588.732 17.2986 8.10455 598.254 17.3921 7.93301 607.930 17.4804 7.76509 617.763 17.5642 7.60074 627.755 17.6437 7.43986 637.908 17.7194 7.28238 648.226 17.7918 7.12825 658.711 17.8615 6.97737 669.365 17.9291 6.82968 680.191 17.9954 6.68513 691.193 18.0704 6.54362 702.372 18.1410 6.38391 713.733 18.1966 6.22354 725.277 18.2431 6.06719 737.008 18.2830 5.91477 748.928 18.3173 5.76619 761.042 18.3467 5.62133 773.351 18.3715 5.48011 785.859 18.3921 5.34244 798.570 18.4085 5.20823 811.486 18.4208 5.07739 824.611 18.4287 4.94984 837.949 18.4316 4.82549 851.502 18.4291 4.70427 865.274 18.4042 4.59328 879.269 18.3888 4.51185 893.491 18.3893 4.43187 907.943 18.3943 4.35330 922.628 18.4029 4.27613 937.551 18.4148 4.20032 952.715 18.4300 4.12586 968.124 18.4482 4.05272 983.783 18.4883 3.97264 999.695 18.5140 3.87209 1015.86 18.5248 3.77870 1032.29 18.5338 3.68757 1048.99 18.5404 3.59863 1065.96 18.5450 3.51184 1083.20 18.5478 3.42714 1100.72 18.5491 3.34449 1118.52 18.5492 3.26383 1136.61 18.5481 3.18511 1155. 18.5462 3.10829 1173.68 18.5434 3.03333 1192.66 18.5401 2.96017 1211.95 18.5365 2.88878 1231.55 18.5339 2.81779 1251.47 18.5294 2.74598 1271.72 18.5225 2.67600 1292.29 18.5143 2.60781 1313.19 18.5050 2.54135 1334.43 18.4949 2.47659 1356.01 18.4840 2.41347 1377.94 18.4724 2.35197 1400.23 18.4602 2.29203 1422.88 18.4473 2.23362 1445.89 18.4340 2.17669 1469.28 18.4201 2.12122 1493.04 18.4059 2.06717 1517.19 18.3912 2.01449 1541.73 18.3761 1.96315 1566.67 18.3607 1.91312 1592.01 18.3450 1.86437 1617.76 18.3291 1.81685 1643.92 18.3130 1.77055 1670.51 18.2970 1.72543 1697.53 18.2816 1.68055 1724.99 18.2652 1.63522 1752.89 18.2472 1.59110 1781.24 18.2285 1.54818 1810.05 18.2091 1.50641 1839.32 18.1892 1.46577 1869.07 18.1687 1.42623 1899.30 18.1476 1.38775 1930.02 18.1260 1.35032 1961.24 18.1039 1.31389 1992.96 18.0813 1.27844 2025.20 18.0581 1.24395 2057.95 18.0344 1.21039 2091.24 18.0101 1.17774 2125.06 17.9852 1.14597 2159.43 17.9596 1.11505 2194.36 17.9335 1.08497 2229.85 17.9066 1.05570 2265.92 17.8791 1.02722 2302.57 17.8510 0.999227 2339.81 17.8216 0.971618 2377.66 17.7910 0.944773 2416.11 17.7592 0.918669 2455.19 17.7260 0.893287 2494.90 17.6915 0.868606 2535.26 17.6553 0.844607 2576.26 17.6175 0.821271 2617.93 17.5778 0.798579 2660.27 17.5359 0.776515 2703.30 17.4916 0.755060 2747.03 17.4445 0.734198 2791.46 17.3944 0.713912 2836.61 17.3406 0.694188 2882.49 17.2827 0.675007 2929.11 17.2199 0.656357 2976.48 17.1511 0.638223 3024.63 17.0755 0.621143 3073.55 16.9919 0.604654 3123.26 16.8983 0.588601 3173.78 16.7918 0.572976 3225.11 16.6688 0.557765 3277.27 16.5236 0.542959 3330.28 16.3475 0.528544 3384.15 16.1255 0.514513 3438.88 15.8296 0.500854 3494.50 15.3954 0.487557 3551.02 14.6156 0.474616 3608.30 6.76821 0.462049 3608.50 6.76945 4.40540 3666.82 14.8853 4.28666 3726.13 15.8359 4.17104 3786.40 16.4059 4.05853 3847.64 16.8151 3.94907 3909.87 17.1335 3.84255 3973.11 17.3929 3.73891 4037.38 17.6105 3.63805 4102.68 17.7967 3.53994 4169.03 17.9585 3.44445 4236.46 18.1006 3.35155 4304.98 18.2265 3.26115 4374.62 18.3388 3.17319 4445.37 18.4395 3.08760 4517.27 18.5302 3.00431 4590.33 18.6121 2.92328 4664.58 18.6865 2.84443 4740.03 18.7541 2.76771 4816.69 18.8156 2.69306 4894.60 18.8717 2.62042 4973.77 18.9230 2.54974 5054.21 18.9699 2.48097 5135.96 19.0128 2.41405 5219.03 19.0521 2.34893 5303.44 19.0881 2.28558 5389.22 19.1212 2.22393 5476.39 19.1516 2.16370 5564.97 19.1793 2.10490 5654.98 19.2046 2.04770 5746.44 19.2275 1.99206 5839.39 19.2485 1.93793 5933.83 19.2675 1.88526 6029.81 19.2848 1.83403 6127.33 19.3006 1.78419 6226.44 19.3148 1.73571 6327.15 19.3277 1.68854 6429.48 19.3393 1.64266 6533.48 19.3498 1.59802 6639.15 19.3593 1.55459 6746.54 19.3677 1.51235 6855.65 19.3753 1.47125 6966.54 19.3821 1.43127 7079.22 19.3881 1.39237 7193.72 19.3936 1.35453 7310.07 19.3987 1.31772 7428.31 19.4041 1.28192 7548.45 19.4094 1.24556 7670.54 19.4131 1.20849 7794.61 19.4150 1.17252 7920.68 19.4159 1.13763 8048.79 19.4158 1.10377 8178.98 19.4151 1.07092 8311.26 19.4136 1.03905 8445.69 19.4115 1.00813 8582.29 19.4087 0.978123 8721.11 19.4052 0.949014 8862.16 19.4010 0.921145 9005.50 19.3966 0.894684 9151.16 19.3921 0.868973 9299.17 19.3872 0.843999 9449.58 19.3818 0.819666 9602.42 19.3746 0.796023 9757.73 19.3633 0.773049 9915.55 19.3598 0.768755 10075.9 19.3678 0.746466 10238.9 19.3646 0.724791 10404.5 19.3619 0.703714 10572.8 19.3588 0.683220 10743.8 19.3553 0.663294 10917.6 19.3515 0.643921 11094.2 19.3475 0.625088 11273.6 19.3432 0.606779 11455.9 19.3389 0.588981 11641.2 19.3344 0.571681 11829.5 19.3298 0.554865 12020.8 19.3251 0.538520 12215.3 19.3203 0.522634 12412.8 19.3154 0.507196 12613.6 19.3106 0.492191 12817.6 19.3056 0.477610 13025.0 19.3007 0.463440 13235.6 19.2957 0.449671 13449.7 19.2907 0.436292 13667.2 19.2857 0.423291 13888.3 19.2807 0.410659 14112.9 19.2756 0.398386 14341.2 19.2706 0.386461 14573.1 19.2657 0.374876 14808.9 19.2607 0.363621 15048.4 19.2557 0.352686 15291.8 19.2508 0.342063 15539.1 19.2459 0.331743 15790.4 19.2411 0.321718 16045.8 19.2362 0.311980 16305.4 19.2314 0.302520 16569.1 19.2267 0.293331 16837.1 19.2220 0.284406 17109.4 19.2173 0.275736 17386.1 19.2127 0.267315 17667.4 19.2081 0.259135 17953.1 19.2036 0.251191 18243.5 19.1991 0.243474 18538.6 19.1947 0.235980 18838.4 19.1903 0.228701 19143.1 19.1860 0.221631 19452.7 19.1817 0.214765 19767.4 19.1775 0.208096 20087.1 19.1733 0.201622 20412.0 19.1692 0.195337 20742.1 19.1652 0.189239 21077.6 19.1611 0.183324 21418.5 19.1572 0.177585 21765.0 19.1533 0.172019 22117.0 19.1494 0.166620 22474.7 19.1457 0.161384 22838.2 19.1419 0.156305 23207.6 19.1382 0.151379 23583.0 19.1346 0.146603 23964.4 19.1311 0.141971 24352.0 19.1276 0.137480 24745.9 19.1241 0.133125 25146.2 19.1208 0.128903 25552.9 19.1174 0.124809 25966.2 19.1142 0.120840 26386.1 19.1109 0.116993 26812.9 19.1078 0.113263 27246.6 19.1047 0.109648 27687.3 19.1017 0.106144 28135.1 19.0987 0.102747 28590.2 19.0957 0.994554E-01 29052.6 19.0929 0.962650E-01 29522.5 19.0900 0.931731E-01 30000.0 19.0873 0.901768E-01 periodictable-1.5.0/periodictable/xsf/kr.nff000066400000000000000000000320211310514471200210340ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.199153E-14 10.1617 -9999. 0.202374E-14 10.3261 -9999. 0.205647E-14 10.4931 -9999. 0.208974E-14 10.6628 -9999. 0.212354E-14 10.8353 -9999. 0.215788E-14 11.0106 -9999. 0.219278E-14 11.1886 -9999. 0.222825E-14 11.3696 -9999. 0.226429E-14 11.5535 -9999. 0.230091E-14 11.7404 -9999. 0.233813E-14 11.9303 -9999. 0.237595E-14 12.1232 -9999. 0.241438E-14 12.3193 -9999. 0.245343E-14 12.5186 -9999. 0.249311E-14 12.7210 -9999. 0.253343E-14 12.9268 -9999. 0.257441E-14 13.1359 -9999. 0.261605E-14 13.3483 -9999. 0.265836E-14 13.5642 -9999. 0.270136E-14 13.7836 -9999. 0.274505E-14 14.0000 -9999. 0.278814E-14 14.2000 -9999. 6.40385 14.2331 -9999. 6.46967 14.4633 -9999. 6.94182 14.6973 -9999. 7.44844 14.9350 -9999. 7.89396 15.1765 -9999. 8.34952 15.4220 -9999. 8.79845 15.6714 -9999. 9.10398 15.9249 -9999. 9.42012 16.1825 -9999. 9.74725 16.4442 -9999. 10.0254 16.7102 -9999. 10.2012 16.9805 -9999. 10.3801 17.2551 -9999. 10.5621 17.5342 -9999. 10.6206 17.8178 -9999. 10.6327 18.1060 -9999. 10.6448 18.3989 -9999. 10.6624 18.6964 -9999. 10.7073 18.9988 -9999. 10.7525 19.3061 -9999. 10.7979 19.6184 -9999. 10.8398 19.9357 -9999. 10.8691 20.2582 -9999. 10.8984 20.5858 -9999. 10.9277 20.9188 -9999. 10.9496 21.2571 -9999. 10.9467 21.6009 -9999. 10.9439 21.9503 -9999. 10.9410 22.3053 -9999. 10.9382 22.6661 -9999. 10.9049 23.0327 -9999. 10.8149 23.4053 -9999. 10.7257 23.7838 -9999. 10.6372 24.1685 -9999. 10.5420 24.5594 -9999. 10.3024 24.9566 -9999. 10.0683 25.3603 -9999. 9.83943 25.7705 -9999. 9.61581 26.1873 -9999. 9.39726 26.6109 -9999. 9.18368 27.0413 -9999. 8.97496 27.4786 -9999. 8.76542 27.9231 -9999. 8.53924 28.3747 -9999. 8.31891 28.8337 -9999. 8.10425 29.3000 10.8394 7.78196 29.7739 11.0262 7.41784 30.2555 11.1588 7.07074 30.7449 11.2578 6.73990 31.2421 11.3317 6.42453 31.7475 11.3863 6.12392 32.2609 11.4255 5.83737 32.7827 11.4529 5.56424 33.3130 11.4714 5.30389 33.8518 11.4885 5.05571 34.3993 11.5152 4.81209 34.9557 11.5210 4.53378 35.5211 11.4951 4.27156 36.0956 11.4528 4.02451 36.6794 11.3986 3.79174 37.2727 11.3354 3.57244 37.8755 11.2649 3.36583 38.4882 11.1887 3.17116 39.1107 11.1078 2.98775 39.7432 11.0234 2.81495 40.3861 10.9362 2.65214 41.0393 10.8474 2.49875 41.7031 10.7597 2.35423 42.3776 10.6689 2.20946 43.0630 10.5721 2.07338 43.7595 10.4721 1.94569 44.4673 10.3700 1.82585 45.1865 10.2662 1.71340 45.9174 10.1611 1.60787 46.6600 10.0550 1.50884 47.4147 9.94785 1.41592 48.1816 9.83975 1.32871 48.9609 9.73071 1.24688 49.7528 9.61786 1.17008 50.5576 9.50454 1.10368 51.3753 9.39488 1.04268 52.2062 9.28617 0.985056 53.0506 9.17754 0.930615 53.9087 9.06830 0.879182 54.7806 8.95776 0.830593 55.6667 8.84475 0.784687 56.5670 8.72502 0.744512 57.4820 8.60680 0.717395 58.4117 8.49511 0.691267 59.3564 8.38327 0.666091 60.3165 8.26621 0.641831 61.2921 8.14684 0.626536 62.2834 8.03206 0.617524 63.2908 7.91946 0.608641 64.3145 7.80632 0.599885 65.3547 7.69072 0.591540 66.4118 7.57325 0.586506 67.4859 7.45430 0.581515 68.5775 7.32952 0.576566 69.6867 7.20083 0.576809 70.8138 7.07047 0.577702 71.9591 6.93454 0.578596 73.1230 6.79191 0.581373 74.3057 6.64226 0.585022 75.5076 6.48352 0.588694 76.7289 6.31207 0.592390 77.9699 6.12486 0.599113 79.2310 5.92098 0.608538 80.5125 5.69417 0.618111 81.8147 5.43659 0.631125 83.1380 5.13991 0.647678 84.4827 4.78512 0.664665 85.8491 4.33656 0.682097 87.2377 3.72833 0.700901 88.6487 2.70469 0.726307 90.0825 0.289705 0.921521 91.5395 -0.957579 5.96658 93.0201 1.05818 10.5187 93.7000 8.54865 13.6057 93.9000 9.28653 7.23264 94.5246 7.55698 6.71549 96.0535 7.64770 5.61185 97.6071 7.79766 4.68955 99.1858 7.86211 3.91886 100.790 7.45947 2.90898 102.420 6.79340 2.62988 104.077 6.39007 2.37755 105.760 5.82447 2.14943 107.471 5.21766 2.29029 109.209 4.77435 2.50720 110.975 4.41724 2.74464 112.770 4.10060 3.00458 114.594 3.81458 3.28914 116.448 3.55724 3.60064 118.331 3.33856 3.94164 120.245 3.15294 4.28982 122.190 2.98237 4.65401 124.166 2.83666 5.04912 126.175 2.76626 5.47778 128.215 2.73919 5.85185 130.289 2.69105 6.21786 132.397 2.65291 6.60676 134.538 2.63849 7.01999 136.714 2.67067 7.45906 138.925 2.78840 7.87309 141.172 2.90982 8.19678 143.456 2.98108 8.53379 145.776 3.06023 8.88464 148.134 3.15101 9.24992 150.530 3.26068 9.63023 152.964 3.43776 10.0262 155.439 3.64212 10.3457 157.953 3.80711 10.6549 160.507 3.97342 10.9734 163.103 4.14864 11.3014 165.742 4.33952 11.6392 168.422 4.59171 11.9871 171.146 4.86869 12.2584 173.915 5.10268 12.5063 176.727 5.32626 12.7593 179.586 5.54767 13.0173 182.491 5.77214 13.2806 185.442 6.00366 13.5491 188.442 6.24921 13.8231 191.489 6.51217 14.0862 194.587 6.77744 14.3388 197.734 7.04232 14.5959 200.932 7.31834 14.8577 204.182 7.61031 15.1241 207.485 7.93279 15.3953 210.840 8.28447 15.6229 214.251 8.62423 15.8259 217.716 8.95157 16.0315 221.237 9.28463 16.2397 224.816 9.62716 16.4507 228.452 9.98370 16.6644 232.147 10.3767 16.8809 235.902 10.7988 17.0634 239.717 11.2124 17.2027 243.595 11.6170 17.3431 247.535 12.0297 17.4848 251.538 12.4590 17.6275 255.607 12.9563 17.7714 259.741 13.5018 17.8289 263.942 13.9959 17.7655 268.211 14.4236 17.7023 272.549 14.8207 17.6394 276.957 15.1968 17.5766 281.437 15.5569 17.5141 285.989 15.9042 17.4518 290.615 16.2410 17.3898 295.315 16.5689 17.3279 300.092 16.8893 17.2663 304.945 17.2032 17.2049 309.878 17.5117 17.1437 314.890 17.8155 17.0827 319.983 18.1153 17.0220 325.158 18.4120 16.9614 330.418 18.7061 16.9011 335.762 18.9984 16.8410 341.192 19.2895 16.7811 346.711 19.5802 16.7214 352.319 19.8713 16.6619 358.017 20.1638 16.6027 363.808 20.4589 16.5436 369.692 20.7582 16.4848 375.672 21.0638 16.4261 381.748 21.3793 16.3677 387.922 21.7112 16.3095 394.197 22.0815 16.2515 400.573 22.4950 16.1096 407.052 22.8621 15.8945 413.635 23.1645 15.6822 420.326 23.4456 15.4728 427.124 23.7081 15.2661 434.032 23.9559 15.0623 441.052 24.1912 14.8611 448.186 24.4158 14.6626 455.435 24.6312 14.4668 462.802 24.8384 14.2736 470.287 25.0385 14.0830 477.894 25.2324 13.8949 485.623 25.4208 13.7093 493.478 25.6048 13.5263 501.459 25.7853 13.3456 509.570 25.9639 13.1674 517.812 26.1428 12.9916 526.187 26.3280 12.8180 534.698 26.5275 12.6261 543.346 26.7112 12.4012 552.134 26.8628 12.1802 561.065 27.0027 11.9632 570.139 27.1319 11.7500 579.361 27.2521 11.5407 588.732 27.3644 11.3351 598.254 27.4695 11.1331 607.930 27.5681 10.9348 617.763 27.6606 10.7399 627.755 27.7476 10.5486 637.908 27.8292 10.3606 648.226 27.9059 10.1760 658.711 27.9778 9.99473 669.365 28.0448 9.81665 680.191 28.1059 9.64174 691.193 28.1626 9.47575 702.372 28.2198 9.31367 713.733 28.2760 9.15437 725.277 28.3308 8.99778 737.008 28.3845 8.84388 748.928 28.4379 8.69260 761.042 28.4920 8.54392 773.351 28.5508 8.39778 785.859 28.6142 8.23913 798.570 28.6680 8.07410 811.486 28.7136 7.91237 824.611 28.7575 7.75389 837.949 28.8231 7.59857 851.502 28.8857 7.38934 865.274 28.8974 7.18259 879.269 28.8929 6.98164 893.491 28.8580 6.78630 907.943 28.8088 6.62975 922.628 28.7774 6.48274 937.551 28.7441 6.33898 952.715 28.7084 6.19842 968.124 28.6686 6.06097 983.783 28.6237 5.92976 999.695 28.5774 5.80528 1015.86 28.5313 5.68331 1032.29 28.4827 5.56282 1048.99 28.4308 5.44350 1065.96 28.3741 5.32525 1083.20 28.3117 5.20963 1100.72 28.2444 5.09652 1118.52 28.1719 4.98588 1136.61 28.0937 4.87750 1155. 28.0094 4.77150 1173.68 27.9187 4.66785 1192.66 27.8211 4.56656 1211.95 27.7161 4.46740 1231.55 27.6032 4.37029 1251.47 27.4815 4.27450 1271.72 27.3493 4.17976 1292.29 27.2048 4.08583 1313.19 27.0460 3.99420 1334.43 26.8719 3.90460 1356.01 26.6802 3.81693 1377.94 26.4683 3.73116 1400.23 26.2325 3.64734 1422.88 25.9685 3.56549 1445.89 25.6705 3.48534 1469.28 25.3302 3.40650 1493.04 24.9372 3.32874 1517.19 24.4731 3.24928 1541.73 23.9095 3.17129 1566.67 23.2068 3.09524 1592.01 22.2886 3.02097 1617.76 20.9931 2.94847 1643.92 18.8648 2.87773 1670.51 13.0823 2.80869 1678.30 -4.63584 2.78898 1678.50 -4.62919 15.6136 1697.53 17.0270 15.3883 1724.99 20.8321 15.0732 1752.89 22.8532 14.7646 1781.24 24.2250 14.4623 1810.05 25.2396 14.1664 1839.32 26.0064 13.8762 1869.07 26.5511 13.5920 1899.30 26.7802 13.3139 1920.90 24.2882 13.1213 1921.10 24.2985 14.9155 1930.02 26.9138 14.8244 1961.24 28.3254 14.5131 1992.96 29.1554 14.2083 2025.20 29.8180 13.9160 2057.95 30.3918 13.6174 2091.24 30.8934 13.3218 2125.06 31.3415 13.0295 2159.43 31.7464 12.7411 2194.36 32.1150 12.4559 2229.85 32.4520 12.1748 2265.92 32.7615 11.8976 2302.57 33.0465 11.6247 2339.81 33.3097 11.3558 2377.66 33.5529 11.0912 2416.11 33.7781 10.8307 2455.19 33.9866 10.5747 2494.90 34.1801 10.3230 2535.26 34.3593 10.0756 2576.26 34.5255 9.83282 2617.93 34.6797 9.59460 2660.27 34.8230 9.36072 2703.30 34.9555 9.13092 2747.03 35.0780 8.90593 2791.46 35.1916 8.68546 2836.61 35.2968 8.46952 2882.49 35.3941 8.25728 2929.11 35.4833 8.04995 2976.48 35.5657 7.84690 3024.63 35.6416 7.64801 3073.55 35.7112 7.45348 3123.26 35.7749 7.26281 3173.78 35.8329 7.07654 3225.11 35.8856 6.89435 3277.27 35.9335 6.71681 3330.28 35.9771 6.54248 3384.15 36.0161 6.37239 3438.88 36.0511 6.20619 3494.50 36.0822 6.04386 3551.02 36.1096 5.88526 3608.46 36.1336 5.73038 3666.82 36.1544 5.57916 3726.13 36.1722 5.43160 3786.40 36.1871 5.28752 3847.64 36.1993 5.14690 3909.87 36.2090 5.00974 3973.11 36.2163 4.87588 4037.38 36.2214 4.74538 4102.68 36.2243 4.61805 4169.03 36.2253 4.49384 4236.46 36.2244 4.37277 4304.98 36.2218 4.25480 4374.62 36.2175 4.13972 4445.37 36.2117 4.02756 4517.27 36.2045 3.91828 4590.33 36.1959 3.81176 4664.58 36.1860 3.70796 4740.03 36.1750 3.60688 4816.69 36.1628 3.50840 4894.60 36.1496 3.41247 4973.77 36.1355 3.31899 5054.21 36.1204 3.22800 5135.96 36.1046 3.13937 5219.03 36.0878 3.05306 5303.44 36.0704 2.96911 5389.22 36.0523 2.88729 5476.39 36.0335 2.80768 5564.97 36.0142 2.73020 5654.98 35.9943 2.65474 5746.44 35.9739 2.58136 5839.39 35.9530 2.50992 5933.83 35.9317 2.44042 6029.81 35.9099 2.37272 6127.33 35.8877 2.30688 6226.44 35.8652 2.24288 6327.15 35.8423 2.18063 6429.48 35.8191 2.12003 6533.48 35.7956 2.06099 6639.15 35.7717 2.00370 6746.54 35.7476 1.94791 6855.65 35.7232 1.89369 6966.54 35.6986 1.84086 7079.22 35.6737 1.78961 7193.72 35.6485 1.73966 7310.07 35.6230 1.69116 7428.31 35.5973 1.64394 7548.45 35.5713 1.59812 7670.54 35.5451 1.55357 7794.61 35.5186 1.51016 7920.68 35.4917 1.46798 8048.79 35.4646 1.42699 8178.98 35.4371 1.38714 8311.26 35.4093 1.34841 8445.69 35.3810 1.31076 8582.29 35.3524 1.27415 8721.11 35.3233 1.23858 8862.16 35.2938 1.20400 9005.50 35.2636 1.17038 9151.16 35.2329 1.13772 9299.17 35.2015 1.10596 9449.58 35.1694 1.07511 9602.42 35.1365 1.04512 9757.73 35.1027 1.01597 9915.55 35.0679 0.987623 10075.9 35.0319 0.960095 10238.9 34.9947 0.933343 10404.5 34.9560 0.907347 10572.8 34.9157 0.882083 10743.8 34.8735 0.857534 10917.6 34.8292 0.833678 11094.2 34.7824 0.810496 11273.6 34.7329 0.787970 11455.9 34.6800 0.766083 11641.2 34.6231 0.744814 11829.5 34.5617 0.724147 12020.8 34.4947 0.704066 12215.3 34.4209 0.684553 12412.8 34.3387 0.665594 12613.6 34.2459 0.647172 12817.6 34.1393 0.629272 13025.0 34.0141 0.611880 13235.6 33.8631 0.594980 13449.7 33.6737 0.578561 13667.2 33.4217 0.562606 13888.3 33.0515 0.547104 14112.9 32.3765 0.532041 14325.5 24.6680 0.518379 14325.7 24.6682 3.71186 14341.2 29.8148 3.70575 14573.1 32.7062 3.61611 14808.9 33.4370 3.52804 15048.4 33.8836 3.44154 15291.8 34.2071 3.35662 15539.1 34.4605 3.27328 15790.4 34.6679 3.19153 16045.8 34.8428 3.11136 16305.4 34.9931 3.03277 16569.1 35.1241 2.95576 16837.1 35.2397 2.88030 17109.4 35.3423 2.80641 17386.1 35.4342 2.73407 17667.4 35.5168 2.66326 17953.1 35.5913 2.59397 18243.5 35.6589 2.52618 18538.6 35.7202 2.45989 18838.4 35.7759 2.39507 19143.1 35.8268 2.33171 19452.7 35.8731 2.26978 19767.4 35.9154 2.20927 20087.1 35.9541 2.15016 20412.0 35.9894 2.09242 20742.1 36.0216 2.03604 21077.6 36.0510 1.98100 21418.5 36.0779 1.92727 21765.0 36.1023 1.87484 22117.0 36.1246 1.82367 22474.7 36.1448 1.77375 22838.2 36.1632 1.72506 23207.6 36.1798 1.67757 23583.0 36.1947 1.63126 23964.4 36.2082 1.58611 24352.0 36.2203 1.54209 24745.9 36.2311 1.49919 25146.2 36.2406 1.45737 25552.9 36.2491 1.41663 25966.2 36.2565 1.37693 26386.1 36.2629 1.33825 26812.9 36.2684 1.30058 27246.6 36.2730 1.26388 27687.3 36.2769 1.22815 28135.1 36.2801 1.19335 28590.2 36.2826 1.15948 29052.6 36.2846 1.12649 29522.5 36.2891 1.09439 30000.0 36.2768 1.06314 periodictable-1.5.0/periodictable/xsf/la.nff000066400000000000000000000440771310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.31251 10.1152 -9999. 3.28769 10.2317 -9999. 3.26306 10.3496 -9999. 3.23861 10.4688 -9999. 3.20975 10.5894 -9999. 3.15961 10.7114 -9999. 3.11024 10.8348 -9999. 3.06165 10.9596 -9999. 3.01382 11.0859 -9999. 2.96673 11.2136 -9999. 2.92038 11.3428 -9999. 2.87476 11.4734 -9999. 2.82984 11.6056 -9999. 2.78563 11.7393 -9999. 2.74211 11.8745 -9999. 2.69927 12.0113 -9999. 2.65710 12.1497 -9999. 2.61559 12.2897 -9999. 2.57473 12.4312 -9999. 2.53450 12.5744 -9999. 2.49468 12.7193 -9999. 2.45473 12.8658 -9999. 2.41543 13.0140 -9999. 2.37675 13.1640 -9999. 2.33870 13.3156 -9999. 2.30125 13.4690 -9999. 2.26440 13.6242 -9999. 2.22815 13.7811 -9999. 2.19247 13.9399 -9999. 2.15736 14.1005 -9999. 2.12423 14.2629 -9999. 2.09175 14.4272 -9999. 2.05976 14.5934 -9999. 2.02827 14.7615 -9999. 1.99726 14.9316 -9999. 1.96672 15.1036 -9999. 1.93866 15.2776 -9999. 1.91242 15.4536 -9999. 1.88655 15.6316 -9999. 1.86102 15.8117 -9999. 1.89160 15.9938 -9999. 1.93675 16.1781 -9999. 2.05735 16.3644 -9999. 2.46207 16.5529 -9999. 3.03749 16.7436 -9999. 3.71287 16.9365 -9999. 4.15148 17.1316 -9999. 4.64191 17.3290 -9999. 5.13971 17.5286 -9999. 5.64097 17.7305 -9999. 6.19112 17.9348 -9999. 6.65981 18.1414 -9999. 7.04893 18.3504 -9999. 7.42772 18.5618 -9999. 7.57896 18.7756 -9999. 7.73329 18.9919 -9999. 7.89076 19.2107 -1.79121 8.24573 19.4320 -1.82933 8.68806 19.6558 -1.78838 9.15412 19.8823 -1.69795 9.64519 20.1113 -1.49715 10.1626 20.3430 -1.23425 10.5908 20.5773 -0.976246 11.0202 20.8144 -0.616646 11.4670 21.0542 -0.130074 11.7186 21.2967 0.248020 11.7619 21.5421 0.431907 11.8053 21.7902 0.529037 11.8489 22.0412 0.279724 11.8926 22.2952 -0.506484E-01 12.4793 22.5520 -0.195470E-01 13.2697 22.8118 0.221580 14.1102 23.0746 0.800529 14.9259 23.3404 1.47325 15.3899 23.6093 2.01294 15.8683 23.8812 2.63332 16.3616 24.1564 3.42045 16.7957 24.4346 4.21534 16.9891 24.7161 4.88506 17.1849 25.0008 5.56798 17.3828 25.2889 6.27745 17.5831 25.5802 7.03911 17.7856 25.8749 7.90654 17.9905 26.1729 9.01263 18.1907 26.4744 10.1694 17.7873 26.7794 11.0831 17.3928 27.0879 12.0748 16.9264 27.4000 12.9204 16.0693 27.7156 13.3860 15.2556 28.0349 13.7129 14.4831 28.3579 13.8314 13.7682 28.6845 13.8898 13.3122 29.0150 14.0493 12.8713 29.3492 14.1877 12.4450 29.6873 14.3097 12.0329 30.0293 14.4124 11.6343 30.3753 14.4938 11.2490 30.7252 14.5494 10.8765 31.0791 14.5654 10.5330 31.4372 14.5784 10.2506 31.7993 14.6175 9.97590 32.1656 14.6541 9.70852 32.5362 14.6882 9.44831 32.9110 14.7188 9.19507 33.2901 14.7455 8.94862 33.6736 14.7683 8.70878 34.0616 14.7916 8.47487 34.4539 14.8092 8.23565 34.8508 14.8130 8.00317 35.2523 14.8095 7.77725 35.6584 14.7986 7.55772 36.0692 14.7798 7.34438 36.4847 14.7522 7.13706 36.9050 14.7103 6.93560 37.3302 14.6525 6.76188 37.7602 14.6043 6.61628 38.1952 14.5741 6.47380 38.6352 14.5479 6.33440 39.0803 14.5253 6.19801 39.5305 14.5057 6.06455 39.9859 14.4892 5.93396 40.4465 14.4763 5.80619 40.9124 14.4682 5.68116 41.3837 14.4662 5.55883 41.8605 14.4943 5.43913 42.3427 14.5347 5.27407 42.8305 14.5377 5.07588 43.3239 14.5136 4.88514 43.8230 14.4747 4.70156 44.3278 14.4253 4.52489 44.8385 14.3682 4.35485 45.3550 14.3070 4.19120 45.8775 14.2405 4.02526 46.4060 14.1639 3.86483 46.9406 14.0810 3.71079 47.4813 13.9939 3.56290 48.0283 13.9112 3.42090 48.5816 13.8285 3.26896 49.1413 13.7271 3.10442 49.7074 13.6068 2.94815 50.2800 13.4735 2.79976 50.8592 13.3284 2.65884 51.4451 13.1552 2.52500 52.0377 12.9707 2.43539 52.6372 12.8110 2.36619 53.2436 12.6598 2.29896 53.8570 12.5120 2.23364 54.4774 12.3646 2.17017 55.1050 12.2146 2.10851 55.7398 12.0575 2.04898 56.3819 11.8993 2.01241 57.0314 11.7508 1.97649 57.6884 11.6047 1.94122 58.3530 11.4587 1.90657 59.0252 11.3111 1.87255 59.7051 11.1604 1.83913 60.3929 10.9981 1.80750 61.0887 10.8343 1.79808 61.7924 10.6834 1.78871 62.5042 10.5331 1.77938 63.2243 10.3830 1.77011 63.9526 10.2321 1.76088 64.6893 10.0795 1.75170 65.4346 9.92440 1.74257 66.1884 9.76607 1.73422 66.9508 9.60479 1.72671 67.7221 9.44027 1.71923 68.5023 9.27146 1.71178 69.2914 9.09773 1.70437 70.0896 8.91835 1.69698 70.8971 8.73255 1.68963 71.7138 8.53933 1.68231 72.5399 8.33733 1.67503 73.3756 8.12352 1.66777 74.2209 7.89592 1.66951 75.0759 7.66401 1.68076 75.9407 7.42985 1.69209 76.8156 7.18720 1.70349 77.7005 6.93453 1.71497 78.5956 6.67007 1.72652 79.5010 6.38633 1.73815 80.4168 6.08740 1.76330 81.3432 5.78356 1.79171 82.2803 5.46623 1.82059 83.2282 5.13293 1.84993 84.1869 4.78079 1.87974 85.1568 4.40618 1.91003 86.1378 4.00182 1.94081 87.1301 3.56799 1.99241 88.1338 3.11724 2.04882 89.1491 2.63966 2.10681 90.1761 2.12830 2.16645 91.2149 1.57223 2.22778 92.2657 0.960925 2.29604 93.3286 0.301845 2.41223 94.4037 -0.387288 2.53429 95.4912 -1.11681 2.66253 96.5913 -1.91023 2.77172 97.7040 -2.80789 2.87768 98.8296 -3.82402 2.98769 99.9681 -5.01836 3.11949 101.120 -6.36189 3.37189 102.285 -7.82554 3.64471 103.463 -9.54043 3.93961 104.655 -11.5661 4.41751 105.860 -13.8850 4.99634 107.080 -16.6642 5.82789 108.313 -19.9460 6.89302 109.561 -24.2469 8.36599 110.753 -29.5441 10.7418 112.008 -37.0213 14.9287 113.298 -44.9382 25.0456 113.476 -45.7486 26.8825 114.487 -49.3629 37.8416 115.135 -49.9598 47.7560 115.862 -47.3043 58.5573 116.567 -42.1393 67.9072 117.910 -27.2761 82.6575 119.268 -8.50698 87.8669 120.642 8.02545 86.2709 122.032 21.2467 81.9631 123.438 31.6587 74.0773 124.860 37.3297 65.7944 126.298 40.1229 58.3796 127.753 41.7191 53.4598 129.225 43.2594 49.0215 130.713 44.3881 44.9516 132.219 45.1299 41.3467 133.742 45.7654 38.2488 135.283 46.4496 35.3830 136.841 47.0668 32.3397 138.418 47.3056 29.3206 140.012 47.2830 26.5832 141.625 47.0940 23.9028 143.257 46.5839 21.3590 144.907 45.8404 19.0860 146.576 44.9020 17.1250 148.265 43.9595 15.5672 149.973 43.1502 14.1511 151.701 42.3491 12.8638 153.448 41.5726 11.6937 155.216 40.8274 10.6223 157.004 40.0785 9.58051 158.813 39.2998 8.64088 160.642 38.5220 7.79340 162.493 37.7494 7.02905 164.365 36.9886 6.33966 166.258 36.2388 5.71788 168.173 35.4998 5.15709 170.111 34.7722 4.65817 172.070 34.0638 4.21324 174.053 33.3700 3.81083 176.058 32.6470 3.44684 178.086 31.9454 3.20681 180.137 31.3329 2.98988 182.213 30.7368 2.77210 184.312 30.1266 2.58213 186.435 29.5274 2.44450 188.583 28.9576 2.33343 190.755 28.3677 2.22801 192.953 27.7870 2.24956 195.175 27.2810 2.28810 197.424 26.7856 2.32731 199.698 26.3126 2.42909 201.999 25.9028 2.55385 204.326 25.5325 2.68501 206.679 25.1946 2.81820 209.060 24.8823 2.95552 211.469 24.6018 3.09954 213.905 24.3445 3.23215 216.369 24.0956 3.36604 218.862 23.8618 3.50549 221.383 23.6437 3.65071 223.933 23.4426 3.80196 226.513 23.2658 3.95946 229.122 23.1132 4.11094 231.762 22.9681 4.24174 234.432 22.8230 4.37670 237.132 22.6847 4.51595 239.864 22.5553 4.65964 242.627 22.4357 4.80789 245.422 22.3271 4.96086 248.249 22.2363 5.11870 251.109 22.1598 5.26950 254.002 22.0868 5.41446 256.928 22.0186 5.56342 259.888 21.9586 5.71647 262.882 21.9085 5.87373 265.910 21.8699 6.03532 268.973 21.8451 6.20136 272.072 21.8368 6.37195 275.206 21.8482 6.54725 278.377 21.9221 6.72736 281.583 22.0228 6.82763 284.827 22.0791 6.89093 288.108 22.1165 6.95482 291.427 22.1449 7.01930 294.785 22.1679 7.08438 298.181 22.1873 7.15007 301.616 22.2044 7.21636 305.090 22.2196 7.28327 308.605 22.2333 7.35079 312.160 22.2413 7.41936 315.756 22.2498 7.49943 319.393 22.2662 7.58037 323.073 22.2853 7.66217 326.794 22.3074 7.74487 330.559 22.3327 7.82845 334.367 22.3612 7.91294 338.219 22.3935 7.99835 342.115 22.4299 8.08466 346.056 22.4713 8.17192 350.043 22.5191 8.26011 354.075 22.5769 8.34926 358.154 22.6514 8.42743 362.280 22.7235 8.48174 366.454 22.7809 8.53638 370.675 22.8369 8.59139 374.945 22.8916 8.64675 379.265 22.9461 8.70247 383.634 23.0010 8.75854 388.053 23.0568 8.81498 392.523 23.1141 8.87178 397.045 23.1736 8.92895 401.619 23.2364 8.98648 406.246 23.3064 9.04439 410.926 23.3799 9.08769 415.660 23.4472 9.12966 420.448 23.5130 9.17182 425.291 23.5789 9.21418 430.191 23.6457 9.25674 435.147 23.7143 9.29949 440.159 23.7855 9.34243 445.230 23.8605 9.38558 450.359 23.9408 9.42892 455.547 24.0279 9.47246 460.795 24.1502 9.51621 466.103 24.2781 9.49897 471.473 24.3635 9.47657 476.904 24.4410 9.45422 482.398 24.5111 9.43193 487.955 24.5758 9.40968 493.576 24.6369 9.38750 499.262 24.6961 9.36537 505.014 24.7566 9.34328 510.831 24.8277 9.32125 516.716 24.8976 9.25677 522.669 24.9406 9.19158 528.690 24.9705 9.12685 534.780 24.9903 9.06256 540.941 25.0013 8.99873 547.172 25.0044 8.93535 553.476 25.0004 8.87242 559.852 24.9900 8.80993 566.301 24.9770 8.74788 572.825 24.9634 8.68209 579.424 24.9390 8.59276 586.099 24.8926 8.50436 592.851 24.8311 8.41686 599.680 24.7556 8.33026 606.589 24.6663 8.24456 613.576 24.5628 8.15973 620.645 24.4442 8.07578 627.795 24.3084 7.99269 635.027 24.1497 7.91461 642.342 23.9778 7.85428 649.742 23.8019 7.79441 657.227 23.6117 7.73499 664.798 23.4059 7.67602 672.456 23.1824 7.61751 680.203 22.9394 7.55945 688.039 22.6748 7.50182 695.965 22.3920 7.44463 703.982 22.0848 7.37633 712.092 21.7345 7.29066 720.296 21.3328 7.20598 728.593 20.8781 7.12228 736.987 20.3634 7.03956 745.477 19.7781 6.95779 754.064 19.1079 6.87698 762.751 18.3328 6.79710 771.538 17.4245 6.71815 780.426 16.3412 6.64012 789.416 15.0173 6.56300 798.510 13.3421 6.48677 807.709 11.1062 6.41143 817.014 7.83621 6.33696 826.426 2.02817 6.26336 835.900 -39.3660 6.19096 836.100 -39.3275 35.2147 845.576 3.47234 34.5503 855.317 10.3823 33.8879 865.170 14.4949 33.2382 875.137 17.4289 32.6010 885.219 19.6953 31.9760 895.416 21.5227 31.3629 905.731 23.0326 30.7616 916.165 24.2955 30.1718 926.719 25.3533 29.5934 937.395 26.2268 29.0260 948.194 26.9104 28.4695 959.117 27.3099 28.0024 970.166 27.6532 27.9119 981.342 28.1800 27.8217 992.647 28.6977 27.7317 1004.08 29.2096 27.6421 1015.65 29.7097 27.5528 1027.35 30.1943 27.4637 1039.18 30.6601 27.3749 1051.16 31.1008 27.2864 1059. 31.3559 27.2292 1067. 31.6145 27.2225 1079.29 32.0374 27.2124 1091.73 32.4701 27.2024 1104.30 32.9068 27.1924 1117.02 33.3461 27.1824 1129.89 33.7874 27.1725 1142.91 34.2311 27.1625 1156.07 34.6779 27.1526 1169.39 35.1290 27.1427 1182.86 35.5860 27.1327 1196.49 36.0512 27.1227 1210.27 36.5277 27.1127 1224.21 37.0320 27.1029 1238.32 37.5634 27.0698 1252.58 38.1160 26.9983 1267.01 38.6867 26.8895 1281.61 39.2229 26.6837 1296.37 39.7018 26.4795 1311.31 40.1532 26.2769 1326.41 40.5854 26.0758 1341.69 41.0028 25.8760 1357.15 41.4084 25.6778 1372.78 41.8048 25.4813 1388.60 42.1944 25.2864 1404.59 42.5793 25.0929 1420.77 42.9621 24.9008 1437.14 43.3464 24.7102 1453.70 43.7413 24.5211 1470.44 44.1487 24.3102 1487.38 44.5637 24.0871 1504.52 44.9886 23.8130 1521.85 45.3751 23.4888 1539.38 45.7069 23.1691 1557.12 46.0166 22.8540 1575.05 46.3070 22.5432 1593.20 46.5810 22.2363 1611.55 46.8405 21.9337 1630.12 47.0873 21.6352 1648.89 47.3226 21.3408 1667.89 47.5477 21.0504 1687.10 47.7633 20.7639 1706.54 47.9705 20.4815 1726.20 48.1734 20.2030 1746.08 48.3689 19.9216 1766.20 48.5534 19.6425 1786.55 48.7293 19.3656 1807.13 48.8959 19.0919 1827.94 49.0547 18.8222 1849. 49.2066 18.5564 1870.30 49.3519 18.2943 1891.85 49.4910 18.0357 1913.64 49.6242 17.7809 1935.69 49.7520 17.5298 1957.99 49.8747 17.2821 1980.54 49.9919 17.0377 2003.36 50.1032 16.7977 2026.44 50.2163 16.5666 2049.78 50.3283 16.3285 2073.39 50.4309 16.0927 2097.28 50.5288 15.8600 2121.44 50.6224 15.6302 2145.88 50.7118 15.4029 2170.60 50.7969 15.1781 2195.60 50.8778 14.9561 2220.90 50.9549 14.7368 2246.48 51.0287 14.5206 2272.36 51.0989 14.3060 2298.54 51.1652 14.0943 2325.02 51.2281 13.8853 2351.80 51.2878 13.6788 2378.89 51.3443 13.4748 2406.30 51.3976 13.2733 2434.02 51.4480 13.0743 2462.06 51.4952 12.8775 2490.42 51.5397 12.6837 2519.11 51.5817 12.4917 2548.13 51.6206 12.3019 2577.48 51.6568 12.1146 2607.18 51.6903 11.9292 2637.21 51.7209 11.7460 2667.59 51.7488 11.5655 2698.32 51.7743 11.3871 2729.41 51.7971 11.2107 2760.85 51.8176 11.0371 2792.65 51.8360 10.8654 2824.82 51.8521 10.6956 2857.36 51.8656 10.5275 2890.28 51.8765 10.3616 2923.58 51.8850 10.1981 2957.26 51.8914 10.0366 2991.32 51.8957 9.87704 3025.78 51.8977 9.71885 3060.64 51.8970 9.56306 3095.90 51.8941 9.40915 3131.56 51.8889 9.25711 3167.64 51.8815 9.10699 3204.13 51.8717 8.95871 3241.04 51.8597 8.81228 3278.38 51.8453 8.66765 3316.14 51.8286 8.52480 3354.35 51.8095 8.38357 3392.99 51.7879 8.24419 3432.07 51.7639 8.10652 3471.61 51.7373 7.97051 3511.60 51.7081 7.83621 3552.06 51.6764 7.70361 3592.98 51.6420 7.57264 3634.37 51.6048 7.44329 3676.24 51.5648 7.31550 3718.59 51.5219 7.18921 3761.42 51.4758 7.06457 3804.75 51.4265 6.94140 3848.58 51.3739 6.81980 3892.92 51.3179 6.69974 3937.77 51.2582 6.58115 3983.13 51.1946 6.46401 4029.01 51.1271 6.34831 4075.43 51.0552 6.23396 4122.38 50.9787 6.12106 4169.87 50.8973 6.00952 4217.90 50.8106 5.89943 4266.49 50.7183 5.79070 4315.64 50.6197 5.68325 4365.36 50.5146 5.57726 4415.65 50.4021 5.47243 4466.51 50.2816 5.36892 4517.97 50.1523 5.26669 4570.01 50.0130 5.16570 4622.66 49.8625 5.06597 4675.91 49.6995 4.96749 4729.78 49.5222 4.87027 4784.27 49.3284 4.77422 4839.38 49.1152 4.67933 4895.13 48.8792 4.58572 4951.52 48.6157 4.49306 5008.56 48.3183 4.40160 5066.26 47.9783 4.31124 5124.62 47.5827 4.22199 5183.66 47.1117 4.13387 5243.37 46.5317 4.04688 5303.78 45.7795 3.96095 5364.88 44.7103 3.87616 5426.68 42.8343 3.79218 5482.60 27.0888 3.71856 5482.80 27.0898 11.5446 5489.19 37.4945 11.5202 5552.43 43.3637 11.2831 5616.39 44.8324 11.0510 5681.09 45.5610 10.8237 5746.54 45.8678 10.6010 5812.74 45.7152 10.3830 5879.70 43.8244 10.1694 5890.50 38.2201 10.1356 5890.70 38.2218 13.9402 5947.43 46.2361 13.7091 6015.95 47.4804 13.4381 6085.25 48.1929 13.1723 6155.35 48.6023 12.9118 6226.26 48.5792 12.6563 6266.20 45.3502 12.5159 6266.40 45.3515 14.3556 6297.99 48.9300 14.2496 6370.54 50.0590 14.0110 6443.93 50.7579 13.7754 6518.16 51.3113 13.5425 6593.25 51.7812 13.3125 6669.20 52.1935 13.0852 6746.03 52.5619 12.8608 6823.74 52.8951 12.6394 6902.35 53.1990 12.4208 6981.87 53.4780 12.2053 7062.30 53.7354 11.9925 7143.66 53.9738 11.7827 7225.95 54.1952 11.5758 7309.19 54.4013 11.3715 7393.39 54.5934 11.1702 7478.56 54.7730 10.9719 7564.72 54.9410 10.7764 7651.86 55.0983 10.5838 7740.01 55.2458 10.3940 7829.18 55.3843 10.2070 7919.37 55.5142 10.0228 8010.60 55.6361 9.84142 8102.88 55.7508 9.66284 8196.22 55.8585 9.48685 8290.64 55.9595 9.31375 8386.15 56.0546 9.14331 8482.76 56.1438 8.97552 8580.48 56.2276 8.81044 8679.33 56.3063 8.64800 8779.31 56.3802 8.48801 8880.45 56.4494 8.33060 8982.75 56.5141 8.17581 9086.23 56.5747 8.02363 9190.90 56.6315 7.87400 9296.78 56.6846 7.72681 9403.88 56.7341 7.58198 9512.21 56.7802 7.43954 9621.79 56.8230 7.29968 9732.63 56.8630 7.16213 9844.75 56.9001 7.02685 9958.16 56.9343 6.89391 10072.9 56.9659 6.76325 10188.9 56.9951 6.63484 10306.3 57.0218 6.50865 10425.0 57.0463 6.38465 10545.1 57.0686 6.26282 10666.6 57.0888 6.14312 10789.5 57.1070 6.02553 10913.8 57.1234 5.91002 11039.5 57.1380 5.79656 11166.7 57.1509 5.68511 11295.3 57.1621 5.57566 11425.4 57.1718 5.46816 11557.0 57.1800 5.36260 11690.2 57.1868 5.25894 11824.9 57.1922 5.15716 11961.1 57.1964 5.05723 12098.9 57.1993 4.95911 12238.2 57.2010 4.86279 12379.2 57.2017 4.76823 12521.8 57.2012 4.67541 12666.1 57.1998 4.58430 12812.0 57.1974 4.49487 12959.6 57.1940 4.40709 13108.9 57.1898 4.32095 13259.9 57.1848 4.23640 13412.6 57.1789 4.15344 13567.2 57.1723 4.07202 13723.4 57.1650 3.99213 13881.5 57.1570 3.91374 14041.5 57.1483 3.83683 14203.2 57.1390 3.76136 14366.8 57.1292 3.68733 14532.3 57.1187 3.61469 14699.7 57.1077 3.54343 14869.1 57.0963 3.47353 15040.4 57.0843 3.40496 15213.6 57.0719 3.33770 15388.9 57.0590 3.27172 15566.2 57.0457 3.20700 15745.5 57.0320 3.14353 15926.9 57.0180 3.08128 16110.4 57.0036 3.02022 16296.0 56.9888 2.96034 16483.7 56.9738 2.90162 16673.6 56.9584 2.84404 16865.7 56.9428 2.78756 17059.9 56.9268 2.73219 17256.5 56.9106 2.67788 17455.3 56.8942 2.62464 17656.3 56.8775 2.57243 17859.8 56.8606 2.52124 18065.5 56.8434 2.47104 18273.6 56.8261 2.42183 18484.1 56.8085 2.37358 18697.1 56.7908 2.32628 18912.4 56.7728 2.27990 19130.3 56.7547 2.23444 19350.7 56.7364 2.18986 19573.6 56.7180 2.14617 19799.1 56.6994 2.10333 20027.2 56.6806 2.06134 20257.9 56.6616 2.02018 20491.3 56.6425 1.97983 20727.3 56.6233 1.94027 20966.1 56.6038 1.90150 21207.6 56.5842 1.86350 21451.9 56.5645 1.82625 21699.1 56.5446 1.78974 21949.0 56.5245 1.75395 22201.9 56.5043 1.71888 22457.6 56.4839 1.68450 22716.3 56.4633 1.65080 22978.0 56.4425 1.61778 23242.7 56.4215 1.58541 23510.5 56.4003 1.55369 23781.3 56.3789 1.52260 24055.3 56.3573 1.49213 24332.4 56.3354 1.46227 24612.7 56.3132 1.43300 24896.3 56.2908 1.40432 25183.1 56.2681 1.37622 25473.2 56.2451 1.34867 25766.6 56.2217 1.32168 26063.4 56.1979 1.29523 26363.7 56.1738 1.26930 26667.4 56.1492 1.24390 26974.6 56.1242 1.21900 27285.3 56.0987 1.19461 27599.7 56.0726 1.17070 27917.6 56.0459 1.14727 28239.2 56.0186 1.12432 28564.5 55.9906 1.10182 28893.6 55.9617 1.07978 29226.4 55.9321 1.05818 29563.1 55.9014 1.03701 29903.7 55.8697 1.01627 30000.0 55.8606 1.01052 periodictable-1.5.0/periodictable/xsf/li.nff000066400000000000000000000337231310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.116418 10.1617 -9999. 0.117427 10.3261 -9999. 0.118445 10.4931 -9999. 0.119472 10.6628 -9999. 0.120508 10.8353 -9999. 0.121552 11.0106 -9999. 0.122606 11.1886 -9999. 0.123668 11.3696 -9999. 0.124440 11.5535 -9999. 0.125017 11.7404 -9999. 0.125598 11.9303 -9999. 0.126181 12.1232 -9999. 0.126767 12.3193 -9999. 0.127356 12.5186 -9999. 0.127947 12.7210 -9999. 0.128541 12.9268 -9999. 0.129138 13.1359 -9999. 0.129738 13.3483 -9999. 0.130340 13.5642 -9999. 0.130945 13.7836 -9999. 0.131550 14.0066 -9999. 0.132137 14.2331 -9999. 0.132727 14.4633 -9999. 0.133319 14.6973 -9999. 0.133914 14.9350 -9999. 0.134512 15.1765 -9999. 0.135113 15.4220 -9999. 0.135716 15.6714 -9999. 0.136322 15.9249 -9999. 0.136930 16.1825 -9999. 0.137541 16.4442 -9999. 0.138155 16.7102 -9999. 0.138772 16.9805 -9999. 0.139071 17.2551 -9999. 0.138903 17.5342 -9999. 0.138735 17.8178 -9999. 0.138567 18.1060 -9999. 0.138399 18.3989 -9999. 0.138232 18.6964 -9999. 0.138065 18.9988 -9999. 0.137898 19.3061 -9999. 0.137709 19.6184 -9999. 0.137514 19.9357 -9999. 0.137318 20.2582 -9999. 0.137123 20.5858 -9999. 0.136928 20.9188 -9999. 0.136733 21.2571 -9999. 0.136539 21.6009 -9999. 0.136345 21.9503 -9999. 0.136151 22.3053 -9999. 0.135586 22.6661 -9999. 0.134963 23.0327 -9999. 0.134343 23.4053 -9999. 0.133726 23.7838 -9999. 0.133111 24.1685 -9999. 0.132500 24.5594 -9999. 0.131891 24.9566 -9999. 0.131285 25.3603 -9999. 0.130681 25.7705 -9999. 0.130081 26.1873 -9999. 0.129483 26.6109 -9999. 0.128888 27.0413 -9999. 0.127621 27.4786 -9999. 0.125603 27.9231 -9999. 0.123616 28.3747 -9999. 0.121662 28.8337 -9999. 0.119738 29.3000 0.680884 0.117845 29.7739 0.672057 0.115981 30.2555 0.662457 0.114147 30.7449 0.652204 0.112619 31.2421 0.641495 0.111196 31.7475 0.630185 0.109791 32.2609 0.618217 0.108404 32.7827 0.605541 0.107034 33.3130 0.592108 0.105682 33.8518 0.577867 0.104347 34.3993 0.562767 0.103028 34.9557 0.546756 0.101727 35.5211 0.529790 0.100441 36.0956 0.511913 0.991722E-01 36.6794 0.492899 0.974117E-01 37.2727 0.472300 0.955735E-01 37.8755 0.450106 0.937699E-01 38.4882 0.426271 0.920004E-01 39.1107 0.400660 0.902642E-01 39.7432 0.373113 0.885608E-01 40.3861 0.343436 0.868896E-01 41.0393 0.311403 0.852499E-01 41.7031 0.276728 0.836412E-01 42.3776 0.239096 0.820959E-01 43.0630 0.198182 0.806583E-01 43.7595 0.153553 0.792460E-01 44.4673 0.104628 0.778582E-01 45.1865 0.507173E-01 0.764948E-01 45.9174 -0.904566E-02 0.751554E-01 46.6600 -0.757630E-01 0.738393E-01 47.4147 -0.150875 0.725463E-01 48.1816 -0.236314 0.712759E-01 48.9609 -0.334760 0.700278E-01 49.7528 -0.450076 0.688015E-01 50.5576 -0.588230 0.674866E-01 51.3753 -0.759145 0.661458E-01 52.2062 -0.981045 0.648315E-01 53.0506 -1.29425 0.636408E-01 53.9087 -1.82877 0.627145E-01 54.6000 -3.20462 0.619885E-01 54.8000 -3.26778 1.99565 55.6667 -2.01988 2.17298 56.5670 -1.68391 2.37060 57.4820 -1.44905 2.58621 58.4117 -1.20997 2.78791 59.3564 -0.978073 2.94577 60.3165 -0.760569 3.08872 61.2921 -0.542090 3.21499 62.2834 -0.319116 3.33533 63.2908 -0.699885E-01 3.44780 64.3145 0.209528 3.50010 65.3547 0.490103 3.51380 66.4118 0.743078 3.44849 67.4859 0.976848 3.38439 68.5775 1.16223 3.20844 69.6867 1.24896 3.07443 70.8138 1.30607 2.96708 71.9591 1.34649 2.89749 73.1230 1.37483 2.82954 74.3057 1.38674 2.79758 75.5076 1.40488 2.78483 76.7289 1.42925 2.79626 77.9699 1.46026 2.80820 79.2310 1.49817 2.85028 80.5125 1.56749 2.89349 81.8147 1.65297 2.93282 83.1380 1.74778 2.95689 84.4827 1.84633 2.98116 85.8491 1.96188 3.00563 87.2377 2.09531 3.01725 88.6487 2.24307 3.00041 90.0825 2.39000 2.95722 91.5395 2.53184 2.88927 93.0201 2.64865 2.77915 94.5246 2.72433 2.68556 96.0535 2.79740 2.59906 97.6071 2.85171 2.48846 99.1858 2.87356 2.39352 100.790 2.92523 2.36108 102.420 2.97852 2.23552 104.077 2.97334 2.17080 105.760 2.98478 2.10776 107.471 2.99098 2.05038 109.209 2.99580 2.00447 110.975 3.00520 1.96700 112.770 3.02065 1.93440 114.594 3.04395 1.90000 116.448 3.06819 1.85974 118.331 3.08790 1.81856 120.245 3.10614 1.77829 122.190 3.12324 1.73891 124.166 3.13943 1.70040 126.175 3.15484 1.66274 128.215 3.16966 1.62592 130.289 3.18417 1.58989 132.397 3.19888 1.55441 134.538 3.21330 1.51713 136.714 3.22540 1.47975 138.925 3.23556 1.44328 141.172 3.24442 1.40771 143.456 3.25202 1.37302 145.776 3.25797 1.33918 148.134 3.26235 1.30831 150.530 3.26778 1.28017 152.964 3.27528 1.25177 155.439 3.28270 1.22254 157.953 3.28877 1.19295 160.507 3.29388 1.16408 163.103 3.29834 1.13591 165.742 3.30227 1.10842 168.422 3.30557 1.08158 171.146 3.30839 1.05569 173.915 3.31098 1.03081 176.727 3.31372 1.00703 179.586 3.31737 0.983784 182.491 3.32179 0.960465 185.442 3.32594 0.934802 188.442 3.32824 0.909232 191.489 3.32851 0.884027 194.587 3.32778 0.861010 197.734 3.32732 0.839043 200.932 3.32690 0.817994 204.182 3.32669 0.797466 207.485 3.32652 0.777459 210.840 3.32698 0.757960 214.251 3.32750 0.737532 217.716 3.32695 0.717367 221.237 3.32594 0.697533 224.816 3.32445 0.678251 228.452 3.32265 0.659499 232.147 3.32059 0.641261 235.902 3.31831 0.623542 239.717 3.31587 0.606309 243.595 3.31327 0.589546 247.535 3.31055 0.573246 251.538 3.30771 0.557394 255.607 3.30479 0.541978 259.741 3.30180 0.527003 263.942 3.29878 0.512429 268.211 3.29574 0.498243 272.549 3.29282 0.484490 276.957 3.29002 0.470846 281.437 3.28707 0.457242 285.989 3.28389 0.443849 290.615 3.28043 0.430821 295.315 3.27686 0.418174 300.092 3.27318 0.405896 304.945 3.26943 0.393981 309.878 3.26563 0.382416 314.890 3.26179 0.371191 319.983 3.25793 0.360294 325.158 3.25404 0.349719 330.418 3.25015 0.339453 335.762 3.24626 0.329488 341.192 3.24237 0.319816 346.711 3.23850 0.310428 352.319 3.23464 0.301315 358.017 3.23082 0.292473 363.808 3.22703 0.283888 369.692 3.22328 0.275554 375.672 3.21959 0.267464 381.748 3.21599 0.259613 387.922 3.21253 0.251897 394.197 3.20905 0.244208 400.573 3.20547 0.236732 407.052 3.20187 0.229475 413.635 3.19827 0.222436 420.326 3.19469 0.215618 427.124 3.19113 0.209010 434.032 3.18762 0.202601 441.052 3.18416 0.196389 448.186 3.18077 0.190350 455.435 3.17744 0.184411 462.802 3.17411 0.178594 470.287 3.17076 0.172928 477.894 3.16740 0.167439 485.623 3.16407 0.162127 493.478 3.16076 0.156984 501.459 3.15749 0.152005 509.570 3.15424 0.147184 517.812 3.15103 0.142522 526.187 3.14785 0.138026 534.698 3.14473 0.133710 543.346 3.14169 0.129547 552.134 3.13876 0.125509 561.065 3.13591 0.121508 570.139 3.13303 0.117597 579.361 3.13018 0.113829 588.732 3.12737 0.110194 598.254 3.12462 0.106681 607.930 3.12192 0.103275 617.763 3.11929 0.999807E-01 627.755 3.11676 0.967852E-01 637.908 3.11431 0.935986E-01 648.226 3.11187 0.903850E-01 658.711 3.10934 0.871976E-01 669.365 3.10662 0.841223E-01 680.191 3.10384 0.814099E-01 691.193 3.10129 0.789774E-01 702.372 3.09896 0.766669E-01 713.733 3.09682 0.742675E-01 725.277 3.09467 0.718383E-01 737.008 3.09249 0.694890E-01 748.928 3.09035 0.672168E-01 761.042 3.08825 0.650189E-01 773.351 3.08618 0.628898E-01 785.859 3.08416 0.608226E-01 798.570 3.08217 0.588170E-01 811.486 3.08021 0.568785E-01 824.611 3.07829 0.550035E-01 837.949 3.07640 0.531901E-01 851.502 3.07455 0.514403E-01 865.274 3.07274 0.497524E-01 879.269 3.07097 0.481237E-01 893.491 3.06925 0.465489E-01 907.943 3.06756 0.450255E-01 922.628 3.06592 0.435519E-01 937.551 3.06432 0.421079E-01 952.715 3.06274 0.407079E-01 968.124 3.06119 0.393511E-01 983.783 3.05967 0.380389E-01 999.695 3.05818 0.367729E-01 1015.86 3.05671 0.355517E-01 1032.29 3.05528 0.343936E-01 1048.99 3.05390 0.332643E-01 1065.96 3.05256 0.321625E-01 1083.20 3.05123 0.310974E-01 1100.72 3.04994 0.300677E-01 1118.52 3.04868 0.290722E-01 1136.61 3.04745 0.281097E-01 1155. 3.04624 0.271788E-01 1173.68 3.04507 0.262784E-01 1192.66 3.04392 0.254085E-01 1211.95 3.04280 0.245671E-01 1231.55 3.04172 0.237533E-01 1251.47 3.04066 0.229618E-01 1271.72 3.03963 0.221907E-01 1292.29 3.03862 0.214382E-01 1313.19 3.03762 0.207116E-01 1334.43 3.03665 0.200097E-01 1356.01 3.03570 0.193314E-01 1377.94 3.03477 0.186762E-01 1400.23 3.03387 0.180431E-01 1422.88 3.03298 0.174315E-01 1445.89 3.03212 0.168406E-01 1469.28 3.03128 0.162689E-01 1493.04 3.03047 0.157153E-01 1517.19 3.02967 0.151752E-01 1541.73 3.02889 0.146530E-01 1566.67 3.02812 0.141488E-01 1592.01 3.02737 0.136619E-01 1617.76 3.02664 0.131917E-01 1643.92 3.02593 0.127378E-01 1670.51 3.02524 0.122994E-01 1697.53 3.02456 0.118761E-01 1724.99 3.02391 0.114673E-01 1752.89 3.02327 0.110671E-01 1781.24 3.02264 0.106790E-01 1810.05 3.02202 0.103031E-01 1839.32 3.02142 0.994046E-02 1869.07 3.02083 0.959413E-02 1899.30 3.02025 0.926777E-02 1930.02 3.01969 0.895249E-02 1961.24 3.01915 0.864796E-02 1992.96 3.01863 0.835378E-02 2025.20 3.01811 0.806960E-02 2057.95 3.01761 0.779510E-02 2091.24 3.01713 0.752992E-02 2125.06 3.01666 0.727378E-02 2159.43 3.01620 0.702633E-02 2194.36 3.01575 0.678732E-02 2229.85 3.01532 0.655644E-02 2265.92 3.01490 0.633340E-02 2302.57 3.01449 0.611795E-02 2339.81 3.01409 0.590983E-02 2377.66 3.01370 0.570880E-02 2416.11 3.01333 0.551262E-02 2455.19 3.01297 0.531145E-02 2494.90 3.01262 0.511762E-02 2535.26 3.01226 0.493087E-02 2576.26 3.01192 0.475093E-02 2617.93 3.01159 0.457755E-02 2660.27 3.01126 0.441008E-02 2703.30 3.01094 0.424784E-02 2747.03 3.01063 0.409159E-02 2791.46 3.01033 0.394107E-02 2836.61 3.01003 0.379610E-02 2882.49 3.00974 0.365646E-02 2929.11 3.00946 0.352145E-02 2976.48 3.00919 0.339096E-02 3024.63 3.00892 0.326531E-02 3073.55 3.00866 0.314430E-02 3123.26 3.00841 0.302778E-02 3173.78 3.00816 0.291558E-02 3225.11 3.00792 0.280726E-02 3277.27 3.00769 0.270283E-02 3330.28 3.00746 0.260229E-02 3384.15 3.00724 0.250549E-02 3438.88 3.00702 0.241229E-02 3494.50 3.00681 0.232255E-02 3551.02 3.00661 0.223631E-02 3608.46 3.00641 0.215327E-02 3666.82 3.00621 0.207333E-02 3726.13 3.00602 0.199635E-02 3786.40 3.00584 0.192222E-02 3847.64 3.00566 0.185088E-02 3909.87 3.00549 0.178266E-02 3973.11 3.00532 0.171696E-02 4037.38 3.00515 0.165368E-02 4102.68 3.00499 0.159274E-02 4169.03 3.00484 0.153404E-02 4236.46 3.00469 0.147754E-02 4304.98 3.00454 0.142325E-02 4374.62 3.00440 0.137097E-02 4445.37 3.00426 0.132060E-02 4517.27 3.00413 0.127208E-02 4590.33 3.00399 0.122534E-02 4664.58 3.00387 0.118039E-02 4740.03 3.00374 0.113717E-02 4816.69 3.00362 0.109554E-02 4894.60 3.00351 0.105543E-02 4973.77 3.00339 0.101679E-02 5054.21 3.00328 0.979567E-03 5135.96 3.00318 0.943747E-03 5219.03 3.00307 0.909264E-03 5303.44 3.00297 0.876043E-03 5389.22 3.00287 0.844037E-03 5476.39 3.00278 0.813196E-03 5564.97 3.00269 0.783486E-03 5654.98 3.00260 0.754904E-03 5746.44 3.00251 0.727378E-03 5839.39 3.00242 0.700857E-03 5933.83 3.00234 0.675300E-03 6029.81 3.00226 0.650677E-03 6127.33 3.00218 0.626951E-03 6226.44 3.00211 0.604111E-03 6327.15 3.00203 0.582105E-03 6429.48 3.00196 0.560900E-03 6533.48 3.00189 0.540466E-03 6639.15 3.00183 0.520778E-03 6746.54 3.00176 0.501809E-03 6855.65 3.00170 0.483540E-03 6966.54 3.00164 0.465936E-03 7079.22 3.00158 0.448971E-03 7193.72 3.00152 0.432626E-03 7310.07 3.00146 0.416874E-03 7428.31 3.00141 0.401695E-03 7548.45 3.00136 0.387063E-03 7670.54 3.00130 0.372963E-03 7794.61 3.00125 0.359378E-03 7920.68 3.00121 0.346287E-03 8048.79 3.00116 0.333673E-03 8178.98 3.00111 0.321512E-03 8311.26 3.00107 0.309790E-03 8445.69 3.00103 0.298496E-03 8582.29 3.00098 0.287612E-03 8721.11 3.00094 0.277127E-03 8862.16 3.00090 0.267023E-03 9005.50 3.00087 0.257276E-03 9151.16 3.00083 0.247879E-03 9299.17 3.00079 0.238826E-03 9449.58 3.00076 0.230102E-03 9602.42 3.00072 0.221698E-03 9757.73 3.00069 0.213601E-03 9915.55 3.00066 0.205779E-03 10075.9 3.00063 0.198251E-03 10238.9 3.00060 0.190995E-03 10404.5 3.00057 0.184002E-03 10572.8 3.00054 0.177261E-03 10743.8 3.00051 0.170764E-03 10917.6 3.00048 0.164502E-03 11094.2 3.00046 0.158467E-03 11273.6 3.00043 0.152651E-03 11455.9 3.00041 0.147044E-03 11641.2 3.00039 0.141641E-03 11829.5 3.00036 0.136434E-03 12020.8 3.00034 0.131415E-03 12215.3 3.00032 0.126578E-03 12412.8 3.00030 0.121916E-03 12613.6 3.00028 0.117424E-03 12817.6 3.00026 0.113094E-03 13025.0 3.00024 0.108922E-03 13235.6 3.00022 0.104901E-03 13449.7 3.00020 0.101026E-03 13667.2 3.00018 0.972922E-04 13888.3 3.00017 0.936942E-04 14112.9 3.00015 0.902272E-04 14341.2 3.00013 0.868865E-04 14573.1 3.00012 0.836676E-04 14808.9 3.00010 0.805662E-04 15048.4 3.00009 0.775780E-04 15291.8 3.00007 0.746991E-04 15539.1 3.00006 0.719256E-04 15790.4 3.00005 0.692535E-04 16045.8 3.00003 0.666795E-04 16305.4 3.00002 0.641998E-04 16569.1 3.00001 0.618114E-04 16837.1 3.00000 0.595107E-04 17109.4 2.99998 0.572949E-04 17386.1 2.99997 0.551607E-04 17667.4 2.99996 0.531053E-04 17953.1 2.99995 0.511259E-04 18243.5 2.99994 0.492198E-04 18538.6 2.99993 0.473844E-04 18838.4 2.99992 0.456171E-04 19143.1 2.99991 0.439156E-04 19452.7 2.99990 0.422775E-04 19767.4 2.99989 0.407005E-04 20087.1 2.99989 0.390553E-04 20412.0 2.99988 0.375510E-04 20742.1 2.99987 0.361054E-04 21077.6 2.99986 0.347159E-04 21418.5 2.99985 0.333804E-04 21765.0 2.99985 0.320968E-04 22117.0 2.99984 0.308630E-04 22474.7 2.99983 0.296771E-04 22838.2 2.99983 0.285370E-04 23207.6 2.99982 0.274411E-04 23583.0 2.99981 0.263875E-04 23964.4 2.99981 0.253747E-04 24352.0 2.99980 0.244010E-04 24745.9 2.99980 0.234648E-04 25146.2 2.99979 0.225648E-04 25552.9 2.99978 0.216994E-04 25966.2 2.99978 0.208674E-04 26386.1 2.99977 0.200674E-04 26812.9 2.99977 0.192981E-04 27246.6 2.99976 0.185584E-04 27687.3 2.99976 0.178472E-04 28135.1 2.99976 0.171632E-04 28590.2 2.99975 0.165056E-04 29052.6 2.99975 0.158731E-04 29522.5 2.99974 0.152649E-04 30000.0 2.99974 0.146800E-04 periodictable-1.5.0/periodictable/xsf/lu.nff000066400000000000000000000320551310514471200210470ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.67493 10.1617 -9999. 1.63824 10.3261 -9999. 1.60236 10.4931 -9999. 1.56726 10.6628 -9999. 1.53293 10.8353 -9999. 1.49935 11.0106 -9999. 1.46651 11.1886 -9999. 1.43538 11.3696 -9999. 1.42424 11.5535 -9999. 1.41319 11.7404 -9999. 1.40223 11.9303 -9999. 1.38963 12.1232 -9999. 1.36815 12.3193 -9999. 1.34699 12.5186 -9999. 1.32616 12.7210 -9999. 1.30108 12.9268 -9999. 1.27644 13.1359 -9999. 1.25227 13.3483 -9999. 1.22856 13.5642 -9999. 1.20529 13.7836 -9999. 1.18260 14.0066 -9999. 1.16139 14.2331 -9999. 1.14057 14.4633 -9999. 1.12012 14.6973 -9999. 1.10004 14.9350 -9999. 1.08087 15.1765 -9999. 1.06523 15.4220 -9999. 1.04981 15.6714 -9999. 1.03462 15.9249 -9999. 1.01964 16.1825 -9999. 1.00020 16.4442 -9999. 0.975191 16.7102 -9999. 0.950806 16.9805 -9999. 0.927030 17.2551 -9999. 0.903850 17.5342 -9999. 0.881514 17.8178 -9999. 0.862480 18.1060 -9999. 0.843858 18.3989 -9999. 0.825637 18.6964 -9999. 0.807810 18.9988 -9999. 0.790368 19.3061 -9999. 0.774573 19.6184 -9999. 0.759473 19.9357 -9999. 0.744668 20.2582 -9999. 0.730150 20.5858 -9999. 0.715945 20.9188 -9999. 0.703634 21.2571 -9999. 0.691534 21.6009 -9999. 0.679642 21.9503 -9999. 0.667955 22.3053 -9999. 0.656062 22.6661 -9999. 0.644332 23.0327 -9999. 0.633762 23.4053 -9999. 0.630564 23.7838 -9999. 0.627382 24.1685 -9999. 0.624398 24.5594 -9999. 0.622140 24.9566 -9999. 0.619890 25.3603 -9999. 0.617835 25.7705 -9999. 0.617480 26.1873 -9999. 0.617126 26.6109 -9999. 0.620682 27.0413 -9999. 0.641341 27.4786 -9999. 0.669383 27.9231 -9999. 0.705770 28.3747 -9999. 0.786806 28.8337 -9999. 0.945780 29.3000 -5.13090 2.22990 29.7739 -6.18539 3.36209 30.2555 -6.32453 6.12834 30.7449 -5.77834 8.07995 31.2421 -5.04485 9.73344 31.7475 -3.74155 10.7388 32.2609 -2.59986 11.3775 32.7827 -1.70248 11.7607 33.3130 -0.887875 12.1117 33.8518 -0.189434 12.3588 34.3993 0.413745 12.6108 34.9557 1.01706 12.9595 35.5211 1.71157 13.3180 36.0956 2.60518 13.5384 36.6794 3.35352 13.5136 37.2727 4.02103 13.5029 37.8755 4.69810 13.4923 38.4882 5.49659 13.2747 39.1107 5.95621 12.8612 39.7432 6.27972 12.6620 40.3861 6.62276 12.4867 41.0393 6.95088 12.3139 41.7031 7.25824 12.1448 42.3776 7.55134 11.9803 43.0630 7.83909 11.8180 43.7595 8.12548 11.6127 44.4673 8.34838 11.3849 45.1865 8.51864 11.1616 45.9174 8.62024 10.9753 46.6600 8.73057 10.8280 47.4147 8.82007 10.6827 48.1816 8.85247 10.6053 48.9609 8.95232 10.5888 49.7528 9.09655 10.5724 50.5576 9.30515 10.5139 51.3753 9.46366 10.3977 52.2062 9.58880 10.2828 53.0506 9.69055 10.1691 53.9087 9.75948 10.0789 54.7806 9.84273 10.0107 55.6667 9.93033 9.94298 56.5670 10.0153 9.87570 57.4820 10.0965 9.80901 58.4117 10.1725 9.74277 59.3564 10.2411 9.67698 60.3165 10.2983 9.61959 61.2921 10.3596 9.57064 62.2834 10.4219 9.52195 63.2908 10.4881 9.47349 64.3145 10.5430 9.40084 65.3547 10.5733 9.32876 66.4118 10.5656 9.25723 67.4859 10.5449 9.26438 68.5775 10.5570 9.28227 69.6867 10.5875 9.30021 70.8138 10.6274 9.31817 71.9591 10.6792 9.33294 73.1230 10.7303 9.33764 74.3057 10.7803 9.34233 75.5076 10.8335 9.34703 76.7289 10.8992 9.35174 77.9699 10.9802 9.31416 79.2310 11.0158 9.24810 80.5125 11.0182 9.18251 81.8147 10.9865 9.11739 83.1380 10.8933 9.05273 84.4827 10.6856 9.11605 85.8491 10.5999 9.29614 87.2377 10.6094 9.47978 88.6487 10.6968 9.61217 90.0825 10.7548 9.68953 91.5395 10.8041 9.76751 93.0201 10.8570 9.84612 94.5246 10.9312 9.91122 96.0535 10.9818 9.93913 97.6071 11.0099 9.96712 99.1858 11.0168 9.99519 100.790 10.9868 10.0373 102.420 10.9672 10.1237 104.077 10.9556 10.2108 105.760 10.9421 10.2987 107.471 10.9112 10.3873 109.209 10.8722 10.5245 110.975 10.8563 10.6750 112.770 10.8545 10.8277 114.594 10.8554 10.9825 116.448 10.8554 11.1528 118.331 10.8703 11.3341 120.245 10.8966 11.5184 122.190 10.9298 11.7056 124.166 10.9682 11.8959 126.175 11.0064 12.0936 128.215 11.0575 12.3054 130.289 11.1205 12.5209 132.397 11.1940 12.7402 134.538 11.2779 12.9633 136.714 11.3730 13.1899 138.925 11.4792 13.4198 141.172 11.5982 13.6536 143.456 11.7343 13.8915 145.776 11.9052 14.1335 148.134 12.0929 14.3249 150.530 12.2603 14.5029 152.964 12.4213 14.6831 155.439 12.5826 14.8655 157.953 12.7498 15.0502 160.507 12.9268 15.2228 163.103 13.0951 15.3871 165.742 13.2571 15.5533 168.422 13.4173 15.7212 171.146 13.5759 15.8909 173.915 13.7312 16.0625 176.727 13.8831 16.2452 179.586 14.0419 16.4348 182.491 14.2080 16.6250 185.442 14.3708 16.8112 188.442 14.5235 16.9981 191.489 14.6361 17.2002 194.587 14.7714 17.4824 197.734 14.9368 17.7937 200.932 15.1601 18.1311 204.182 15.4360 18.4747 207.485 15.7752 18.8251 210.840 16.2410 19.1824 214.251 16.7362 19.3133 217.716 17.1946 19.3954 221.237 17.5776 19.4386 224.816 17.9243 19.4816 228.452 18.2486 19.5246 232.147 18.5567 19.5675 235.902 18.8522 19.6106 239.717 19.1376 19.6537 243.595 19.4138 19.6968 247.535 19.6825 19.7406 251.538 19.9450 19.7842 255.607 20.1999 19.8272 259.741 20.4478 19.8713 263.942 20.6887 19.9153 268.211 20.9203 19.9590 272.549 21.1380 20.0034 276.957 21.3278 20.0690 281.437 21.5270 20.1618 285.989 21.7424 20.2728 290.615 21.9708 20.3867 295.315 22.2089 20.5010 300.092 22.4541 20.6167 304.945 22.7062 20.7326 309.878 22.9636 20.8483 314.890 23.2261 20.9654 319.983 23.4944 21.0834 325.158 23.7689 21.2020 330.418 24.0494 21.3212 335.762 24.3364 21.4412 341.192 24.6308 21.5622 346.711 24.9331 21.6830 352.319 25.2433 21.8044 358.017 25.5634 21.9272 363.808 25.8949 22.0504 369.692 26.2398 22.1746 375.672 26.6027 22.2999 381.748 26.9918 22.4254 387.922 27.4250 22.5363 394.197 27.9048 22.6140 400.573 28.3898 22.5829 407.052 28.8070 22.5089 413.635 29.1859 22.4360 420.326 29.5409 22.3627 427.124 29.8762 22.2895 434.032 30.1931 22.2165 441.052 30.4916 22.1437 448.186 30.7405 22.0809 455.435 30.9877 22.0675 462.802 31.2466 22.0891 470.287 31.5326 22.1297 477.894 31.8457 22.1711 485.623 32.1759 22.2115 493.478 32.5224 22.2518 501.459 32.8900 22.2935 509.570 33.2859 22.3342 517.812 33.7360 22.3605 526.187 34.2243 22.3366 534.698 34.7161 22.2171 543.346 35.1450 22.0511 552.134 35.5407 21.8864 561.065 35.9175 21.7108 570.139 36.2747 21.5299 579.361 36.6117 21.3446 588.732 36.9335 21.1599 598.254 37.2430 20.9760 607.930 37.5433 20.7936 617.763 37.8376 20.6129 627.755 38.1335 20.4324 637.908 38.4295 20.2370 648.226 38.7158 20.0195 658.711 38.9707 19.7886 669.365 39.1944 19.5602 680.191 39.3930 19.3652 691.193 39.6018 19.1954 702.372 39.8433 19.0299 713.733 40.0948 18.8287 725.277 40.3189 18.6043 737.008 40.5237 18.3823 748.928 40.7167 18.1627 761.042 40.9019 17.9453 773.351 41.0831 17.7267 785.859 41.2576 17.4989 798.570 41.4140 17.2644 811.486 41.5554 17.0327 824.611 41.6851 16.8039 837.949 41.8049 16.5780 851.502 41.9152 16.3533 865.274 42.0159 16.1299 879.269 42.1059 15.9079 893.491 42.1860 15.6886 907.943 42.2574 15.4721 922.628 42.3222 15.2584 937.551 42.3774 15.0407 952.715 42.4216 14.8243 968.124 42.4542 14.6096 983.783 42.4772 14.3977 999.695 42.4929 14.1863 1015.86 42.5046 13.9753 1032.29 42.4993 13.7453 1048.99 42.4733 13.5159 1065.96 42.4251 13.2872 1083.20 42.3571 13.0623 1100.72 42.2702 12.8409 1118.52 42.1640 12.6231 1136.61 42.0372 12.4082 1155. 41.8890 12.1969 1173.68 41.7182 11.9892 1192.66 41.5228 11.7846 1211.95 41.3007 11.5832 1231.55 41.0489 11.3850 1251.47 40.7641 11.1899 1271.72 40.4423 10.9985 1292.29 40.0791 10.8105 1313.19 39.6681 10.6257 1334.43 39.2016 10.4437 1356.01 38.6688 10.2643 1377.94 38.0560 10.0881 1400.23 37.3454 9.91473 1422.88 36.5112 9.74406 1445.89 35.5162 9.57594 1469.28 34.3037 9.40860 1493.04 32.7767 9.24109 1517.19 30.7470 9.06467 1541.73 27.8052 8.88992 1566.67 22.6054 8.71842 1588.40 -11.0350 8.57380 1588.60 -11.0358 27.8270 1592.01 10.6573 27.7312 1617.76 21.1871 27.0244 1643.92 21.3360 33.6891 1670.51 27.1492 38.9425 1697.53 33.6220 38.0218 1724.99 37.3082 37.1222 1752.89 40.0322 36.2450 1781.24 42.2005 35.3891 1810.05 43.9919 34.5539 1839.32 45.5033 33.7381 1869.07 46.7930 32.9417 1899.30 47.8986 32.1644 1930.02 48.8428 31.4056 1961.24 49.6339 30.6649 1992.96 50.2505 29.9421 2023.50 49.7726 29.2728 2023.70 49.7823 29.8668 2025.20 50.3349 29.8340 2057.95 51.4536 29.1309 2091.24 51.9947 28.4444 2125.06 52.3492 27.7751 2159.43 52.5086 27.1212 2194.36 52.3886 26.4838 2229.85 51.6716 25.8614 2263.40 41.7649 25.2953 2263.60 41.7809 31.2651 2265.92 47.4270 31.2188 2302.57 53.0895 30.5012 2339.81 54.8089 29.8010 2377.66 55.9543 29.1172 2416.11 56.8167 28.4501 2455.19 57.5144 27.7995 2491.10 58.3502 27.2237 2491.30 58.3518 27.1902 2494.90 57.7334 27.2302 2535.26 58.3627 27.6794 2576.26 59.3614 27.0947 2617.93 60.0663 26.5195 2660.27 60.6685 25.9537 2703.30 61.2036 25.3966 2747.03 61.6869 24.8491 2791.46 62.1281 24.3114 2836.61 62.5332 23.7832 2882.49 62.9071 23.2646 2929.11 63.2528 22.7548 2976.48 63.5728 22.2545 3024.63 63.8694 21.7633 3073.55 64.1447 21.2818 3123.26 64.4009 20.8093 3173.78 64.6385 20.3450 3225.11 64.8594 19.8904 3277.27 65.0642 19.4433 3330.28 65.2535 19.0058 3384.15 65.4294 18.5773 3438.88 65.5923 18.1567 3494.50 65.7431 17.7444 3551.02 65.8814 17.3399 3608.46 66.0090 16.9448 3666.82 66.1263 16.5564 3726.13 66.2340 16.1772 3786.40 66.3320 15.8041 3847.64 66.4208 15.4399 3909.87 66.5016 15.0828 3973.11 66.5742 14.7332 4037.38 66.6391 14.3909 4102.68 66.6967 14.0558 4169.03 66.7472 13.7278 4236.46 66.7911 13.4067 4304.98 66.8286 13.0926 4374.62 66.8600 12.7851 4445.37 66.8855 12.4842 4517.27 66.9055 12.1899 4590.33 66.9199 11.9018 4664.58 66.9291 11.6202 4740.03 66.9333 11.3447 4816.69 66.9326 11.0752 4894.60 66.9272 10.8117 4973.77 66.9174 10.5540 5054.21 66.9029 10.3021 5135.96 66.8842 10.0558 5219.03 66.8613 9.81492 5303.44 66.8342 9.57942 5389.22 66.8028 9.34921 5476.39 66.7675 9.12429 5564.97 66.7281 8.90436 5654.98 66.6847 8.68944 5746.44 66.6372 8.47941 5839.39 66.5856 8.27411 5933.83 66.5298 8.07350 6029.81 66.4699 7.87744 6127.33 66.4055 7.68578 6226.44 66.3365 7.49854 6327.15 66.2630 7.31572 6429.48 66.1845 7.13682 6533.48 66.1007 6.96224 6639.15 66.0115 6.79158 6746.54 65.9163 6.62485 6855.65 65.8147 6.46193 6966.54 65.7061 6.30288 7079.22 65.5899 6.14739 7193.72 65.4652 5.99556 7310.07 65.3312 5.84730 7428.31 65.1864 5.70214 7548.45 65.0292 5.56064 7670.54 64.8581 5.42233 7794.61 64.6703 5.28719 7920.68 64.4628 5.15507 8048.79 64.2312 5.02608 8178.98 63.9699 4.90014 8311.26 63.6707 4.77710 8445.69 63.3212 4.65693 8582.29 62.9023 4.53947 8721.11 62.3797 4.42456 8862.16 61.6870 4.31254 9005.50 60.6582 4.20291 9151.16 58.6159 4.09594 9244. 43.6076 4.03005 9244.20 43.6089 10.9885 9299.17 57.5817 10.8681 9449.58 60.4875 10.5486 9602.42 61.6079 10.2388 9757.73 62.2026 9.93831 9915.55 62.4764 9.64646 10075.9 62.4335 9.36312 10238.9 61.7797 9.08811 10348.5 53.9601 8.91010 10348.7 53.9608 12.5239 10404.5 61.3525 12.3978 10572.8 63.1231 12.0292 10743.8 63.6827 11.6715 10870.3 60.9431 11.4173 10870.5 60.9436 12.8327 10917.6 63.8694 12.7567 11094.2 65.0852 12.4786 11273.6 65.7922 12.2037 11455.9 66.3442 11.9322 11641.2 66.8065 11.6642 11829.5 67.2065 11.3998 12020.8 67.5588 11.1392 12215.3 67.8731 10.8825 12412.8 68.1557 10.6296 12613.6 68.4113 10.3808 12817.6 68.6435 10.1361 13025.0 68.8553 9.89540 13235.6 69.0488 9.65887 13449.7 69.2260 9.42651 13667.2 69.3884 9.19833 13888.3 69.5374 8.97436 14112.9 69.6741 8.75458 14341.2 69.7997 8.53901 14573.1 69.9149 8.32763 14808.9 70.0206 8.12043 15048.4 70.1174 7.91739 15291.8 70.2061 7.71850 15539.1 70.2872 7.52372 15790.4 70.3612 7.33301 16045.8 70.4286 7.14635 16305.4 70.4899 6.96370 16569.1 70.5454 6.78502 16837.1 70.5956 6.61026 17109.4 70.6407 6.43937 17386.1 70.6811 6.27232 17667.4 70.7171 6.10904 17953.1 70.7489 5.94949 18243.5 70.7768 5.79361 18538.6 70.8012 5.64136 18838.4 70.8220 5.49266 19143.1 70.8397 5.34747 19452.7 70.8544 5.20573 19767.4 70.8663 5.06738 20087.1 70.8755 4.93236 20412.0 70.8822 4.80061 20742.1 70.8866 4.67207 21077.6 70.8888 4.54669 21418.5 70.8890 4.42441 21765.0 70.8872 4.30515 22117.0 70.8836 4.18888 22474.7 70.8784 4.07552 22838.2 70.8715 3.96502 23207.6 70.8632 3.85731 23583.0 70.8535 3.75235 23964.4 70.8425 3.65007 24352.0 70.8303 3.55042 24745.9 70.8170 3.45333 25146.2 70.8025 3.35876 25552.9 70.7871 3.26665 25966.2 70.7708 3.17694 26386.1 70.7536 3.08957 26812.9 70.7356 3.00451 27246.6 70.7168 2.92168 27687.3 70.6973 2.84105 28135.1 70.6772 2.76255 28590.2 70.6564 2.68615 29052.6 70.6350 2.61178 29522.5 70.6131 2.53941 30000.0 70.5907 2.46898 periodictable-1.5.0/periodictable/xsf/mg.nff000066400000000000000000000325451310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.925044 10.1617 -9999. 0.793444 10.3261 -9999. 0.680567 10.4931 -9999. 0.583747 10.6628 -9999. 0.500699 10.8353 -9999. 0.429469 11.0106 -9999. 0.368371 11.1886 -9999. 0.315965 11.3696 -9999. 0.271014 11.5535 -9999. 0.232459 11.7404 -9999. 0.211041 11.9303 -9999. 0.201813 12.1232 -9999. 0.192988 12.3193 -9999. 0.184549 12.5186 -9999. 0.176479 12.7210 -9999. 0.168762 12.9268 -9999. 0.161383 13.1359 -9999. 0.154326 13.3483 -9999. 0.147578 13.5642 -9999. 0.141125 13.7836 -9999. 0.134954 14.0066 -9999. 0.129053 14.2331 -9999. 0.123410 14.4633 -9999. 0.118013 14.6973 -9999. 0.112853 14.9350 -9999. 0.107918 15.1765 -9999. 0.103199 15.4220 -9999. 0.986868E-01 15.6714 -9999. 0.943715E-01 15.9249 -9999. 0.902449E-01 16.1825 -9999. 0.862988E-01 16.4442 -9999. 0.859980E-01 16.7102 -9999. 0.862263E-01 16.9805 -9999. 0.864552E-01 17.2551 -9999. 0.866847E-01 17.5342 -9999. 0.869148E-01 17.8178 -9999. 0.871455E-01 18.1060 -9999. 0.873768E-01 18.3989 -9999. 0.876087E-01 18.6964 -9999. 0.878412E-01 18.9988 -9999. 0.880745E-01 19.3061 -9999. 0.883082E-01 19.6184 -9999. 0.899293E-01 19.9357 -9999. 0.917246E-01 20.2582 -9999. 0.935558E-01 20.5858 -9999. 0.954235E-01 20.9188 -9999. 0.973285E-01 21.2571 -9999. 0.992715E-01 21.6009 -9999. 0.101253 21.9503 -9999. 0.103275 22.3053 -9999. 0.105337 22.6661 -9999. 0.107439 23.0327 -9999. 0.109584 23.4053 -9999. 0.111772 23.7838 -9999. 0.114003 24.1685 -9999. 0.116279 24.5594 -9999. 0.118601 24.9566 -9999. 0.120969 25.3603 -9999. 0.123384 25.7705 -9999. 0.125847 26.1873 -9999. 0.127326 26.6109 -9999. 0.128800 27.0413 -9999. 0.130291 27.4786 -9999. 0.131798 27.9231 -9999. 0.133324 28.3747 -9999. 0.134867 28.8337 -9999. 0.136428 29.3000 1.28306 0.138006 29.7739 1.26035 0.139604 30.2555 1.23660 0.141219 30.7449 1.21176 0.142854 31.2421 1.18579 0.144507 31.7475 1.15865 0.146179 32.2609 1.13051 0.147871 32.7827 1.10145 0.149152 33.3130 1.07038 0.149283 33.8518 1.03704 0.149415 34.3993 1.00158 0.149547 34.9557 0.963920 0.149679 35.5211 0.923943 0.149811 36.0956 0.881497 0.149943 36.6794 0.836407 0.150076 37.2727 0.788491 0.150208 37.8755 0.737595 0.150341 38.4882 0.683992 0.150473 39.1107 0.626607 0.148531 39.7432 0.563719 0.145775 40.3861 0.494750 0.143069 41.0393 0.419553 0.140414 41.7031 0.337346 0.137808 42.3776 0.247091 0.135250 43.0630 0.147466 0.132794 43.7595 0.366648E-01 0.130386 44.4673 -0.878440E-01 0.128021 45.1865 -0.229706 0.125699 45.9174 -0.394682 0.123419 46.6600 -0.592764 0.121619 47.4147 -0.838664 0.123035 48.1816 -1.17162 0.124468 48.9609 -1.74178 0.125918 49.4000 -2.66223 0.126731 49.6000 -2.72520 1.67475 49.7528 -2.31057 1.69596 50.5576 -1.77151 1.81096 51.3753 -1.62590 1.93377 52.2062 -1.56726 2.06490 53.0506 -1.54554 2.20492 53.9087 -1.54170 2.35444 54.7806 -1.54710 2.51410 55.6667 -1.55512 2.68459 56.5670 -1.56166 2.86663 57.4820 -1.56114 3.06103 58.4117 -1.54510 3.26859 59.3564 -1.49011 3.48238 60.3165 -1.43611 3.64316 61.2921 -1.39939 3.81136 62.2834 -1.36536 3.98732 63.2908 -1.32880 4.17141 64.3145 -1.28667 4.36400 65.3547 -1.23542 4.56548 66.4118 -1.16176 4.77626 67.4859 -1.06036 4.97750 68.5775 -0.964643 5.14266 69.6867 -0.881115 5.31329 70.8138 -0.800267 5.48959 71.9591 -0.723011 5.67174 73.1230 -0.649063 5.88066 74.3057 -0.551523 6.12027 75.5076 -0.385048 6.36964 76.7289 -0.190817 6.56452 77.9699 -0.134145E-01 6.73571 79.2310 0.162804 6.91135 80.5125 0.357263 7.09158 81.8147 0.569237 7.26009 83.1380 0.800413 7.41951 84.4827 1.06871 7.56137 85.8491 1.32247 7.62538 87.2377 1.54667 7.68993 88.6487 1.76303 7.75136 90.0825 1.97522 7.80845 91.5395 2.18356 7.85861 93.0201 2.38810 7.90391 94.5246 2.59042 7.94441 96.0535 2.79106 7.97987 97.6071 2.98884 8.00922 99.1858 3.18419 8.03453 100.790 3.37764 8.05500 102.420 3.56993 8.07185 104.077 3.75994 8.08214 105.760 3.94730 8.08897 107.471 4.13343 8.09198 109.209 4.31733 8.08993 110.975 4.49878 8.08436 112.770 4.67860 8.07520 114.594 4.85678 8.06173 116.448 5.03231 8.04380 118.331 5.20502 8.02275 120.245 5.37577 7.99874 122.190 5.54459 7.97099 124.166 5.71065 7.93965 126.175 5.87427 7.90585 128.215 6.03605 7.86914 130.289 6.19570 7.82887 132.397 6.35269 7.78561 134.538 6.50692 7.73949 136.714 6.65859 7.69090 138.925 6.80781 7.63976 141.172 6.95448 7.58619 143.456 7.09862 7.53029 145.776 7.24023 7.47213 148.134 7.37940 7.41176 150.530 7.51594 7.34912 152.964 7.64976 7.28448 155.439 7.78099 7.21797 157.953 7.90960 7.14950 160.507 8.03551 7.07932 163.103 8.15884 7.00745 165.742 8.27957 6.93394 168.422 8.39759 6.85870 171.146 8.51283 6.78202 173.915 8.62529 6.70394 176.727 8.73505 6.62468 179.586 8.84210 6.54414 182.491 8.94655 6.46261 185.442 9.04811 6.37969 188.442 9.14704 6.29627 191.489 9.24355 6.21157 194.587 9.33722 6.12593 197.734 9.42817 6.03952 200.932 9.51635 5.95227 204.182 9.60172 5.86444 207.485 9.68419 5.77596 210.840 9.76407 5.68749 214.251 9.84144 5.59833 217.716 9.91588 5.50887 221.237 9.98777 5.41942 224.816 10.0573 5.32966 228.452 10.1241 5.23957 232.147 10.1881 5.14959 235.902 10.2496 5.05976 239.717 10.3087 4.97009 243.595 10.3653 4.88051 247.535 10.4194 4.79106 251.538 10.4708 4.70203 255.607 10.5202 4.61364 259.741 10.5672 4.52525 263.942 10.6116 4.43749 268.211 10.6538 4.35040 272.549 10.6938 4.26396 276.957 10.7316 4.17818 281.437 10.7673 4.09312 285.989 10.8009 4.00888 290.615 10.8325 3.92543 295.315 10.8622 3.84289 300.092 10.8899 3.76097 304.945 10.9156 3.68008 309.878 10.9397 3.60052 314.890 10.9621 3.52132 319.983 10.9823 3.44358 325.158 11.0013 3.36695 330.418 11.0185 3.29090 335.762 11.0339 3.21632 341.192 11.0481 3.14293 346.711 11.0609 3.07051 352.319 11.0721 2.99906 358.017 11.0819 2.92891 363.808 11.0905 2.85991 369.692 11.0978 2.79206 375.672 11.1038 2.72528 381.748 11.1085 2.65960 387.922 11.1121 2.59553 394.197 11.1147 2.53231 400.573 11.1162 2.47064 407.052 11.1169 2.40995 413.635 11.1166 2.35039 420.326 11.1154 2.29197 427.124 11.1132 2.23451 434.032 11.1100 2.17832 441.052 11.1060 2.12336 448.186 11.1013 2.06943 455.435 11.0956 2.01670 462.802 11.0892 1.96521 470.287 11.0823 1.91498 477.894 11.0748 1.86558 485.623 11.0665 1.81746 493.478 11.0577 1.77036 501.459 11.0482 1.72415 509.570 11.0382 1.67908 517.812 11.0275 1.63494 526.187 11.0162 1.59213 534.698 11.0048 1.55011 543.346 10.9927 1.50875 552.134 10.9797 1.46845 561.065 10.9662 1.42970 570.139 10.9529 1.39167 579.361 10.9388 1.35382 588.732 10.9241 1.31794 598.254 10.9094 1.28214 607.930 10.8934 1.24710 617.763 10.8772 1.21386 627.755 10.8610 1.18073 637.908 10.8441 1.14872 648.226 10.8267 1.11698 658.711 10.8088 1.08685 669.365 10.7904 1.05629 680.191 10.7712 1.02794 691.193 10.7521 0.999157 702.372 10.7321 0.971770 713.733 10.7116 0.944684 725.277 10.6907 0.918818 737.008 10.6690 0.892689 748.928 10.6465 0.868305 761.042 10.6239 0.843442 773.351 10.5998 0.819702 785.859 10.5753 0.796849 798.570 10.5500 0.774110 811.486 10.5236 0.752512 824.611 10.4966 0.730864 837.949 10.4678 0.710001 851.502 10.4383 0.690546 865.274 10.4080 0.670220 879.269 10.3756 0.651105 893.491 10.3423 0.632241 907.943 10.3069 0.613651 922.628 10.2693 0.595822 937.551 10.2301 0.578832 952.715 10.1879 0.561041 968.124 10.1426 0.545052 983.783 10.0906 0.529008 999.695 10.0380 0.525262 1015.86 9.99147 0.510831 1032.29 9.93634 0.496893 1048.99 9.87582 0.483246 1065.96 9.80931 0.469879 1083.20 9.73584 0.456885 1100.72 9.65419 0.444252 1118.52 9.56260 0.431968 1136.61 9.45870 0.420021 1155. 9.33916 0.408405 1173.68 9.19918 0.397112 1192.66 9.03146 0.386127 1211.95 8.82413 0.375447 1231.55 8.55613 0.365066 1251.47 8.18440 0.355016 1271.72 7.59699 0.345289 1292.29 6.27650 0.335885 1302.90 0.193487 0.331189 1303.10 0.196396 4.46720 1313.19 6.34747 4.41667 1334.43 7.91579 4.31336 1356.01 8.66482 4.21247 1377.94 9.16725 4.11397 1400.23 9.54661 4.01774 1422.88 9.85105 3.92374 1445.89 10.1046 3.83197 1469.28 10.3212 3.74241 1493.04 10.5095 3.65503 1517.19 10.6755 3.56991 1541.73 10.8236 3.48680 1566.67 10.9567 3.40561 1592.01 11.0772 3.32632 1617.76 11.1869 3.24889 1643.92 11.2874 3.17328 1670.51 11.3800 3.09941 1697.53 11.4658 3.02727 1724.99 11.5464 2.95683 1752.89 11.6222 2.88462 1781.24 11.6909 2.81304 1810.05 11.7536 2.74243 1839.32 11.8109 2.67357 1869.07 11.8637 2.60642 1899.30 11.9124 2.54098 1930.02 11.9575 2.47719 1961.24 11.9995 2.41499 1992.96 12.0381 2.35432 2025.20 12.0748 2.29660 2057.95 12.1106 2.23733 2091.24 12.1426 2.17918 2125.06 12.1719 2.12232 2159.43 12.1989 2.06667 2194.36 12.2237 2.01221 2229.85 12.2465 1.95898 2265.92 12.2675 1.90689 2302.57 12.2866 1.85598 2339.81 12.3042 1.80623 2377.66 12.3201 1.75758 2416.11 12.3346 1.71015 2455.19 12.3479 1.66379 2494.90 12.3597 1.61844 2535.26 12.3704 1.57425 2576.26 12.3799 1.53110 2617.93 12.3884 1.48903 2660.27 12.3960 1.44797 2703.30 12.4026 1.40788 2747.03 12.4083 1.36879 2791.46 12.4133 1.33067 2836.61 12.4174 1.29350 2882.49 12.4208 1.25727 2929.11 12.4235 1.22195 2976.48 12.4256 1.18753 3024.63 12.4272 1.15400 3073.55 12.4281 1.12132 3123.26 12.4285 1.08948 3173.78 12.4285 1.05847 3225.11 12.4280 1.02828 3277.27 12.4271 0.998862 3330.28 12.4257 0.970228 3384.15 12.4240 0.942357 3438.88 12.4220 0.915219 3494.50 12.4196 0.888815 3551.02 12.4170 0.863111 3608.46 12.4141 0.838088 3666.82 12.4109 0.813743 3726.13 12.4075 0.790079 3786.40 12.4039 0.767030 3847.64 12.4001 0.744627 3909.87 12.3961 0.722839 3973.11 12.3919 0.701651 4037.38 12.3876 0.681040 4102.68 12.3832 0.660987 4169.03 12.3786 0.641500 4236.46 12.3740 0.622564 4304.98 12.3692 0.604156 4374.62 12.3644 0.586252 4445.37 12.3594 0.568843 4517.27 12.3544 0.551929 4590.33 12.3494 0.535513 4664.58 12.3443 0.519538 4740.03 12.3391 0.504023 4816.69 12.3340 0.488957 4894.60 12.3288 0.474312 4973.77 12.3236 0.460073 5054.21 12.3184 0.446257 5135.96 12.3131 0.432841 5219.03 12.3079 0.419788 5303.44 12.3027 0.407142 5389.22 12.2975 0.394823 5476.39 12.2923 0.382882 5564.97 12.2871 0.371283 5654.98 12.2820 0.360049 5746.44 12.2768 0.349097 5839.39 12.2718 0.338494 5933.83 12.2667 0.328186 6029.81 12.2617 0.318185 6127.33 12.2567 0.308475 6226.44 12.2518 0.299050 6327.15 12.2469 0.289903 6429.48 12.2420 0.281025 6533.48 12.2372 0.272409 6639.15 12.2325 0.264045 6746.54 12.2278 0.255930 6855.65 12.2231 0.248059 6966.54 12.2186 0.240419 7079.22 12.2140 0.233003 7193.72 12.2096 0.225810 7310.07 12.2051 0.218830 7428.31 12.2008 0.212064 7548.45 12.1965 0.205494 7670.54 12.1923 0.199123 7794.61 12.1881 0.192944 7920.68 12.1840 0.186949 8048.79 12.1799 0.181132 8178.98 12.1759 0.175491 8311.26 12.1720 0.170021 8445.69 12.1681 0.164716 8582.29 12.1643 0.159573 8721.11 12.1606 0.154583 8862.16 12.1569 0.149745 9005.50 12.1533 0.145051 9151.16 12.1497 0.140504 9299.17 12.1462 0.136089 9449.58 12.1428 0.131812 9602.42 12.1394 0.127666 9757.73 12.1361 0.123644 9915.55 12.1329 0.119748 10075.9 12.1297 0.115968 10238.9 12.1265 0.112305 10404.5 12.1234 0.108753 10572.8 12.1204 0.105310 10743.8 12.1175 0.101972 10917.6 12.1146 0.987374E-01 11094.2 12.1117 0.956017E-01 11273.6 12.1089 0.925624E-01 11455.9 12.1062 0.896166E-01 11641.2 12.1035 0.867616E-01 11829.5 12.1008 0.839945E-01 12020.8 12.0983 0.813128E-01 12215.3 12.0957 0.787139E-01 12412.8 12.0932 0.761954E-01 12613.6 12.0908 0.737547E-01 12817.6 12.0884 0.713897E-01 13025.0 12.0861 0.690979E-01 13235.6 12.0838 0.668773E-01 13449.7 12.0816 0.647256E-01 13667.2 12.0794 0.626407E-01 13888.3 12.0773 0.606208E-01 14112.9 12.0752 0.586636E-01 14341.2 12.0731 0.567674E-01 14573.1 12.0711 0.549303E-01 14808.9 12.0691 0.531506E-01 15048.4 12.0672 0.514265E-01 15291.8 12.0653 0.497562E-01 15539.1 12.0635 0.481382E-01 15790.4 12.0617 0.465708E-01 16045.8 12.0599 0.450526E-01 16305.4 12.0582 0.435819E-01 16569.1 12.0565 0.421575E-01 16837.1 12.0549 0.407777E-01 17109.4 12.0533 0.394413E-01 17386.1 12.0517 0.381470E-01 17667.4 12.0502 0.368933E-01 17953.1 12.0487 0.356792E-01 18243.5 12.0472 0.345034E-01 18538.6 12.0458 0.333647E-01 18838.4 12.0443 0.322619E-01 19143.1 12.0430 0.311940E-01 19452.7 12.0416 0.301599E-01 19767.4 12.0403 0.291585E-01 20087.1 12.0390 0.281917E-01 20412.0 12.0378 0.272533E-01 20742.1 12.0366 0.263454E-01 21077.6 12.0354 0.254671E-01 21418.5 12.0342 0.246174E-01 21765.0 12.0331 0.237953E-01 22117.0 12.0320 0.230000E-01 22474.7 12.0309 0.222307E-01 22838.2 12.0298 0.214865E-01 23207.6 12.0288 0.207665E-01 23583.0 12.0278 0.200701E-01 23964.4 12.0268 0.193964E-01 24352.0 12.0258 0.187448E-01 24745.9 12.0249 0.181145E-01 25146.2 12.0240 0.175048E-01 25552.9 12.0231 0.169151E-01 25966.2 12.0222 0.163447E-01 26386.1 12.0213 0.157930E-01 26812.9 12.0205 0.152594E-01 27246.6 12.0197 0.147434E-01 27687.3 12.0189 0.142443E-01 28135.1 12.0181 0.137616E-01 28590.2 12.0174 0.132949E-01 29052.6 12.0167 0.128435E-01 29522.5 12.0159 0.124069E-01 30000.0 12.0152 0.119848E-01 periodictable-1.5.0/periodictable/xsf/mn.nff000066400000000000000000000315041310514471200210370ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.88990 10.1617 -9999. 1.92644 10.3261 -9999. 1.96368 10.4931 -9999. 2.00165 10.6628 -9999. 2.04035 10.8353 -9999. 2.07980 11.0106 -9999. 2.12001 11.1886 -9999. 2.16100 11.3696 -9999. 2.20278 11.5535 -9999. 2.24537 11.7404 -9999. 2.28879 11.9303 -9999. 2.33304 12.1232 -9999. 2.37676 12.3193 -9999. 2.42130 12.5186 -9999. 2.46667 12.7210 -9999. 2.51289 12.9268 -9999. 2.55998 13.1359 -9999. 2.60796 13.3483 -9999. 2.65683 13.5642 -9999. 2.70662 13.7836 -9999. 2.75734 14.0066 -9999. 2.80901 14.2331 -9999. 2.86165 14.4633 -9999. 2.91527 14.6973 -9999. 2.96991 14.9350 -9999. 3.02556 15.1765 -9999. 3.08226 15.4220 -9999. 3.14002 15.6714 -9999. 3.19886 15.9249 -9999. 3.25880 16.1825 -9999. 3.31987 16.4442 -9999. 3.38209 16.7102 -9999. 3.44217 16.9805 -9999. 3.48884 17.2551 -9999. 3.53615 17.5342 -9999. 3.58409 17.8178 -9999. 3.63268 18.1060 -9999. 3.68194 18.3989 -9999. 3.73186 18.6964 -9999. 3.78246 18.9988 -9999. 3.83374 19.3061 -9999. 3.85544 19.6184 -9999. 3.87253 19.9357 -9999. 3.88970 20.2582 -9999. 3.90694 20.5858 -9999. 3.92427 20.9188 -9999. 3.94166 21.2571 -9999. 3.95914 21.6009 -9999. 3.97669 21.9503 -9999. 3.99432 22.3053 -9999. 4.01203 22.6661 -9999. 4.00030 23.0327 -9999. 3.97304 23.4053 -9999. 3.94596 23.7838 -9999. 3.91906 24.1685 -9999. 3.89235 24.5594 -9999. 3.86582 24.9566 -9999. 3.83947 25.3603 -9999. 3.81330 25.7705 -9999. 3.78323 26.1873 -9999. 3.72987 26.6109 -9999. 3.67726 27.0413 -9999. 3.62539 27.4786 -9999. 3.57425 27.9231 -9999. 3.52383 28.3747 -9999. 3.47413 28.8337 -9999. 3.42513 29.3000 6.50240 3.37693 29.7739 6.52171 3.32983 30.2555 6.53714 3.28339 30.7449 6.54862 3.23759 31.2421 6.55611 3.19243 31.7475 6.55952 3.14791 32.2609 6.55870 3.10400 32.7827 6.55342 3.06070 33.3130 6.54314 3.01801 33.8518 6.52639 2.97690 34.3993 6.50655 2.94108 34.9557 6.48445 2.90568 35.5211 6.45900 2.87072 36.0956 6.42978 2.83618 36.6794 6.39724 2.80205 37.2727 6.36467 2.76833 37.8755 6.32496 2.71646 38.4882 6.26729 2.66435 39.1107 6.19462 2.61324 39.7432 6.10733 2.56311 40.3861 6.00368 2.51394 41.0393 5.88056 2.46597 41.7031 5.73569 2.42140 42.3776 5.56396 2.37764 43.0630 5.35416 2.33467 43.7595 5.07923 2.30245 44.4673 4.77170 2.33906 45.1865 4.41786 2.37625 45.9174 3.93173 2.41403 46.6600 3.29552 2.74470 47.4147 2.77858 3.25644 48.1816 2.27583 3.86359 48.9609 1.63500 4.58393 49.7528 1.15257 6.20992 50.5576 2.00701 8.36740 51.3753 3.27730 8.94377 52.2062 4.50051 9.43837 53.0506 5.54117 9.46000 53.9087 6.51927 9.37570 54.7806 7.24311 9.05133 55.6667 7.77471 8.73819 56.5670 8.20129 8.43393 57.4820 8.54735 8.13930 58.4117 8.82762 7.85497 59.3564 9.04566 7.58057 60.3165 9.19693 7.35293 61.2921 9.35392 7.16484 62.2834 9.50102 6.98157 63.2908 9.63326 6.80299 64.3145 9.74965 6.62897 65.3547 9.84953 6.45940 66.4118 9.92971 6.29418 67.4859 9.99262 6.14892 68.5775 10.0529 6.01221 69.6867 10.1062 5.87852 70.8138 10.1490 5.74781 71.9591 10.1789 5.62000 73.1230 10.1882 5.49504 74.3057 10.1626 5.40548 75.5076 10.1630 5.34635 76.7289 10.1765 5.28786 77.9699 10.1918 5.23001 79.2310 10.2061 5.17280 80.5125 10.2159 5.11620 81.8147 10.2108 5.06786 83.1380 10.2151 5.03821 84.4827 10.2270 5.00872 85.8491 10.2406 4.97940 87.2377 10.2544 4.95026 88.6487 10.2672 4.92129 90.0825 10.2779 4.89248 91.5395 10.2851 4.86385 93.0201 10.2872 4.83538 94.5246 10.2798 4.80708 96.0535 10.2462 4.77895 97.6071 10.2127 4.80833 99.1858 10.2050 4.84354 100.790 10.2096 4.87899 102.420 10.2222 4.91472 104.077 10.2407 4.95070 105.760 10.2640 4.98695 107.471 10.2914 5.02345 109.209 10.3222 5.06023 110.975 10.3557 5.09728 112.770 10.3922 5.13662 114.594 10.4327 5.17671 116.448 10.4770 5.21712 118.331 10.5246 5.25785 120.245 10.5756 5.29889 122.190 10.6300 5.34025 124.166 10.6880 5.38194 126.175 10.7501 5.42395 128.215 10.8173 5.46629 130.289 10.8934 5.50660 132.397 10.9691 5.53684 134.538 11.0440 5.56727 136.714 11.1200 5.59785 138.925 11.1983 5.62860 141.172 11.2796 5.65952 143.456 11.3650 5.69061 145.776 11.4562 5.72187 148.134 11.5578 5.75331 150.530 11.6820 5.76483 152.964 11.7888 5.75371 155.439 11.8822 5.74262 157.953 11.9713 5.73156 160.507 12.0571 5.72051 163.103 12.1406 5.70948 165.742 12.2225 5.69848 168.422 12.3032 5.68750 171.146 12.3832 5.67653 173.915 12.4631 5.66559 176.727 12.5456 5.65301 179.586 12.6252 5.63644 182.491 12.7020 5.61993 185.442 12.7777 5.60345 188.442 12.8524 5.58703 191.489 12.9267 5.57066 194.587 13.0006 5.55434 197.734 13.0749 5.53806 200.932 13.1493 5.52017 204.182 13.2229 5.50172 207.485 13.2958 5.48333 210.840 13.3688 5.46500 214.251 13.4421 5.44674 217.716 13.5160 5.42853 221.237 13.5909 5.41039 224.816 13.6674 5.39230 228.452 13.7462 5.37429 232.147 13.8285 5.35632 235.902 13.9169 5.33842 239.717 14.0201 5.32057 243.595 14.1372 5.26706 247.535 14.2320 5.19443 251.538 14.3082 5.12280 255.607 14.3761 5.05216 259.741 14.4375 4.98249 263.942 14.4935 4.91378 268.211 14.5450 4.84602 272.549 14.5924 4.77920 276.957 14.6364 4.71329 281.437 14.6775 4.64830 285.989 14.7164 4.58420 290.615 14.7552 4.52098 295.315 14.7921 4.45086 300.092 14.8219 4.37922 304.945 14.8455 4.30873 309.878 14.8647 4.23938 314.890 14.8799 4.17114 319.983 14.8912 4.10400 325.158 14.8990 4.03795 330.418 14.9032 3.97296 335.762 14.9039 3.90901 341.192 14.9012 3.84609 346.711 14.8952 3.78419 352.319 14.8859 3.72328 358.017 14.8731 3.66298 363.808 14.8567 3.60350 369.692 14.8364 3.54499 375.672 14.8125 3.48742 381.748 14.7847 3.43080 387.922 14.7531 3.37508 394.197 14.7176 3.32028 400.573 14.6781 3.26636 407.052 14.6348 3.21332 413.635 14.5880 3.16114 420.326 14.5430 3.10587 427.124 14.4869 3.04259 434.032 14.4186 2.98059 441.052 14.3412 2.91986 448.186 14.2546 2.86037 455.435 14.1583 2.80209 462.802 14.0517 2.74500 470.287 13.9336 2.68907 477.894 13.8010 2.63428 485.623 13.6546 2.58600 493.478 13.4977 2.54166 501.459 13.3272 2.49807 509.570 13.1399 2.45524 517.812 12.9329 2.41314 526.187 12.7025 2.37176 534.698 12.4439 2.33115 543.346 12.1526 2.29292 552.134 11.8220 2.25534 561.065 11.4414 2.21646 570.139 10.9950 2.17739 579.361 10.4620 2.13934 588.732 9.81100 2.10212 598.254 8.98789 2.06565 607.930 7.89160 2.02981 617.763 6.29719 1.99460 627.755 3.50844 1.95999 637.908 -8.42761 1.92599 638.600 -18.0574 1.92371 638.800 -18.0426 16.5984 648.226 3.56736 16.3194 658.711 7.25819 16.0192 669.365 9.41955 15.7245 680.191 10.9601 15.4352 691.193 12.1550 15.1512 702.372 13.1261 14.8725 713.733 13.9327 14.5870 725.277 14.6093 14.2976 737.008 15.0046 13.9670 748.928 15.2444 13.9671 761.042 15.6958 14.2068 773.351 16.3817 14.4506 785.859 17.2721 14.3998 798.570 18.0296 14.1050 811.486 18.5918 13.7795 824.611 19.0745 13.4617 837.949 19.4896 13.1513 851.502 19.8572 12.8610 865.274 20.1883 12.5903 879.269 20.4999 12.3369 893.491 20.7973 12.0887 907.943 21.0774 11.8456 922.628 21.3469 11.6073 937.551 21.6002 11.3636 952.715 21.8356 11.1225 968.124 22.0546 10.8843 983.783 22.2591 10.6513 999.695 22.4516 10.4227 1015.86 22.6350 10.1985 1032.29 22.8080 9.97462 1048.99 22.9709 9.75224 1065.96 23.1213 9.53120 1083.20 23.2594 9.31505 1100.72 23.3881 9.10383 1118.52 23.5081 8.89743 1136.61 23.6204 8.69577 1155. 23.7256 8.49864 1173.68 23.8242 8.30594 1192.66 23.9168 8.11769 1211.95 24.0040 7.93370 1231.55 24.0872 7.75385 1251.47 24.1660 7.57626 1271.72 24.2403 7.40089 1292.29 24.3087 7.22735 1313.19 24.3709 7.05785 1334.43 24.4285 6.89231 1356.01 24.4820 6.73065 1377.94 24.5316 6.57273 1400.23 24.5777 6.41852 1422.88 24.6208 6.26798 1445.89 24.6616 6.12099 1469.28 24.7002 5.97676 1493.04 24.7380 5.83489 1517.19 24.7721 5.69216 1541.73 24.8012 5.55236 1566.67 24.8268 5.41601 1592.01 24.8496 5.28314 1617.76 24.8700 5.15347 1643.92 24.8881 5.02684 1670.51 24.9043 4.90343 1697.53 24.9191 4.78310 1724.99 24.9338 4.66575 1752.89 24.9470 4.54758 1781.24 24.9573 4.43117 1810.05 24.9644 4.31685 1839.32 24.9690 4.20548 1869.07 24.9715 4.09702 1899.30 24.9723 3.99146 1930.02 24.9718 3.88854 1961.24 24.9700 3.78823 1992.96 24.9662 3.69045 2025.20 24.9631 3.59707 2057.95 24.9596 3.50268 2091.24 24.9542 3.41037 2125.06 24.9471 3.32011 2159.43 24.9388 3.23221 2194.36 24.9296 3.14640 2229.85 24.9194 3.06252 2265.92 24.9081 2.98070 2302.57 24.8960 2.90088 2339.81 24.8831 2.82302 2377.66 24.8693 2.74705 2416.11 24.8548 2.67300 2455.19 24.8397 2.60077 2494.90 24.8238 2.53038 2535.26 24.8074 2.46175 2576.26 24.7903 2.39486 2617.93 24.7728 2.32969 2660.27 24.7547 2.26618 2703.30 24.7361 2.20433 2747.03 24.7170 2.14406 2791.46 24.6975 2.08536 2836.61 24.6776 2.02820 2882.49 24.6573 1.97256 2929.11 24.6366 1.91837 2976.48 24.6155 1.86562 3024.63 24.5941 1.81427 3073.55 24.5724 1.76427 3123.26 24.5503 1.71563 3173.78 24.5278 1.66829 3225.11 24.5050 1.62224 3277.27 24.4820 1.57744 3330.28 24.4585 1.53385 3384.15 24.4348 1.49147 3438.88 24.4107 1.45022 3494.50 24.3863 1.41011 3551.02 24.3616 1.37110 3608.46 24.3364 1.33316 3666.82 24.3109 1.29628 3726.13 24.2850 1.26044 3786.40 24.2586 1.22557 3847.64 24.2318 1.19169 3909.87 24.2045 1.15878 3973.11 24.1767 1.12676 4037.38 24.1483 1.09562 4102.68 24.1192 1.06540 4169.03 24.0895 1.03601 4236.46 24.0590 1.00747 4304.98 24.0278 0.979721 4374.62 23.9956 0.952745 4445.37 23.9624 0.926585 4517.27 23.9281 0.901138 4590.33 23.8925 0.876412 4664.58 23.8556 0.852412 4740.03 23.8171 0.829086 4816.69 23.7768 0.806453 4894.60 23.7345 0.784456 4973.77 23.6900 0.763123 5054.21 23.6428 0.742345 5135.96 23.5925 0.722213 5219.03 23.5388 0.702659 5303.44 23.4810 0.683674 5389.22 23.4182 0.665236 5476.39 23.3496 0.647339 5564.97 23.2739 0.629964 5654.98 23.1894 0.613093 5746.44 23.0938 0.596717 5839.39 22.9840 0.580824 5933.83 22.8551 0.565389 6029.81 22.6997 0.550414 6127.33 22.5053 0.535881 6226.44 22.2484 0.521775 6327.15 21.8761 0.508081 6429.48 21.2225 0.494788 6533.48 18.0825 0.481891 6538.90 13.7573 0.481234 6539.10 13.7578 3.87590 6639.15 21.3097 3.79170 6746.54 22.1537 3.70472 6855.65 22.6533 3.61897 6966.54 23.0114 3.53438 7079.22 23.2908 3.45107 7193.72 23.5195 3.36899 7310.07 23.7123 3.28831 7428.31 23.8785 3.20892 7548.45 24.0236 3.13076 7670.54 24.1519 3.05404 7794.61 24.2663 2.97871 7920.68 24.3690 2.90471 8048.79 24.4617 2.83205 8178.98 24.5456 2.76082 8311.26 24.6219 2.69094 8445.69 24.6915 2.62248 8582.29 24.7550 2.55531 8721.11 24.8132 2.48948 8862.16 24.8664 2.42505 9005.50 24.9152 2.36203 9151.16 24.9600 2.30031 9299.17 25.0011 2.23986 9449.58 25.0389 2.18076 9602.42 25.0735 2.12295 9757.73 25.1052 2.06653 9915.55 25.1344 2.01123 10075.9 25.1611 1.95725 10238.9 25.1855 1.90452 10404.5 25.2078 1.85300 10572.8 25.2281 1.80269 10743.8 25.2466 1.75357 10917.6 25.2634 1.70562 11094.2 25.2786 1.65882 11273.6 25.2924 1.61315 11455.9 25.3048 1.56859 11641.2 25.3158 1.52512 11829.5 25.3257 1.48273 12020.8 25.3345 1.44138 12215.3 25.3422 1.40108 12412.8 25.3489 1.36178 12613.6 25.3547 1.32349 12817.6 25.3597 1.28616 13025.0 25.3638 1.24980 13235.6 25.3672 1.21436 13449.7 25.3699 1.17985 13667.2 25.3719 1.14623 13888.3 25.3734 1.11349 14112.9 25.3742 1.08161 14341.2 25.3746 1.05057 14573.1 25.3744 1.02036 14808.9 25.3738 0.990942 15048.4 25.3728 0.962313 15291.8 25.3713 0.934454 15539.1 25.3695 0.907344 15790.4 25.3674 0.880966 16045.8 25.3649 0.855305 16305.4 25.3622 0.830341 16569.1 25.3591 0.806060 16837.1 25.3559 0.782444 17109.4 25.3524 0.759478 17386.1 25.3486 0.737146 17667.4 25.3447 0.715431 17953.1 25.3407 0.694320 18243.5 25.3364 0.673796 18538.6 25.3321 0.653846 18838.4 25.3276 0.634455 19143.1 25.3229 0.615608 19452.7 25.3182 0.597292 19767.4 25.3134 0.579493 20087.1 25.3085 0.562198 20412.0 25.3036 0.545393 20742.1 25.2985 0.529067 21077.6 25.2935 0.513206 21418.5 25.2883 0.497799 21765.0 25.2832 0.482833 22117.0 25.2780 0.468296 22474.7 25.2728 0.454179 22838.2 25.2676 0.440468 23207.6 25.2624 0.427153 23583.0 25.2572 0.414224 23964.4 25.2520 0.401670 24352.0 25.2468 0.389481 24745.9 25.2416 0.377647 25146.2 25.2364 0.366158 25552.9 25.2313 0.355006 25966.2 25.2262 0.344180 26386.1 25.2211 0.333671 26812.9 25.2160 0.323471 27246.6 25.2110 0.313572 27687.3 25.2060 0.303965 28135.1 25.2011 0.294641 28590.2 25.1962 0.285593 29052.6 25.1915 0.276814 29522.5 25.1875 0.268295 30000.0 25.1795 0.260029 periodictable-1.5.0/periodictable/xsf/mo.nff000066400000000000000000000560761310514471200210530ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.23820 10.1447 -9999. 2.20464 10.3088 -9999. 2.17288 10.4756 -9999. 2.14408 10.6450 -9999. 2.11566 10.8172 -9999. 2.09307 10.9921 -9999. 2.12057 11.1699 -9999. 2.20711 11.3506 -9999. 2.32651 11.5342 -9999. 2.50051 11.7207 -9999. 2.70468 11.9103 -9999. 2.90608 12.1029 -9999. 3.10741 12.2987 -9999. 3.30207 12.4976 -9999. 3.47987 12.6997 -9999. 3.65905 12.9052 -9999. 3.83170 13.1139 -9999. 3.99671 13.2000 -9999. 4.06604 13.4000 -9999. 4.14903 13.6167 -9999. 4.28511 13.8000 -9999. 4.40189 14.0000 -9999. 4.48484 14.2000 -9999. 4.61366 14.4000 -9999. 4.68521 14.6000 -9999. 4.78024 14.8361 -9999. 4.92749 15.0761 -9999. 5.08904 15.3200 -9999. 5.27782 15.4000 -9999. 5.34063 15.6000 -9999. 5.57004 15.8000 -9999. 5.76754 16.0556 -9999. 6.10461 16.3152 -9999. 6.46138 16.5791 -9999. 6.83899 16.8473 -9999. 7.15482 17.1198 -9999. 7.47780 17.3967 -9999. 7.81536 17.4000 -9999. 7.81949 17.6000 -9999. 8.00166 17.8847 -9999. 8.15603 18.1739 -9999. 8.31339 18.4000 -9999. 8.43669 18.6000 -9999. 8.46479 18.9008 -9999. 8.37323 19.0000 -9999. 8.34358 19.2000 5.20954 8.31758 19.5105 5.55318 8.20842 19.8261 5.83296 8.10068 20.1468 6.08563 7.99436 20.4726 6.32197 7.88943 20.8038 6.54462 7.78587 21.1403 6.75545 7.68369 21.4822 6.94723 7.59194 21.8000 7.13155 7.53526 22.0000 7.28720 7.51410 22.3558 7.54382 7.40221 22.7174 7.82790 7.26913 23.0000 8.04828 7.13196 23.2000 8.20198 7.01413 23.5752 8.43173 6.72563 23.8000 8.56012 6.56063 24.0000 8.63892 6.40783 24.3882 8.76673 6.04135 24.4000 8.78171 6.03061 24.6000 8.78027 5.88373 24.9979 8.78793 5.56663 25.0000 8.79451 5.56501 25.4000 8.78192 5.36448 25.8108 8.80884 5.10496 26.2283 8.78624 4.85800 26.6525 8.74684 4.62299 27.0836 8.69546 4.39935 27.5217 8.64475 4.15808 27.9668 8.54570 3.90057 28.4191 8.40811 3.65900 28.8788 8.23954 3.43240 29.3459 8.04072 3.21983 29.8205 7.80668 3.02042 30.3028 7.51286 2.83337 30.7930 7.19169 2.75214 31.2910 6.89336 2.68998 31.7971 6.56777 2.62922 32.3114 6.20519 2.64651 32.8340 5.88145 2.70805 33.3651 5.55201 2.77103 33.9048 5.19658 2.88268 34.4531 4.87012 3.02580 35.0104 4.54167 3.17602 35.5766 4.18396 3.33370 36.1521 3.74406 3.52307 36.7368 3.29256 3.85938 37.3310 2.88452 4.22779 37.9348 2.41946 4.63138 38.5484 1.90217 5.07349 39.1718 1.13881 5.83319 39.8054 0.839567 7.10494 40.4492 0.906210 8.57420 41.1035 1.21934 9.55601 41.7683 1.69776 10.6502 42.4439 2.33239 11.5398 43.1304 3.23612 12.4914 43.8279 4.28586 12.8588 44.5368 5.06363 13.1002 45.2572 5.77948 13.3462 45.9892 6.48792 13.5968 46.7330 7.19499 13.7169 47.4889 7.87006 13.7968 48.2570 8.46744 13.8772 49.0375 9.03299 13.9580 49.8306 9.61040 14.0873 50.6366 10.2425 14.2381 51.4556 11.0167 14.3904 52.2879 11.8614 14.5444 53.1336 12.7958 14.3024 53.9930 13.6213 14.0002 54.8663 14.3710 13.6925 55.7537 15.0518 13.2537 56.6555 15.7585 12.8290 57.5718 16.4484 12.4179 58.5030 17.0968 11.7007 59.4492 17.5301 10.8716 60.4108 17.5934 10.1012 60.5000 17.5035 10.0331 60.7500 17.7292 10.4822 61.0000 18.2686 10.1299 61.2500 18.1376 9.26469 61.5000 17.8324 9.49797 61.7500 18.1266 9.64907 62.0000 18.2153 8.98189 62.2500 17.9890 8.94557 62.5000 18.0257 9.13384 62.7500 18.4266 9.12316 63.0000 18.4777 8.47376 63.2500 18.3478 8.36029 63.5000 18.2808 8.40188 63.7500 18.4281 8.19366 64.0000 18.5036 8.22930 64.2500 18.2522 7.44827 64.5000 18.3596 8.52242 64.7500 18.8347 7.64205 65.0000 18.6546 7.30402 65.2500 18.5000 7.22291 65.5000 18.4072 7.09348 65.7500 18.4753 7.25067 65.9990 18.5795 6.97852 66.2500 18.5986 6.89767 66.7500 18.6938 6.66086 67.5000 18.6816 6.07085 67.7500 18.7209 6.01022 68.0000 18.7338 5.77271 68.5000 18.6469 5.49419 68.7500 18.6046 5.28664 69.0000 18.5224 5.14681 69.2500 18.4643 5.08478 69.5000 18.4138 4.89222 69.7500 18.3206 4.84541 70.0000 18.2620 4.73206 70.2500 18.2365 4.72830 70.5000 18.2674 4.59901 70.7500 18.2076 4.41675 71.0000 18.1556 4.35222 71.2500 18.0556 4.17081 71.5000 17.9327 4.11991 71.7500 17.8709 4.13939 72.0000 17.8754 4.04662 72.2500 17.8281 3.97945 72.5000 17.7803 3.86676 72.7500 17.7055 3.85273 73.2500 17.6603 3.67929 73.5000 17.5895 3.65415 73.7500 17.5756 3.58906 74.0000 17.5169 3.50218 74.2500 17.4635 3.45713 74.5000 17.4253 3.44584 75.0000 17.3677 3.28343 76.0000 17.2560 3.03419 77.0000 17.1062 2.77284 77.2500 17.0580 2.70452 77.5000 17.0210 2.65231 78.5000 16.8174 2.41878 78.7500 16.7797 2.37190 79.5000 16.6212 2.21214 80.0000 16.5228 2.12372 81.0000 16.3054 1.95986 81.7500 16.1571 1.86056 82.0000 16.0996 1.82112 82.2500 16.0573 1.79805 82.7500 15.9490 1.73947 84.0884 15.6862 1.61784 84.2500 15.6731 1.60386 85.0000 15.5629 1.55302 85.2500 15.5038 1.50288 86.0000 15.3621 1.46390 86.5000 15.2824 1.43164 86.7500 15.2317 1.42941 87.0000 15.2038 1.41247 87.2500 15.1578 1.40706 87.5000 15.1129 1.38653 88.9152 14.9180 1.33199 89.2500 14.8743 1.31953 90.0010 14.7729 1.28227 91.0010 14.6330 1.24929 91.2500 14.6058 1.24483 91.5000 14.5715 1.23497 91.7500 14.5459 1.23131 92.2500 14.4792 1.20965 92.5000 14.4526 1.20519 92.7500 14.4185 1.19436 93.2500 14.3567 1.18143 93.7500 14.2939 1.17389 94.0000 14.2675 1.16530 94.2500 14.2329 1.16232 95.0000 14.1473 1.14332 95.5000 14.0853 1.14146 96.0000 14.0276 1.13176 97.0000 13.9105 1.12572 97.2500 13.8869 1.12807 97.7500 13.8336 1.12304 99.3310 13.6664 1.12836 99.5000 13.6501 1.12892 100.000 13.6008 1.12422 101.000 13.5073 1.15054 101.500 13.4642 1.14034 102.000 13.4137 1.14310 102.500 13.3678 1.16962 103.000 13.3340 1.16396 103.500 13.2949 1.18771 104.000 13.2659 1.17972 104.500 13.2191 1.18491 105.000 13.1842 1.19752 105.500 13.1439 1.20176 106.000 13.1094 1.21224 106.500 13.0772 1.22801 107.000 13.0502 1.22468 107.500 13.0148 1.23528 108.000 12.9785 1.23181 108.500 12.9430 1.25392 109.000 12.9208 1.26327 109.500 12.8959 1.26128 111.271 12.7793 1.28224 111.500 12.7662 1.28495 112.000 12.7362 1.28415 112.500 12.7074 1.29673 113.500 12.6366 1.31002 114.000 12.6121 1.32977 114.500 12.5839 1.33200 115.500 12.5292 1.36794 116.000 12.5092 1.37159 116.500 12.4882 1.38204 117.000 12.4604 1.38587 118.000 12.4148 1.41934 118.500 12.3923 1.41969 119.000 12.3743 1.43620 119.500 12.3491 1.44510 120.000 12.3459 1.46173 121.500 12.3049 1.46901 122.000 12.2813 1.45494 123.000 12.2215 1.46036 124.000 12.1743 1.47359 125.000 12.1186 1.49514 126.000 12.0742 1.50402 128.000 12.0244 1.57421 129.000 11.9850 1.54527 130.000 11.9253 1.56134 131.000 11.8877 1.59716 132.000 11.8578 1.60038 134.000 11.7785 1.62488 135.000 11.7325 1.62290 136.000 11.6977 1.65645 138.000 11.5999 1.67539 139.000 11.5740 1.71228 140.000 11.5454 1.72262 141.000 11.4971 1.70564 142.000 11.4468 1.76297 143.000 11.4225 1.76841 144.000 11.3836 1.80146 146.000 11.3231 1.81816 147.000 11.2794 1.85414 148.000 11.2535 1.87819 149.000 11.2270 1.88871 151.000 11.1628 1.93743 152.000 11.1430 1.94694 153.000 11.1170 1.96760 154.000 11.0945 1.97101 156.000 11.0431 2.00330 158.523 10.9720 2.01755 160.000 10.9268 2.02584 161.000 10.8926 2.02529 162.000 10.8530 2.04178 163.000 10.8308 2.03621 165.636 10.7180 2.06109 167.000 10.6599 2.07392 168.000 10.6246 2.06447 169.000 10.5839 2.10381 170.000 10.5598 2.09633 172.000 10.4756 2.12064 173.000 10.4475 2.11404 175.000 10.3556 2.13189 176.000 10.3220 2.11976 178.847 10.1719 2.16600 179.000 10.1683 2.16850 181.000 10.0698 2.15687 182.000 10.0188 2.18161 183.000 9.96933 2.18829 184.000 9.92972 2.21208 185.000 9.88437 2.19724 186.000 9.80975 2.19402 187.000 9.72246 2.21310 188.000 9.68785 2.29181 190.000 9.61924 2.32368 191.000 9.58679 2.33252 192.000 9.54296 2.32884 193.000 9.50024 2.33938 195.000 9.39084 2.33286 197.000 9.27785 2.35548 200.000 9.08200 2.36960 201.000 9.04361 2.39941 203.000 8.90831 2.38219 204.000 8.84821 2.40118 205.000 8.77592 2.39285 206.000 8.72659 2.40659 209.332 8.45788 2.42222 212.000 8.24425 2.43463 215.000 7.98959 2.46663 216.000 7.89337 2.45939 218.000 7.69638 2.48544 220.000 7.49359 2.48963 222.000 7.27084 2.51004 223.000 7.14371 2.50513 225.000 6.86336 2.51774 226.000 6.70448 2.53945 227.000 6.48180 2.53091 228.000 6.35222 2.75666 229.000 6.27253 2.73945 230.000 6.10332 2.74607 231.000 5.95109 2.87667 232.000 5.85930 2.92282 233.000 5.71690 2.94456 234.000 5.57309 3.00377 235.000 5.42136 3.04436 236.000 5.25930 3.06937 237.000 5.04452 3.10966 240.000 4.37525 3.45913 241.000 4.20557 3.66680 242.000 4.06726 3.79756 243.000 3.90798 3.96827 244.000 3.79931 4.16674 245.000 3.76288 4.33353 246.000 3.53058 4.34746 249.979 2.85098 4.68637 251.000 2.58414 4.77662 253.000 2.06339 5.17262 255.000 1.53475 5.67817 258.000 0.849635 6.69429 260.000 0.521002 7.52395 262.000 0.327261 8.37932 263.000 0.268510 8.88382 266.000 0.505738 10.2424 267.000 0.655385 10.6584 269.000 0.949757 11.2767 273.351 1.76660 12.4461 274.000 1.89238 12.6289 276.000 2.34601 13.0767 278.000 2.78244 13.3229 281.000 3.24424 13.5314 283.000 3.44170 13.7116 287.577 3.80396 14.2016 292.229 4.13615 14.7091 295.000 4.26561 15.0160 299.000 4.47204 15.6246 300.000 4.57044 15.6755 301.000 4.62717 15.9323 303.000 4.65400 16.1742 304.000 4.84355 16.5721 305.000 5.02916 16.5000 307.000 5.11596 16.9365 309.000 5.33858 17.2674 310.000 5.56797 17.4915 314.000 6.24439 17.9964 319.000 7.15040 18.4059 323.000 7.91010 18.6190 324.000 8.00512 18.5510 327.000 8.35758 18.5476 331.000 8.66712 18.5783 335.000 8.88587 18.7654 336.000 8.99214 18.8612 338.000 9.18687 18.9689 343.000 9.71865 19.1728 344.000 9.84114 19.1283 349.564 10.0345 19.3149 350.000 10.1391 19.3295 354.000 10.4157 19.5730 359.726 10.9288 19.6365 363.000 11.1180 19.6725 367.000 11.2489 19.8500 370.000 11.4698 19.9127 370.750 11.3516 19.6817 371.010 11.4256 19.8080 371.500 11.3382 19.8121 371.750 11.4461 19.8704 372.250 11.3854 19.7893 372.750 11.3917 19.7811 373.500 11.2591 19.8950 375.250 11.3698 19.9540 376.000 11.2288 20.0178 376.250 11.3151 19.9865 376.500 11.1075 20.0771 378.510 11.3493 20.2438 378.750 11.1473 20.3335 379.500 11.2675 20.2803 379.740 11.0661 20.4178 380.250 11.1908 20.4314 380.490 11.0413 20.5787 380.990 10.9673 20.5545 383.000 11.2083 20.8306 383.500 11.1750 20.7468 383.760 10.9695 20.9026 386.000 11.2678 21.0774 386.500 11.0259 21.1276 386.740 11.0511 21.2518 387.750 10.8746 21.3268 388.250 10.7937 21.4446 388.750 10.6580 21.4598 389.500 10.3974 21.7481 390.000 10.2224 21.8427 391.250 9.49670 22.6379 391.750 9.19170 23.1876 392.250 8.93474 23.9613 392.750 8.75505 24.9822 393.000 8.86048 25.7464 393.250 9.07352 26.4119 393.490 9.53752 27.2561 393.750 10.2797 27.8810 393.990 11.0990 28.2816 394.260 12.0065 28.4996 394.500 12.8543 28.5772 394.750 13.7004 28.4991 395.250 15.2607 27.7574 395.500 15.7808 27.2312 395.760 16.0475 26.5823 396.750 16.4384 24.8287 397.000 16.5086 24.5620 397.250 16.4678 24.1553 397.750 16.3678 23.6733 399.000 15.7643 22.9672 400.260 15.2997 22.6893 401.490 14.8646 22.7178 401.760 14.8742 22.8054 402.250 14.7633 22.8388 402.740 14.7104 22.9924 403.250 14.6573 23.1447 403.500 14.7245 23.2805 403.750 14.7302 23.3142 404.000 14.8888 23.4613 404.750 15.2009 23.5612 405.000 15.2800 23.4695 405.500 15.3592 23.4172 406.250 15.4784 23.3021 406.500 15.4339 23.3331 407.500 15.5118 23.1313 408.500 15.2802 23.0968 409.260 15.1054 23.3282 409.510 15.0328 23.3322 410.260 14.9135 24.0232 411.260 15.6923 25.2454 411.770 16.5296 25.3650 412.490 17.4799 24.9184 412.990 17.9989 24.4975 413.250 18.1358 24.1436 414.500 18.1087 23.1175 414.750 18.0748 23.0530 415.000 17.8969 22.8142 416.750 17.5739 22.2709 417.740 17.4000 22.2505 418.000 17.4000 22.1681 419.750 16.9477 22.2657 420.000 16.9069 22.3594 420.500 16.9217 22.3668 420.750 16.9639 22.6746 421.000 16.9407 22.4645 421.500 17.0536 22.6295 422.750 17.4223 22.6417 423.000 17.4238 22.4670 423.250 17.4004 22.5710 423.500 17.4277 22.4887 424.000 17.4798 22.5762 424.500 17.4433 22.4228 424.750 17.5516 22.5387 425.010 17.5889 22.4013 425.750 17.6030 22.2840 427.000 17.5730 22.3270 427.250 17.4421 22.2554 429.250 17.3136 22.3439 429.500 17.4238 22.4117 430.260 17.4152 22.4161 431.500 17.4743 22.4748 431.750 17.4426 22.4494 432.000 17.4802 22.5176 432.250 17.3989 22.4695 432.500 17.5354 22.6994 432.750 17.5645 22.5192 433.000 17.7261 22.4917 434.250 17.5267 22.6457 435.000 17.6020 22.6283 435.250 17.4814 22.7386 436.000 17.5626 22.7439 437.500 17.7647 22.9279 437.750 17.6928 22.8802 439.250 17.7848 23.1869 445.000 18.9619 23.6101 448.000 19.5261 23.5752 449.000 19.7144 23.5173 450.000 20.0331 23.6487 451.000 20.1448 23.1902 453.000 20.4573 23.0596 454.000 20.5896 22.8879 455.000 20.5087 22.5607 456.000 20.5586 22.7236 458.000 20.6527 22.6792 460.000 20.8335 22.4982 461.000 20.9196 22.5345 462.000 20.8481 22.3737 467.000 21.0834 22.0015 468.000 21.1637 22.0070 469.000 21.0487 21.8466 470.000 21.0840 22.1161 471.000 21.3395 22.1599 472.000 21.2460 21.7722 475.000 21.4243 21.7492 476.000 21.2596 21.6441 478.000 21.2229 21.7667 479.000 21.3836 22.0842 480.000 21.7389 21.7527 484.000 21.3354 21.6603 485.000 21.4065 21.5557 486.000 21.5577 22.0567 487.000 21.7189 21.5591 488.000 21.6858 21.8482 489.000 21.7875 21.6097 490.000 21.9400 21.7143 493.000 21.8289 21.4763 496.000 21.7731 21.6375 497.000 21.7953 21.6120 498.000 21.8504 21.6793 499.000 21.8056 21.6512 501.000 21.8116 21.8728 502.000 21.9441 22.0572 503.000 22.0512 21.8156 504.000 21.9656 22.0221 505.000 22.1703 22.0888 506.000 22.2066 22.0449 507.000 22.1112 21.8619 508.000 22.1045 22.3984 509.000 22.3633 22.2360 510.000 22.4267 22.4006 511.000 22.5218 22.3023 513.000 22.5547 22.3475 515.000 22.6391 22.5697 516.000 22.8437 22.9394 517.000 23.1527 22.6833 518.000 23.1722 22.7520 519.000 23.2851 22.7036 521.000 23.7379 22.9384 522.000 23.7485 22.5718 523.000 23.8158 22.8523 524.000 23.9382 22.6965 525.000 23.9950 22.7614 526.000 24.1951 22.9786 527.000 24.3825 22.7099 528.000 24.6848 23.0106 529.000 24.7589 22.2907 530.000 24.4342 22.4065 531.000 24.7047 22.9888 532.000 25.1194 22.6245 533.000 25.3965 22.5419 534.000 25.3568 22.1008 535.000 25.0291 21.8848 536.000 25.3340 22.9132 537.000 25.8244 21.9605 538.000 25.6353 21.8652 539.000 25.4762 21.6171 540.000 25.4161 21.9564 541.000 25.5275 21.8132 542.000 25.7506 22.1452 543.010 26.1033 21.7086 544.000 26.2364 21.5559 545.000 25.7176 20.5629 546.000 26.3475 21.6065 549.000 26.2056 21.4023 550.000 26.1179 20.9610 551.000 25.8764 21.2390 554.000 26.5224 20.9745 555.000 26.1842 20.6909 556.000 26.1415 20.7764 557.000 26.1140 21.0550 558.000 26.3050 20.5763 559.000 26.0379 20.8668 560.000 26.0171 20.5696 562.000 26.1676 21.1556 562.990 26.3207 20.8232 564.000 26.2724 21.1332 565.000 26.5669 20.8293 566.000 26.3858 20.8519 567.000 26.5143 20.7440 569.010 26.2225 20.7968 570.000 26.4698 20.8888 572.000 26.3607 21.2869 580.000 27.8004 20.0625 582.000 27.2970 20.1370 584.000 27.0994 19.8560 586.000 26.8593 20.1404 589.990 26.9268 20.4121 599.533 27.7729 20.5036 600.000 27.8063 20.5081 602.000 27.8083 20.3636 604.000 27.9122 20.4230 610.000 28.3558 20.2740 612.000 28.4561 20.1466 614.000 28.5508 20.1158 620.000 28.7462 19.8317 630.010 28.9959 19.6391 640.000 29.3335 19.4223 648.000 29.5941 19.2809 652.000 29.7534 19.1561 656.000 29.8586 19.1121 657.990 29.9756 19.0081 662.000 30.0292 18.9700 664.000 30.1725 18.8819 674.740 30.3659 18.7183 684.000 30.6818 18.5804 694.000 31.1216 18.3790 702.000 31.5017 18.1283 703.990 31.5075 18.0031 710.000 31.5938 17.8055 712.000 31.7313 17.8329 714.000 31.8038 17.6779 722.000 31.7977 17.4101 724.000 31.8189 17.4732 728.010 31.7782 17.3160 739.785 32.1962 17.0953 744.000 32.2852 17.0178 748.000 32.3586 16.9561 750.000 32.4267 16.9551 758.000 32.6602 16.7376 768.000 32.9224 16.4707 770.000 32.9728 16.4692 772.000 33.1045 16.3664 774.000 33.1149 16.3366 776.000 33.3038 16.1628 788.551 33.1497 15.8333 801.305 33.2778 15.5105 802.000 33.2851 15.4933 806.000 33.3566 15.4087 815.990 33.4467 15.3219 829.188 33.6977 15.0785 830.010 33.7753 15.0636 832.000 33.7563 15.0663 834.010 33.8598 14.9730 836.000 33.8322 14.9468 838.000 33.9073 14.8540 840.000 33.8254 14.8614 853.586 34.1761 14.5460 862.000 34.3185 14.3564 871.990 34.4123 14.0749 878.000 34.4113 13.9611 880.000 34.4381 13.9046 882.000 34.4094 13.9121 888.000 34.4865 13.7253 896.000 34.5671 13.6432 897.990 34.5753 13.5638 899.990 34.5542 13.5810 904.000 34.6758 13.4919 906.000 34.6621 13.4643 907.990 34.6577 13.3575 916.000 34.7220 13.2798 918.000 34.7390 13.2132 920.010 34.7284 13.2203 922.000 34.7648 13.1541 924.000 34.8015 13.2271 926.000 34.8841 13.0496 928.010 34.8136 13.0382 943.020 34.9850 12.7263 958.272 35.0337 12.4218 973.772 35.0353 12.1651 989.522 35.0575 12.0039 1005.53 35.1742 11.8198 1021.79 35.2741 11.5762 1038.32 35.3513 11.3376 1055.11 35.4177 11.1038 1072.18 35.4762 10.8749 1089.52 35.5284 10.6508 1107.14 35.5749 10.4312 1125.05 35.6164 10.2161 1143.24 35.6531 10.0055 1161.73 35.6855 9.79928 1180.52 35.7139 9.59728 1199.62 35.7386 9.39943 1219.02 35.7598 9.20566 1238.74 35.7788 9.01589 1258.77 35.7981 8.83002 1279.13 35.8134 8.64029 1299.82 35.8208 8.45265 1320.85 35.8224 8.26907 1342.21 35.8192 8.08949 1363.92 35.8116 7.91380 1385.98 35.7999 7.74193 1408.40 35.7844 7.57379 1431.18 35.7650 7.40931 1454.32 35.7421 7.24839 1477.85 35.7157 7.09097 1501.75 35.6858 6.93697 1526.04 35.6552 6.78632 1550.72 35.6214 6.63329 1575.80 35.5811 6.48153 1601.29 35.5323 6.33325 1627.19 35.4785 6.18836 1653.51 35.4193 6.04679 1680.25 35.3546 5.90844 1707.43 35.2843 5.77327 1735.05 35.2081 5.64119 1763.11 35.1257 5.51213 1791.63 35.0367 5.38602 1820.60 34.9408 5.26280 1850.05 34.8373 5.14240 1879.97 34.7256 5.02475 1910.38 34.6051 4.90979 1941.28 34.4754 4.79747 1972.68 34.3341 4.68573 2004.58 34.1794 4.57558 2037.01 34.0091 4.46803 2069.95 33.8212 4.36299 2103.43 33.6132 4.26044 2137.46 33.3815 4.16029 2172.03 33.1216 4.06249 2207.16 32.8270 3.96699 2242.86 32.4891 3.87374 2279.13 32.0953 3.78268 2316. 31.6267 3.69376 2353.46 31.0529 3.60694 2391.52 30.3197 3.52215 2430.20 29.3147 3.43935 2469.51 27.7297 3.35851 2493. 26.0567 3.31169 2520.10 11.7655 3.25903 2520.30 11.7660 11.2040 2526. 22.0106 11.1674 2566.86 26.8215 10.9111 2592. 27.2955 10.7583 2625. 21.0984 10.5632 2625.20 21.1046 14.4992 2626. 23.8802 14.4931 2668.47 29.6895 14.1719 2711.63 31.2204 13.8578 2755.49 32.2005 13.5507 2800.06 32.8335 13.2504 2839. 33.0038 12.9972 2865.40 30.3063 12.8302 2865.60 30.3097 14.5823 2876. 33.0633 14.5069 2922.52 34.6194 14.1777 2969.79 35.4837 13.8559 3017.82 36.1595 13.5414 3066.63 36.7285 13.2341 3116.23 37.2237 12.9337 3166.63 37.6632 12.6402 3217.85 38.0588 12.3533 3269.90 38.4199 12.0729 3322.79 38.7534 11.7969 3376.53 39.0586 11.5112 3431.14 39.3346 11.2324 3486.64 39.5820 10.9604 3543.03 39.8093 10.6950 3600.34 40.0181 10.4360 3658.57 40.2105 10.1832 3717.74 40.3884 9.93663 3777.88 40.5532 9.69597 3838.98 40.7074 9.46115 3901.07 40.8546 9.23203 3964.17 40.9913 9.00145 4028.29 41.1149 8.77184 4093.44 41.2262 8.54808 4159.65 41.3274 8.33001 4226.93 41.4199 8.11752 4295.29 41.5045 7.91045 4364.77 41.5819 7.70867 4435.36 41.6528 7.51203 4507.10 41.7177 7.32039 4580. 41.7772 7.13365 4654.08 41.8317 6.95168 4729.35 41.8832 6.77435 4805.85 41.9312 6.60155 4883.58 41.9752 6.42872 4962.57 42.0137 6.25797 5042.83 42.0462 6.09175 5124.40 42.0743 5.92995 5207.28 42.0983 5.77245 5291.50 42.1188 5.61913 5377.09 42.1361 5.46987 5464.06 42.1504 5.32459 5552.44 42.1621 5.18316 5642.24 42.1712 5.04550 5733.50 42.1781 4.91149 5826.24 42.1829 4.78102 5920.47 42.1858 4.65404 6016.23 42.1870 4.53042 6113.54 42.1870 4.41009 6212.42 42.1859 4.29296 6312.90 42.1843 4.17736 6415.01 42.1800 4.06303 6518.76 42.1733 3.95183 6624.20 42.1648 3.84368 6731.34 42.1548 3.73849 6840.21 42.1434 3.63618 6950.85 42.1308 3.53667 7063.27 42.1171 3.43987 7177.52 42.1024 3.34573 7293.61 42.0868 3.25417 7411.57 42.0703 3.16511 7531.45 42.0531 3.07849 7653.27 42.0352 2.99424 7777.05 42.0166 2.91229 7902.84 41.9974 2.83259 8030.66 41.9777 2.75507 8160.55 41.9575 2.67967 8292.54 41.9368 2.60633 8426.67 41.9157 2.53500 8562.96 41.8942 2.46562 8701.46 41.8724 2.39814 8842.20 41.8504 2.33251 8985.22 41.8283 2.26868 9130.54 41.8058 2.20595 9278.22 41.7828 2.14481 9428.29 41.7593 2.08536 9580.79 41.7354 2.02756 9735.75 41.7112 1.97136 9893.22 41.6866 1.91663 10053.2 41.6618 1.86340 10215.8 41.6366 1.81163 10381.1 41.6111 1.76127 10549.0 41.5853 1.71229 10719.6 41.5592 1.66464 10893.0 41.5328 1.61830 11069.2 41.5060 1.57323 11248.2 41.4789 1.52939 11430.1 41.4515 1.48676 11615.0 41.4237 1.44530 11802.9 41.3954 1.40498 11993.8 41.3667 1.36577 12187.8 41.3376 1.32764 12384.9 41.3079 1.29056 12585.2 41.2777 1.25451 12788.8 41.2469 1.21945 12995.6 41.2154 1.18536 13205.8 41.1832 1.15221 13419.4 41.1501 1.11997 13636.4 41.1162 1.08863 13857.0 41.0812 1.05816 14081.1 41.0451 1.02852 14308.9 41.0077 0.999713 14540.3 40.9689 0.971700 14775.5 40.9284 0.944462 15014.5 40.8861 0.917980 15257.3 40.8416 0.892231 15504.1 40.7947 0.867197 15754.8 40.7450 0.842856 16009.7 40.6919 0.819190 16268.6 40.6350 0.796180 16531.7 40.5734 0.773808 16799.1 40.5062 0.752056 17070.8 40.4323 0.730907 17347.0 40.3499 0.710344 17627.5 40.2569 0.690352 17912.6 40.1500 0.670913 18202.4 40.0245 0.652013 18496.8 39.8728 0.633637 18795.9 39.6820 0.615769 19099.9 39.4272 0.598396 19408.9 39.0500 0.581504 19722.8 38.3467 0.565079 20000.3 30.4385 0.551156 20000.5 30.4387 3.71490 20041.8 36.5300 3.70285 20366.0 38.7994 3.61058 20695.4 39.4951 3.52009 21030.1 39.9268 3.43139 21370.2 40.2410 3.34446 21715.9 40.4875 3.25930 22067.1 40.6894 3.17590 22424.0 40.8595 3.09425 22786.7 41.0056 3.01432 23155.3 41.1328 2.93611 23529.8 41.2449 2.85960 23910.4 41.3443 2.78477 24297.1 41.4331 2.71161 24690.1 41.5127 2.64008 25089.4 41.5845 2.57017 25495.2 41.6494 2.50187 25907.6 41.7082 2.43514 26326.6 41.7616 2.36996 26752.5 41.8101 2.30632 27185.2 41.8543 2.24418 27624.8 41.8946 2.18352 28071.7 41.9314 2.12432 28525.7 41.9651 2.06655 28987.1 41.9969 2.01019 29455.9 42.0440 1.95521 29932.3 42.0207 1.90158 30000.0 42.0368 1.89415 periodictable-1.5.0/periodictable/xsf/n.nff000066400000000000000000000326301310514471200206630ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.677847 10.1617 -9999. 0.689631 10.3261 -9999. 0.701620 10.4931 -9999. 0.713817 10.6628 -9999. 0.726227 10.8353 -9999. 0.738852 11.0106 -9999. 0.751697 11.1886 -9999. 0.765839 11.3696 -9999. 0.786026 11.5535 -9999. 0.806743 11.7404 -9999. 0.828008 11.9303 -9999. 0.849833 12.1232 -9999. 0.872233 12.3193 -9999. 0.895223 12.5186 -9999. 0.919280 12.7210 -9999. 0.954622 12.9268 -9999. 0.991323 13.1359 -9999. 1.02943 13.3483 -9999. 1.06901 13.5642 -9999. 1.11011 13.7836 -9999. 1.15279 14.0066 -9999. 1.22432 14.2331 -9999. 1.30424 14.4633 -9999. 1.38938 14.6973 -9999. 1.48008 14.9350 -9999. 1.57670 15.1765 -9999. 1.68655 15.4220 -9999. 1.80625 15.6714 -9999. 1.93445 15.9249 -9999. 2.07175 16.1825 -9999. 2.21879 16.4442 -9999. 2.37627 16.7102 -9999. 2.54492 16.9805 -9999. 2.68091 17.2551 -9999. 2.82044 17.5342 -9999. 2.96724 17.8178 -9999. 3.12169 18.1060 -9999. 3.28417 18.3989 -9999. 3.45511 18.6964 -9999. 3.63494 18.9988 -9999. 3.79196 19.3061 -9999. 3.94069 19.6184 -9999. 4.09526 19.9357 -9999. 4.25588 20.2582 -9999. 4.42281 20.5858 -9999. 4.54192 20.9188 -9999. 4.62172 21.2571 -9999. 4.70292 21.6009 -9999. 4.78554 21.9503 -9999. 4.86963 22.3053 -9999. 4.92315 22.6661 -9999. 4.94757 23.0327 -9999. 4.97211 23.4053 -9999. 4.99678 23.7838 -9999. 5.02156 24.1685 -9999. 5.02138 24.5594 -9999. 4.99215 24.9566 -9999. 4.96309 25.3603 -9999. 4.93420 25.7705 -9999. 4.90547 26.1873 -9999. 4.87692 26.6109 -9999. 4.84853 27.0413 -9999. 4.82030 27.4786 -9999. 4.77252 27.9231 -9999. 4.69687 28.3747 -9999. 4.62241 28.8337 -9999. 4.54913 29.3000 3.09670 4.47701 29.7739 3.18574 4.40604 30.2555 3.26861 4.33619 30.7449 3.34589 4.26745 31.2421 3.41793 4.19980 31.7475 3.48497 4.13322 32.2609 3.54521 4.06770 32.7827 3.60004 4.00711 33.3130 3.65406 3.95223 33.8518 3.70766 3.89810 34.3993 3.75942 3.84471 34.9557 3.80887 3.79205 35.5211 3.85551 3.74012 36.0956 3.89834 3.68889 36.6794 3.93428 3.63837 37.2000 3.93988 3.59457 37.4000 3.95594 3.64104 37.8755 4.02773 3.60150 38.4882 4.08710 3.55191 39.1107 4.13881 3.50300 39.7432 4.18663 3.45476 40.3861 4.23179 3.40719 41.0393 4.27486 3.36027 41.7031 4.31619 3.31400 42.3776 4.35601 3.26836 43.0630 4.39451 3.22336 43.7595 4.43188 3.17897 44.4673 4.46832 3.13520 45.1865 4.50400 3.09203 45.9174 4.54124 3.04945 46.6600 4.57806 3.00283 47.4147 4.61022 2.95442 48.1816 4.63910 2.90678 48.9609 4.66531 2.85992 49.7528 4.68891 2.81381 50.5576 4.70963 2.76844 51.3753 4.72672 2.72381 52.2062 4.73743 2.67989 53.0506 4.72873 2.63668 53.9087 4.74381 2.65841 54.7806 4.79551 2.63101 55.6667 4.82377 2.59803 56.5670 4.85174 2.56546 57.4820 4.87868 2.53328 58.4117 4.90536 2.50150 59.3564 4.93244 2.46913 60.3165 4.95892 2.43557 61.2921 4.98466 2.40164 62.2834 5.00922 2.36630 63.2908 5.03169 2.33146 64.3145 5.05325 2.29710 65.3547 5.07398 2.26327 66.4118 5.09412 2.22997 67.4859 5.11385 2.19716 68.5775 5.13350 2.16482 69.6867 5.15315 2.13196 70.8138 5.17222 2.09899 71.9591 5.19044 2.06521 73.1230 5.20726 2.03172 74.3057 5.22311 1.99878 75.5076 5.23827 1.96635 76.7289 5.25289 1.93446 77.9699 5.26721 1.90309 79.2310 5.28116 1.87156 80.5125 5.29458 1.84053 81.8147 5.30767 1.80919 83.1380 5.31977 1.77788 84.4827 5.33090 1.74711 85.8491 5.34142 1.71687 87.2377 5.35147 1.68715 88.6487 5.36108 1.65784 90.0825 5.37030 1.62891 91.5395 5.37913 1.60031 93.0201 5.38740 1.57190 94.5246 5.39514 1.54400 96.0535 5.40250 1.51661 97.6071 5.40957 1.48969 99.1858 5.41689 1.46326 100.790 5.42415 1.43628 102.420 5.43019 1.40887 104.077 5.43530 1.38222 105.760 5.43994 1.35606 107.471 5.44406 1.33039 109.209 5.44773 1.30519 110.975 5.45099 1.28048 112.770 5.45389 1.25624 114.594 5.45644 1.23245 116.448 5.45866 1.20914 118.331 5.46061 1.18627 120.245 5.46230 1.16381 122.190 5.46373 1.14177 124.166 5.46493 1.12014 126.175 5.46595 1.09894 128.215 5.46695 1.07815 130.289 5.46801 1.05760 132.397 5.46877 1.03651 134.538 5.46881 1.01582 136.714 5.46841 0.995549 138.925 5.46766 0.975693 141.172 5.46663 0.956241 143.456 5.46534 0.937174 145.776 5.46382 0.918471 148.134 5.46208 0.900155 150.530 5.46020 0.882212 152.964 5.45820 0.864610 155.439 5.45616 0.847362 157.953 5.45421 0.830458 160.507 5.45304 0.813567 163.103 5.45202 0.795548 165.742 5.44957 0.776260 168.422 5.44577 0.757438 171.146 5.44112 0.739074 173.915 5.43580 0.721154 176.727 5.42989 0.703670 179.586 5.42343 0.686608 182.491 5.41647 0.669961 185.442 5.40903 0.653718 188.442 5.40111 0.637868 191.489 5.39274 0.622402 194.587 5.38392 0.607312 197.734 5.37465 0.592587 200.932 5.36494 0.578219 204.182 5.35477 0.564200 207.485 5.34415 0.550521 210.840 5.33308 0.537173 214.251 5.32155 0.524149 217.716 5.30957 0.511440 221.237 5.29733 0.498997 224.816 5.28450 0.486268 228.452 5.27067 0.473865 232.147 5.25612 0.461778 235.902 5.24084 0.449999 239.717 5.22480 0.438521 243.595 5.20796 0.427335 247.535 5.19029 0.416435 251.538 5.17175 0.405812 255.607 5.15227 0.395461 259.741 5.13178 0.385374 263.942 5.11023 0.375544 268.211 5.08753 0.365965 272.549 5.06357 0.356630 276.957 5.03826 0.347533 281.437 5.01147 0.338668 285.989 4.98307 0.330030 290.615 4.95292 0.321611 295.315 4.92083 0.313408 300.092 4.88664 0.305413 304.945 4.85017 0.297623 309.878 4.81152 0.290032 314.890 4.77024 0.280969 319.983 4.72420 0.271097 325.158 4.67285 0.261571 330.418 4.61616 0.252380 335.762 4.55339 0.243512 341.192 4.48353 0.234956 346.711 4.40525 0.226700 352.319 4.31681 0.218734 358.017 4.21577 0.211049 363.808 4.09877 0.203644 369.692 3.96099 0.196614 375.672 3.79504 0.189827 381.748 3.58874 0.183275 387.922 3.32035 0.176948 394.197 2.94481 0.170840 400.573 2.34175 0.164943 407.052 0.902755 0.159249 409.800 -3.34729 0.156919 410.000 -3.34070 4.19145 413.635 1.37475 4.14308 420.326 2.76993 4.05657 427.124 3.47180 3.97187 434.032 3.95030 3.88894 441.052 4.31518 3.80774 448.186 4.61038 3.72824 455.435 4.85808 3.65039 462.802 5.07115 3.57417 470.287 5.25773 3.49954 477.894 5.42335 3.42648 485.623 5.57192 3.35493 493.478 5.70635 3.28488 501.459 5.82888 3.21629 509.570 5.94124 3.14914 517.812 6.04487 3.08339 526.187 6.14095 3.01901 534.698 6.23051 2.95597 543.346 6.31452 2.89425 552.134 6.39405 2.83382 561.065 6.47106 2.77465 570.139 6.54609 2.71065 579.361 6.61317 2.64396 588.732 6.67262 2.57890 598.254 6.72717 2.51545 607.930 6.77737 2.45355 617.763 6.82373 2.39319 627.755 6.86664 2.33430 637.908 6.90643 2.27687 648.226 6.94337 2.22084 658.711 6.97771 2.16620 669.365 7.00967 2.11290 680.191 7.03943 2.06091 691.193 7.06718 2.01021 702.372 7.09308 1.96074 713.733 7.11728 1.91250 725.277 7.13995 1.86544 737.008 7.16124 1.81954 748.928 7.18132 1.77478 761.042 7.20082 1.73111 773.351 7.21973 1.68755 785.859 7.23710 1.64348 798.570 7.25230 1.59980 811.486 7.26550 1.55727 824.611 7.27724 1.51588 837.949 7.28754 1.47559 851.502 7.29659 1.43672 865.274 7.30472 1.39924 879.269 7.31226 1.36305 893.491 7.31934 1.32778 907.943 7.32586 1.29344 922.628 7.33212 1.26000 937.551 7.33793 1.22669 952.715 7.34274 1.19410 968.124 7.34685 1.16223 983.783 7.35026 1.13121 999.695 7.35311 1.10104 1015.86 7.35545 1.07169 1032.29 7.35753 1.04340 1048.99 7.35965 1.01539 1065.96 7.36113 0.987635 1083.20 7.36187 0.960644 1100.72 7.36219 0.934382 1118.52 7.36212 0.908828 1136.61 7.36171 0.883967 1155. 7.36099 0.859792 1173.68 7.36002 0.836289 1192.66 7.35885 0.813426 1211.95 7.35751 0.791189 1231.55 7.35616 0.769561 1251.47 7.35479 0.748220 1271.72 7.35321 0.727154 1292.29 7.35124 0.706299 1313.19 7.34877 0.686031 1334.43 7.34603 0.666348 1356.01 7.34309 0.647237 1377.94 7.33996 0.628640 1400.23 7.33664 0.610591 1422.88 7.33321 0.593089 1445.89 7.32971 0.576061 1469.28 7.32611 0.559505 1493.04 7.32250 0.543407 1517.19 7.31883 0.527586 1541.73 7.31491 0.512213 1566.67 7.31092 0.497310 1592.01 7.30688 0.482831 1617.76 7.30279 0.468772 1643.92 7.29866 0.455120 1670.51 7.29452 0.441867 1697.53 7.29037 0.429000 1724.99 7.28628 0.416509 1752.89 7.28224 0.404201 1781.24 7.27808 0.392198 1810.05 7.27386 0.380508 1839.32 7.26959 0.369169 1869.07 7.26530 0.358167 1899.30 7.26101 0.347492 1930.02 7.25672 0.337134 1961.24 7.25245 0.327086 1992.96 7.24817 0.317340 2025.20 7.24396 0.307997 2057.95 7.23990 0.298733 2091.24 7.23578 0.289725 2125.06 7.23167 0.280975 2159.43 7.22757 0.272469 2194.36 7.22350 0.264210 2229.85 7.21945 0.256185 2265.92 7.21543 0.248394 2302.57 7.21145 0.240822 2339.81 7.20750 0.233471 2377.66 7.20358 0.226326 2416.11 7.19970 0.219390 2455.19 7.19586 0.212656 2494.90 7.19206 0.206120 2535.26 7.18831 0.199772 2576.26 7.18459 0.193608 2617.93 7.18093 0.187630 2660.27 7.17730 0.181816 2703.30 7.17372 0.176182 2747.03 7.17019 0.170711 2791.46 7.16670 0.165399 2836.61 7.16327 0.160250 2882.49 7.15988 0.155248 2929.11 7.15654 0.150389 2976.48 7.15324 0.145680 3024.63 7.15000 0.141110 3073.55 7.14680 0.136673 3123.26 7.14365 0.132370 3173.78 7.14055 0.128195 3225.11 7.13750 0.124153 3277.27 7.13451 0.120219 3330.28 7.13155 0.116411 3384.15 7.12865 0.112717 3438.88 7.12579 0.109134 3494.50 7.12299 0.105658 3551.02 7.12023 0.102286 3608.46 7.11752 0.990161E-01 3666.82 7.11486 0.958453E-01 3726.13 7.11224 0.927710E-01 3786.40 7.10967 0.897890E-01 3847.64 7.10714 0.868981E-01 3909.87 7.10467 0.840951E-01 3973.11 7.10224 0.813777E-01 4037.38 7.09985 0.787312E-01 4102.68 7.09749 0.761794E-01 4169.03 7.09518 0.737062E-01 4236.46 7.09292 0.713120E-01 4304.98 7.09070 0.689915E-01 4374.62 7.08853 0.667440E-01 4445.37 7.08640 0.645673E-01 4517.27 7.08430 0.624588E-01 4590.33 7.08226 0.604167E-01 4664.58 7.08025 0.584390E-01 4740.03 7.07828 0.565230E-01 4816.69 7.07635 0.546688E-01 4894.60 7.07446 0.528719E-01 4973.77 7.07262 0.511327E-01 5054.21 7.07081 0.494484E-01 5135.96 7.06903 0.478178E-01 5219.03 7.06730 0.462392E-01 5303.44 7.06560 0.447096E-01 5389.22 7.06394 0.432299E-01 5476.39 7.06231 0.417965E-01 5564.97 7.06072 0.404085E-01 5654.98 7.05916 0.390665E-01 5746.44 7.05764 0.377663E-01 5839.39 7.05615 0.365079E-01 5933.83 7.05470 0.352890E-01 6029.81 7.05327 0.341103E-01 6127.33 7.05188 0.329685E-01 6226.44 7.05052 0.318640E-01 6327.15 7.04918 0.307956E-01 6429.48 7.04788 0.297618E-01 6533.48 7.04661 0.287609E-01 6639.15 7.04537 0.277916E-01 6746.54 7.04415 0.268536E-01 6855.65 7.04296 0.259475E-01 6966.54 7.04181 0.250700E-01 7079.22 7.04067 0.242218E-01 7193.72 7.03957 0.234003E-01 7310.07 7.03848 0.226054E-01 7428.31 7.03743 0.218367E-01 7548.45 7.03640 0.210932E-01 7670.54 7.03539 0.203739E-01 7794.61 7.03441 0.196782E-01 7920.68 7.03345 0.190053E-01 8048.79 7.03251 0.183546E-01 8178.98 7.03159 0.177251E-01 8311.26 7.03070 0.171163E-01 8445.69 7.02983 0.165279E-01 8582.29 7.02898 0.159585E-01 8721.11 7.02814 0.154081E-01 8862.16 7.02733 0.148760E-01 9005.50 7.02654 0.143614E-01 9151.16 7.02577 0.138640E-01 9299.17 7.02502 0.133831E-01 9449.58 7.02428 0.129181E-01 9602.42 7.02356 0.124689E-01 9757.73 7.02286 0.120344E-01 9915.55 7.02218 0.116146E-01 10075.9 7.02152 0.112088E-01 10238.9 7.02087 0.108166E-01 10404.5 7.02023 0.104376E-01 10572.8 7.01962 0.100714E-01 10743.8 7.01901 0.971753E-02 10917.6 7.01843 0.937560E-02 11094.2 7.01785 0.904524E-02 11273.6 7.01730 0.872607E-02 11455.9 7.01675 0.841776E-02 11641.2 7.01622 0.811993E-02 11829.5 7.01570 0.783223E-02 12020.8 7.01520 0.755438E-02 12215.3 7.01471 0.728601E-02 12412.8 7.01423 0.702685E-02 12613.6 7.01376 0.677659E-02 12817.6 7.01331 0.653494E-02 13025.0 7.01287 0.630162E-02 13235.6 7.01243 0.607636E-02 13449.7 7.01201 0.585890E-02 13667.2 7.01160 0.564898E-02 13888.3 7.01120 0.544636E-02 14112.9 7.01082 0.525080E-02 14341.2 7.01044 0.506207E-02 14573.1 7.01007 0.487994E-02 14808.9 7.00971 0.470421E-02 15048.4 7.00936 0.453465E-02 15291.8 7.00902 0.437107E-02 15539.1 7.00868 0.421328E-02 15790.4 7.00836 0.406106E-02 16045.8 7.00805 0.391426E-02 16305.4 7.00774 0.377268E-02 16569.1 7.00744 0.363616E-02 16837.1 7.00715 0.350453E-02 17109.4 7.00687 0.337762E-02 17386.1 7.00659 0.325528E-02 17667.4 7.00632 0.313736E-02 17953.1 7.00606 0.302370E-02 18243.5 7.00581 0.291418E-02 18538.6 7.00556 0.280864E-02 18838.4 7.00532 0.270697E-02 19143.1 7.00509 0.260902E-02 19452.7 7.00486 0.251467E-02 19767.4 7.00464 0.242380E-02 20087.1 7.00442 0.233706E-02 20412.0 7.00422 0.225277E-02 20742.1 7.00401 0.217158E-02 21077.6 7.00381 0.209337E-02 21418.5 7.00362 0.201803E-02 21765.0 7.00344 0.194545E-02 22117.0 7.00325 0.187552E-02 22474.7 7.00308 0.180815E-02 22838.2 7.00291 0.174324E-02 23207.6 7.00274 0.168069E-02 23583.0 7.00258 0.162043E-02 23964.4 7.00242 0.156235E-02 24352.0 7.00227 0.150639E-02 24745.9 7.00212 0.145246E-02 25146.2 7.00197 0.140048E-02 25552.9 7.00183 0.135039E-02 25966.2 7.00170 0.130212E-02 26386.1 7.00156 0.125559E-02 26812.9 7.00143 0.121074E-02 27246.6 7.00131 0.116751E-02 27687.3 7.00119 0.112584E-02 28135.1 7.00107 0.108567E-02 28590.2 7.00095 0.104695E-02 29052.6 7.00084 0.100962E-02 29522.5 7.00073 0.973629E-03 30000.0 7.00063 0.938934E-03 periodictable-1.5.0/periodictable/xsf/na.nff000066400000000000000000000330101310514471200210150ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.147534E-01 10.1617 -9999. 0.151684E-01 10.3261 -9999. 0.155950E-01 10.4931 -9999. 0.160337E-01 10.6628 -9999. 0.164847E-01 10.8353 -9999. 0.169485E-01 11.0106 -9999. 0.174252E-01 11.1886 -9999. 0.179154E-01 11.3696 -9999. 0.184193E-01 11.5535 -9999. 0.189374E-01 11.7404 -9999. 0.194701E-01 11.9303 -9999. 0.200178E-01 12.1232 -9999. 0.205809E-01 12.3193 -9999. 0.211598E-01 12.5186 -9999. 0.217550E-01 12.7210 -9999. 0.223670E-01 12.9268 -9999. 0.229962E-01 13.1359 -9999. 0.236430E-01 13.3483 -9999. 0.243081E-01 13.5642 -9999. 0.249919E-01 13.7836 -9999. 0.255150E-01 14.0066 -9999. 0.259862E-01 14.2331 -9999. 0.264661E-01 14.4633 -9999. 0.269549E-01 14.6973 -9999. 0.274527E-01 14.9350 -9999. 0.279597E-01 15.1765 -9999. 0.284761E-01 15.4220 -9999. 0.290020E-01 15.6714 -9999. 0.294125E-01 15.9249 -9999. 0.297985E-01 16.1825 -9999. 0.301895E-01 16.4442 -9999. 0.305857E-01 16.7102 -9999. 0.309870E-01 16.9805 -9999. 0.313936E-01 17.2551 -9999. 0.318055E-01 17.5342 -9999. 0.322229E-01 17.8178 -9999. 0.325671E-01 18.1060 -9999. 0.328178E-01 18.3989 -9999. 0.330704E-01 18.6964 -9999. 0.333250E-01 18.9988 -9999. 0.335815E-01 19.3061 -9999. 0.338400E-01 19.6184 -9999. 0.341004E-01 19.9357 -9999. 0.343629E-01 20.2582 -9999. 0.346274E-01 20.5858 -9999. 0.348264E-01 20.9188 -9999. 0.349017E-01 21.2571 -9999. 0.349772E-01 21.6009 -9999. 0.350529E-01 21.9503 -9999. 0.351287E-01 22.3053 -9999. 0.352047E-01 22.6661 -9999. 0.352808E-01 23.0327 -9999. 0.353571E-01 23.4053 -9999. 0.354336E-01 23.7838 -9999. 0.355102E-01 24.1685 -9999. 0.355870E-01 24.5594 -9999. 0.358675E-01 24.9566 -9999. 0.361683E-01 25.3603 -9999. 0.364716E-01 25.7705 -9999. 0.367775E-01 26.1873 -9999. 0.370860E-01 26.6109 -9999. 0.372048E-01 27.0413 -9999. 0.370648E-01 27.4786 -9999. 0.369253E-01 27.9231 -9999. 0.367864E-01 28.3747 -9999. 0.366479E-01 28.8337 -9999. 0.365100E-01 29.3000 -2.03950 0.363726E-01 29.7739 -2.47455 0.362357E-01 30.2555 -3.36315 0.360994E-01 30.4000 -4.05942 0.360590E-01 30.6000 -4.11461 2.39177 30.7449 -3.47735 2.41235 31.2421 -2.73139 2.48359 31.7475 -2.40933 2.55694 32.2609 -2.20846 2.63245 32.7827 -2.06454 2.71019 33.3130 -1.95293 2.79022 33.8518 -1.86154 2.87263 34.3993 -1.78343 2.95746 34.9557 -1.71413 3.04480 35.5211 -1.65048 3.13471 36.0956 -1.58983 3.22729 36.6794 -1.52916 3.32259 37.2727 -1.46249 3.41755 37.8755 -1.39993 3.49959 38.4882 -1.34414 3.58360 39.1107 -1.29174 3.66962 39.7432 -1.24091 3.75771 40.3861 -1.19080 3.84791 41.0393 -1.14068 3.94028 41.7031 -1.08995 4.03487 42.3776 -1.03796 4.13172 43.0630 -0.984050 4.23091 43.7595 -0.927363 4.33247 44.4673 -0.866628 4.43647 45.1865 -0.797934 4.54297 45.9174 -0.720079 4.63804 46.6600 -0.649149 4.72878 47.4147 -0.580495 4.82129 48.1816 -0.511218 4.91562 48.9609 -0.440371 5.01178 49.7528 -0.366996 5.10983 50.5576 -0.289843 5.20980 51.3753 -0.205353 5.31172 52.2062 -0.113753 5.40276 53.0506 -0.274963E-01 5.49076 53.9087 0.570975E-01 5.58020 54.7806 0.142480 5.67110 55.6667 0.229379 5.76347 56.5670 0.318413 5.85735 57.4820 0.410163 5.95276 58.4117 0.505472 6.04972 59.3564 0.605953 6.14826 60.3165 0.710711 6.24351 61.2921 0.816965 6.33921 62.2834 0.926526 6.43637 63.2908 1.04047 6.53502 64.3145 1.15981 6.63519 65.3547 1.28571 6.73689 66.4118 1.41983 6.84014 67.4859 1.56454 6.94499 68.5775 1.72804 7.05143 69.6867 1.93808 7.13276 70.8138 2.11892 7.16815 71.9591 2.28017 7.20372 73.1230 2.43538 7.23946 74.3057 2.58724 7.27537 75.5076 2.73746 7.31147 76.7289 2.88729 7.34775 77.9699 3.03778 7.38420 79.2310 3.18994 7.42084 80.5125 3.34487 7.45766 81.8147 3.50402 7.49465 83.1380 3.66963 7.53184 84.4827 3.84659 7.56921 85.8491 4.05244 7.59160 87.2377 4.24012 7.57278 88.6487 4.41270 7.55402 90.0825 4.57752 7.53529 91.5395 4.73855 7.51662 93.0201 4.89770 7.49799 94.5246 5.05663 7.47941 96.0535 5.21722 7.46088 97.6071 5.38272 7.44238 99.1858 5.56287 7.42395 100.790 5.76027 7.36974 102.420 5.92746 7.29136 104.077 6.07806 7.21382 105.760 6.21847 7.13710 107.471 6.35123 7.06120 109.209 6.47782 6.98610 110.975 6.59919 6.91181 112.770 6.71608 6.83830 114.594 6.82905 6.76558 116.448 6.93857 6.69362 118.331 7.04510 6.62244 120.245 7.14905 6.55202 122.190 7.25111 6.48233 124.166 7.35243 6.41171 126.175 7.44995 6.34007 128.215 7.54438 6.26925 130.289 7.63664 6.19922 132.397 7.72710 6.12997 134.538 7.81608 6.06149 136.714 7.90397 5.99377 138.925 7.99117 5.92682 141.172 8.07824 5.86061 143.456 8.16605 5.79514 145.776 8.25638 5.73040 148.134 8.35595 5.66639 150.530 8.45437 5.57644 152.964 8.53980 5.48463 155.439 8.61598 5.39434 157.953 8.68701 5.30552 160.507 8.75383 5.21817 163.103 8.81713 5.13226 165.742 8.87736 5.04777 168.422 8.93490 4.96465 171.146 8.99006 4.88292 173.915 9.04309 4.80253 176.727 9.09424 4.72346 179.586 9.14374 4.64569 182.491 9.19183 4.56920 185.442 9.23877 4.49398 188.442 9.28488 4.41999 191.489 9.33065 4.34722 194.587 9.37694 4.27564 197.734 9.42700 4.20525 200.932 9.47721 4.12344 204.182 9.51989 4.03997 207.485 9.55672 3.95818 210.840 9.59030 3.87805 214.251 9.62118 3.79954 217.716 9.64978 3.72262 221.237 9.67639 3.64726 224.816 9.70123 3.57342 228.452 9.72450 3.50108 232.147 9.74638 3.43020 235.902 9.76703 3.36076 239.717 9.78660 3.29272 243.595 9.80525 3.22606 247.535 9.82320 3.16075 251.538 9.84068 3.09676 255.607 9.85812 3.03407 259.741 9.87783 2.97265 263.942 9.89789 2.90618 268.211 9.91284 2.83824 272.549 9.92460 2.77188 276.957 9.93420 2.70708 281.437 9.94206 2.64379 285.989 9.94845 2.58198 290.615 9.95356 2.52162 295.315 9.95754 2.46267 300.092 9.96050 2.40509 304.945 9.96254 2.34887 309.878 9.96376 2.29396 314.890 9.96422 2.24033 319.983 9.96402 2.18795 325.158 9.96323 2.13680 330.418 9.96195 2.08684 335.762 9.96028 2.03805 341.192 9.95838 1.99041 346.711 9.95734 1.94388 352.319 9.95588 1.89573 358.017 9.95232 1.84798 363.808 9.94743 1.80144 369.692 9.94158 1.75607 375.672 9.93492 1.71184 381.748 9.92757 1.66873 387.922 9.91958 1.62670 394.197 9.91101 1.58573 400.573 9.90191 1.54579 407.052 9.89231 1.50686 413.635 9.88223 1.46890 420.326 9.87171 1.43191 427.124 9.86076 1.39584 434.032 9.84939 1.36069 441.052 9.83762 1.32642 448.186 9.82544 1.29301 455.435 9.81287 1.26045 462.802 9.79988 1.22870 470.287 9.78647 1.19775 477.894 9.77233 1.16759 485.623 9.75786 1.13889 493.478 9.74347 1.11108 501.459 9.72898 1.08395 509.570 9.71428 1.05744 517.812 9.69932 1.03155 526.187 9.68408 1.00629 534.698 9.66853 0.981590 543.346 9.65271 0.957444 552.134 9.63644 0.933713 561.065 9.61965 0.910558 570.139 9.60243 0.887949 579.361 9.58457 0.865735 588.732 9.56605 0.844073 598.254 9.54575 0.823237 607.930 9.52566 0.804790 617.763 9.50632 0.787093 627.755 9.48803 0.769875 637.908 9.47032 0.751284 648.226 9.45186 0.730662 658.711 9.43025 0.709016 669.365 9.40579 0.688027 680.191 9.37895 0.669590 691.193 9.35176 0.653119 702.372 9.32520 0.637470 713.733 9.29807 0.621030 725.277 9.26898 0.604227 737.008 9.23798 0.587853 748.928 9.20514 0.571943 761.042 9.17037 0.556473 773.351 9.13354 0.541370 785.859 9.09436 0.526506 798.570 9.05237 0.511915 811.486 9.00730 0.497760 824.611 8.95881 0.483985 837.949 8.90639 0.470581 851.502 8.84948 0.457646 865.274 8.78742 0.445154 879.269 8.71942 0.433081 893.491 8.64432 0.421336 907.943 8.56067 0.409910 922.628 8.46670 0.398795 937.551 8.35944 0.387375 952.715 8.23504 0.376134 968.124 8.08800 0.365090 983.783 7.91008 0.354370 999.695 7.68757 0.343972 1015.86 7.39535 0.333887 1032.29 6.97970 0.324144 1048.99 6.28827 0.314686 1065.96 4.35430 0.305505 1070.70 -0.861678 0.303012 1070.90 -0.858176 4.56315 1083.20 5.77584 4.48199 1100.72 7.05429 4.37039 1118.52 7.74835 4.26157 1136.61 8.23083 4.15551 1155. 8.60108 4.05207 1173.68 8.90076 3.95118 1192.66 9.15156 3.85283 1211.95 9.36631 3.75692 1231.55 9.55317 3.66337 1251.47 9.71780 3.57219 1271.72 9.86424 3.48328 1292.29 9.99550 3.39658 1313.19 10.1139 3.31201 1334.43 10.2211 3.22955 1356.01 10.3186 3.14913 1377.94 10.4077 3.07076 1400.23 10.4894 2.99433 1422.88 10.5643 2.91977 1445.89 10.6333 2.84711 1469.28 10.6969 2.77625 1493.04 10.7556 2.70714 1517.19 10.8099 2.63981 1541.73 10.8602 2.57417 1566.67 10.9070 2.51017 1592.01 10.9504 2.44775 1617.76 10.9908 2.38689 1643.92 11.0286 2.32756 1670.51 11.0639 2.26967 1697.53 11.0970 2.21324 1724.99 11.1289 2.15824 1752.89 11.1588 2.10256 1781.24 11.1861 2.04765 1810.05 11.2107 1.99371 1839.32 11.2329 1.94119 1869.07 11.2533 1.89005 1899.30 11.2719 1.84025 1930.02 11.2890 1.79176 1961.24 11.3047 1.74456 1992.96 11.3189 1.69862 2025.20 11.3327 1.65480 2057.95 11.3459 1.61025 2091.24 11.3574 1.56664 2125.06 11.3676 1.52408 2159.43 11.3766 1.48254 2194.36 11.3847 1.44197 2229.85 11.3918 1.40236 2265.92 11.3981 1.36373 2302.57 11.4035 1.32597 2339.81 11.4080 1.28918 2377.66 11.4119 1.25329 2416.11 11.4151 1.21828 2455.19 11.4176 1.18414 2494.90 11.4196 1.15087 2535.26 11.4209 1.11842 2576.26 11.4217 1.08680 2617.93 11.4221 1.05600 2660.27 11.4220 1.02598 2703.30 11.4214 0.996722 2747.03 11.4204 0.968234 2791.46 11.4191 0.940485 2836.61 11.4173 0.913468 2882.49 11.4153 0.887163 2929.11 11.4130 0.861554 2976.48 11.4103 0.836624 3024.63 11.4074 0.812351 3073.55 11.4043 0.788746 3123.26 11.4010 0.765755 3173.78 11.3974 0.743395 3225.11 11.3937 0.721644 3277.27 11.3897 0.700476 3330.28 11.3856 0.679893 3384.15 11.3814 0.659883 3438.88 11.3771 0.640411 3494.50 11.3726 0.621488 3551.02 11.3680 0.603067 3608.46 11.3633 0.585176 3666.82 11.3586 0.567775 3726.13 11.3537 0.550867 3786.40 11.3488 0.534432 3847.64 11.3439 0.518461 3909.87 11.3389 0.502941 3973.11 11.3339 0.487859 4037.38 11.3288 0.473204 4102.68 11.3237 0.458952 4169.03 11.3186 0.445127 4236.46 11.3135 0.431680 4304.98 11.3083 0.418640 4374.62 11.3032 0.405953 4445.37 11.2981 0.393637 4517.27 11.2930 0.381676 4590.33 11.2879 0.370061 4664.58 11.2828 0.358789 4740.03 11.2777 0.347849 4816.69 11.2727 0.337226 4894.60 11.2677 0.326910 4973.77 11.2628 0.316871 5054.21 11.2578 0.307154 5135.96 11.2529 0.297721 5219.03 11.2481 0.288568 5303.44 11.2433 0.279665 5389.22 11.2386 0.271038 5476.39 11.2338 0.262663 5564.97 11.2292 0.254539 5654.98 11.2246 0.246653 5746.44 11.2200 0.239003 5839.39 11.2155 0.231581 5933.83 11.2111 0.224381 6029.81 11.2067 0.217395 6127.33 11.2023 0.210617 6226.44 11.1981 0.204045 6327.15 11.1938 0.197670 6429.48 11.1897 0.191485 6533.48 11.1856 0.185487 6639.15 11.1815 0.179670 6746.54 11.1776 0.174028 6855.65 11.1736 0.168557 6966.54 11.1698 0.163253 7079.22 11.1660 0.158110 7193.72 11.1622 0.153120 7310.07 11.1586 0.148287 7428.31 11.1550 0.143596 7548.45 11.1514 0.139051 7670.54 11.1479 0.134644 7794.61 11.1445 0.130374 7920.68 11.1411 0.126234 8048.79 11.1378 0.122218 8178.98 11.1345 0.118330 8311.26 11.1313 0.114557 8445.69 11.1282 0.110903 8582.29 11.1251 0.107363 8721.11 11.1221 0.103929 8862.16 11.1191 0.100602 9005.50 11.1162 0.973804E-01 9151.16 11.1133 0.942536E-01 9299.17 11.1105 0.912268E-01 9449.58 11.1078 0.882941E-01 9602.42 11.1051 0.854530E-01 9757.73 11.1024 0.827005E-01 9915.55 11.0999 0.800322E-01 10075.9 11.0973 0.774482E-01 10238.9 11.0948 0.749450E-01 10404.5 11.0924 0.725201E-01 10572.8 11.0900 0.701711E-01 10743.8 11.0877 0.678958E-01 10917.6 11.0854 0.656919E-01 11094.2 11.0831 0.635572E-01 11273.6 11.0810 0.614898E-01 11455.9 11.0788 0.594875E-01 11641.2 11.0767 0.575483E-01 11829.5 11.0746 0.556703E-01 12020.8 11.0726 0.538517E-01 12215.3 11.0707 0.520907E-01 12412.8 11.0687 0.503855E-01 12613.6 11.0668 0.487343E-01 12817.6 11.0650 0.471356E-01 13025.0 11.0632 0.455877E-01 13235.6 11.0614 0.440890E-01 13449.7 11.0597 0.426382E-01 13667.2 11.0580 0.412335E-01 13888.3 11.0564 0.398738E-01 14112.9 11.0548 0.385575E-01 14341.2 11.0532 0.372834E-01 14573.1 11.0516 0.360501E-01 14808.9 11.0501 0.348564E-01 15048.4 11.0487 0.337010E-01 15291.8 11.0472 0.325828E-01 15539.1 11.0458 0.315006E-01 15790.4 11.0445 0.304532E-01 16045.8 11.0431 0.294397E-01 16305.4 11.0418 0.284589E-01 16569.1 11.0405 0.275099E-01 16837.1 11.0393 0.265915E-01 17109.4 11.0381 0.257030E-01 17386.1 11.0369 0.248433E-01 17667.4 11.0357 0.240116E-01 17953.1 11.0346 0.232069E-01 18243.5 11.0335 0.224285E-01 18538.6 11.0324 0.216755E-01 18838.4 11.0313 0.209470E-01 19143.1 11.0303 0.202424E-01 19452.7 11.0293 0.195609E-01 19767.4 11.0283 0.189017E-01 20087.1 11.0273 0.182679E-01 20412.0 11.0264 0.176514E-01 20742.1 11.0255 0.170554E-01 21077.6 11.0246 0.164792E-01 21418.5 11.0237 0.159221E-01 21765.0 11.0229 0.153835E-01 22117.0 11.0221 0.148628E-01 22474.7 11.0213 0.143595E-01 22838.2 11.0205 0.138729E-01 23207.6 11.0197 0.134024E-01 23583.0 11.0190 0.129476E-01 23964.4 11.0182 0.125080E-01 24352.0 11.0175 0.120830E-01 24745.9 11.0168 0.116721E-01 25146.2 11.0162 0.112749E-01 25552.9 11.0155 0.108910E-01 25966.2 11.0149 0.105198E-01 26386.1 11.0142 0.101610E-01 26812.9 11.0136 0.981422E-02 27246.6 11.0130 0.947897E-02 27687.3 11.0125 0.915492E-02 28135.1 11.0119 0.884169E-02 28590.2 11.0113 0.853893E-02 29052.6 11.0108 0.824628E-02 29522.5 11.0103 0.796342E-02 30000.0 11.0098 0.769003E-02 periodictable-1.5.0/periodictable/xsf/nb.nff000066400000000000000000000316041310514471200210250ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.56685 10.1617 -9999. 2.66209 10.3261 -9999. 2.76087 10.4931 -9999. 2.86331 10.6628 -9999. 2.96956 10.8353 -9999. 3.07974 11.0106 -9999. 3.19401 11.1886 -9999. 3.31252 11.3696 -9999. 3.42326 11.5535 -9999. 3.51200 11.7404 -9999. 3.60305 11.9303 -9999. 3.69645 12.1232 -9999. 3.79228 12.3193 -9999. 3.89059 12.5186 -9999. 3.99145 12.7210 -9999. 4.09492 12.9268 -9999. 4.19732 13.1359 -9999. 4.29578 13.3483 -9999. 4.39654 13.5642 -9999. 4.49967 13.7836 -9999. 4.60521 14.0066 -9999. 4.71323 14.2331 -9999. 4.82379 14.4633 -9999. 4.92204 14.6973 -9999. 4.99540 14.9350 -9999. 5.06985 15.1765 -9999. 5.14542 15.4220 -9999. 5.22211 15.6714 -9999. 5.29994 15.9249 -9999. 5.36144 16.1825 -9999. 5.40803 16.4442 -9999. 5.45502 16.7102 -9999. 5.50243 16.9805 -9999. 5.55024 17.2551 -9999. 5.52629 17.5342 -9999. 5.49985 17.8178 -9999. 5.47353 18.1060 -9999. 5.44735 18.3989 -9999. 5.42129 18.6964 -9999. 5.35934 18.9988 -9999. 5.22402 19.3061 -9999. 5.09212 19.6184 -9999. 4.96355 19.9357 -9999. 4.83823 20.2582 -9999. 4.71607 20.5858 -9999. 4.57132 20.9188 -9999. 4.42631 21.2571 -9999. 4.28590 21.6009 -9999. 4.14994 21.9503 -9999. 4.01830 22.3053 -9999. 3.89083 22.6661 -9999. 3.78365 23.0327 -9999. 3.68358 23.4053 -9999. 3.58615 23.7838 -9999. 3.49131 24.1685 -9999. 3.39896 24.5594 -9999. 3.32114 24.9566 -9999. 3.26923 25.3603 -9999. 3.21814 25.7705 -9999. 3.16785 26.1873 -9999. 3.11835 26.6109 -9999. 3.09552 27.0413 -9999. 3.08913 27.4786 -9999. 3.08276 27.9231 -9999. 3.07640 28.3747 -9999. 3.08935 28.8337 -9999. 3.16044 29.3000 3.65589 3.23316 29.7739 3.28421 3.35858 30.2555 2.94113 3.56089 30.7449 2.58333 3.77537 31.2421 2.15063 4.06135 31.7475 1.77528 4.47181 32.2609 1.44276 4.92376 32.7827 1.13375 5.42138 33.3130 0.845374 5.96928 33.8518 0.574920 6.57256 34.3993 0.312846 7.23682 34.9557 0.309060E-01 8.04643 35.5211 -0.116685 9.01917 36.0956 -0.107686 10.1095 36.6794 0.146301 11.3037 37.2727 0.570445 12.4075 37.8755 1.20021 13.6192 38.4882 2.35458 14.7266 39.1107 3.52583 15.3002 39.7432 4.78554 15.6547 40.3861 5.88594 15.7420 41.0393 6.78429 15.7278 41.7031 7.57706 15.7135 42.3776 8.31831 15.6993 43.0630 9.03042 15.6850 43.7595 9.73071 15.6708 44.4673 10.4357 15.6566 45.1865 11.1732 15.6424 45.9174 12.0028 15.6283 46.6600 12.9126 15.3674 47.4147 13.6599 15.0138 48.1816 14.3473 14.6684 48.9609 15.0367 14.3309 49.7528 15.8417 13.9371 50.5576 16.5048 13.2171 51.3753 16.9841 12.5343 52.2062 17.3605 11.8868 53.0506 17.6940 11.2590 53.9087 17.9449 10.5992 54.7806 18.1179 9.97803 55.6667 18.2359 9.39326 56.5670 18.3131 8.84278 57.4820 18.3575 8.32454 58.4117 18.3756 7.83669 59.3564 18.3729 7.37744 60.3165 18.3550 6.94508 61.2921 18.3297 6.53806 62.2834 18.3166 6.12911 63.2908 18.2548 5.71452 64.3145 18.1655 5.32795 65.3547 18.0587 4.96755 66.4118 17.9394 4.63153 67.4859 17.8108 4.31822 68.5775 17.6756 4.02612 69.6867 17.5360 3.75377 70.8138 17.3953 3.49985 71.9591 17.2616 3.26310 73.1230 17.1216 3.01378 74.3057 16.9629 2.78071 75.5076 16.7949 2.56567 76.7289 16.6212 2.36726 77.9699 16.4427 2.18419 79.2310 16.2576 2.01528 80.5125 16.0707 1.87098 81.8147 15.8902 1.73976 83.1380 15.7116 1.61773 84.4827 15.5328 1.50427 85.8491 15.3504 1.39877 87.2377 15.1543 1.30066 88.6487 14.9611 1.24613 90.0825 14.7885 1.19890 91.5395 14.6243 1.15346 93.0201 14.4625 1.10975 94.5246 14.2959 1.07194 96.0535 14.1335 1.04477 97.6071 13.9637 1.01829 99.1858 13.7936 1.02779 100.790 13.6424 1.04439 102.420 13.4997 1.06431 104.077 13.3678 1.08972 105.760 13.2437 1.11574 107.471 13.1230 1.14238 109.209 13.0075 1.17622 110.975 12.8987 1.21118 112.770 12.7956 1.24718 114.594 12.6984 1.28425 116.448 12.6072 1.31759 118.331 12.5154 1.34875 120.245 12.4237 1.38065 122.190 12.3329 1.41329 124.166 12.2430 1.44671 126.175 12.1540 1.48092 128.215 12.0657 1.51594 130.289 11.9784 1.55179 132.397 11.8938 1.58849 134.538 11.8089 1.62010 136.714 11.7208 1.65170 138.925 11.6305 1.68392 141.172 11.5384 1.71676 143.456 11.4443 1.75025 145.776 11.3483 1.78439 148.134 11.2507 1.81919 150.530 11.1544 1.85352 152.964 11.0523 1.88106 155.439 10.9427 1.90901 157.953 10.8270 1.93737 160.507 10.7050 1.96616 163.103 10.5773 1.99521 165.742 10.4406 2.02065 168.422 10.2929 2.04629 171.146 10.1329 2.07219 173.915 9.95887 2.09843 176.727 9.76589 2.12499 179.586 9.55397 2.16023 182.491 9.32097 2.19828 185.442 9.05806 2.25268 188.442 8.78371 2.32435 191.489 8.48045 2.39830 194.587 8.13659 2.50013 197.734 7.77283 2.64962 200.932 7.38003 2.80911 204.182 6.96546 3.03219 207.485 6.52531 3.26360 210.840 5.98241 3.51267 214.251 5.40330 3.99318 217.716 4.82148 4.57096 221.237 4.31803 5.33099 224.816 3.91986 6.21889 228.452 3.73787 7.25768 232.147 3.80764 8.17174 235.902 3.83946 8.98427 239.717 3.91127 9.87761 243.595 4.21271 10.8251 247.535 4.56163 11.5923 251.538 5.03425 12.4139 255.607 5.61515 12.9857 259.741 6.09081 13.4529 263.942 6.56845 13.9370 268.211 7.02385 14.3084 272.549 7.44485 14.6892 276.957 7.85801 15.0802 281.437 8.30906 15.4815 285.989 8.77446 15.7975 290.615 9.21280 16.1001 295.315 9.63811 16.4085 300.092 10.0750 16.7228 304.945 10.5708 17.0174 309.878 11.0473 17.2581 314.890 11.5107 17.5022 319.983 11.9935 17.7497 325.158 12.5784 18.0007 330.418 13.1951 18.0465 335.762 13.6628 17.9948 341.192 13.9951 17.9432 346.711 14.2543 18.0412 352.319 14.5586 18.1968 358.017 14.9060 18.3538 363.808 15.2672 18.5122 369.692 15.6413 18.6719 375.672 16.0291 18.8330 381.748 16.4333 18.9955 387.922 16.8592 19.1594 394.197 17.3206 19.3247 400.573 17.8734 19.4494 407.052 18.3710 19.4552 413.635 18.8265 19.4610 420.326 19.2638 19.4669 427.124 19.6917 19.4727 434.032 20.1153 19.4786 441.052 20.5395 19.4844 448.186 20.9707 19.4903 455.435 21.4280 19.4961 462.802 21.8985 19.4360 470.287 22.3359 19.3486 477.894 22.7438 19.2615 485.623 23.1399 19.1749 493.478 23.5281 19.0886 501.459 23.9115 19.0027 509.570 24.2929 18.9172 517.812 24.6755 18.8321 526.187 25.0637 18.7474 534.698 25.4610 18.6630 543.346 25.9374 18.5671 552.134 26.3759 18.3448 561.065 26.7474 18.1252 570.139 27.0915 17.9082 579.361 27.4151 17.6938 588.732 27.7223 17.4820 598.254 28.0158 17.2727 607.930 28.2974 17.0659 617.763 28.5686 16.8616 627.755 28.8307 16.6597 637.908 29.0846 16.4602 648.226 29.3312 16.2632 658.711 29.5715 16.0685 669.365 29.8061 15.8761 680.191 30.0359 15.6860 691.193 30.2618 15.4982 702.372 30.4850 15.3127 713.733 30.7068 15.1294 725.277 30.9299 14.9483 737.008 31.1654 14.7693 748.928 31.3946 14.5570 761.042 31.6082 14.3442 773.351 31.8099 14.1345 785.859 32.0061 13.9279 798.570 32.1994 13.7243 811.486 32.3926 13.5236 824.611 32.5905 13.3260 837.949 32.8033 13.1311 851.502 33.0668 12.8911 865.274 33.2802 12.5746 879.269 33.4278 12.2659 893.491 33.5442 11.9647 907.943 33.6361 11.6805 922.628 33.7036 11.4059 937.551 33.7564 11.1668 952.715 33.8143 10.9462 968.124 33.8779 10.7294 983.783 33.9396 10.5171 999.695 33.9992 10.3084 1015.86 34.0568 10.1034 1032.29 34.1117 9.89893 1048.99 34.1629 9.69527 1065.96 34.2066 9.49228 1083.20 34.2439 9.29351 1100.72 34.2759 9.09891 1118.52 34.3031 8.90840 1136.61 34.3260 8.72189 1155. 34.3447 8.53934 1173.68 34.3598 8.36071 1192.66 34.3712 8.18562 1211.95 34.3792 8.01420 1231.55 34.3846 7.84637 1251.47 34.3875 7.68037 1271.72 34.3872 7.51584 1292.29 34.3813 7.35234 1313.19 34.3703 7.19247 1334.43 34.3550 7.03610 1356.01 34.3357 6.88313 1377.94 34.3126 6.73349 1400.23 34.2860 6.58711 1422.88 34.2562 6.44390 1445.89 34.2235 6.30366 1469.28 34.1891 6.16506 1493.04 34.1534 6.02740 1517.19 34.1106 5.88320 1541.73 34.0584 5.74116 1566.67 33.9977 5.60259 1592.01 33.9299 5.46757 1617.76 33.8552 5.33575 1643.92 33.7733 5.20694 1670.51 33.6838 5.08124 1697.53 33.5864 4.95865 1724.99 33.4796 4.83916 1752.89 33.3641 4.72470 1781.24 33.2402 4.61365 1810.05 33.1066 4.50565 1839.32 32.9623 4.40039 1869.07 32.8057 4.29760 1899.30 32.6348 4.19716 1930.02 32.4475 4.09906 1961.24 32.2412 4.00326 1992.96 32.0125 3.90969 2025.20 31.7556 3.81809 2057.95 31.4665 3.73130 2091.24 31.1387 3.64707 2125.06 30.7610 3.56538 2159.43 30.3175 3.48606 2194.36 29.7840 3.40925 2229.85 29.1199 3.33475 2265.92 28.2479 3.26250 2302.57 26.9916 3.19248 2339.81 24.7379 3.12463 2370.40 9.50284 3.07077 2370.60 9.50482 11.3846 2377.66 20.7176 11.3328 2416.11 25.0802 11.0570 2455.19 24.7669 10.7876 2464.60 19.2062 10.7244 2464.80 19.2131 14.7781 2494.90 27.4023 14.5323 2535.26 29.2837 14.2136 2576.26 30.4376 13.9019 2617.93 31.2162 13.5973 2660.27 31.6238 13.2990 2697.60 28.8304 13.0452 2697.80 28.8341 14.8700 2703.30 31.2653 14.8276 2747.03 33.1711 14.4982 2791.46 34.1005 14.1751 2836.61 34.8210 13.8565 2882.49 35.4269 13.5426 2929.11 35.9539 13.2330 2976.48 36.4204 12.9281 3024.63 36.8385 12.6280 3073.55 37.2161 12.3327 3123.26 37.5592 12.0423 3173.78 37.8722 11.7569 3225.11 38.1588 11.4767 3277.27 38.4218 11.2013 3330.28 38.6637 10.9311 3384.15 38.8865 10.6660 3438.88 39.0920 10.4060 3494.50 39.2820 10.1508 3551.02 39.4572 9.90020 3608.46 39.6185 9.65484 3666.82 39.7674 9.41477 3726.13 39.9053 9.17987 3786.40 40.0329 8.94941 3847.64 40.1502 8.72360 3909.87 40.2582 8.50283 3973.11 40.3577 8.28684 4037.38 40.4492 8.07553 4102.68 40.5333 7.86887 4169.03 40.6103 7.66678 4236.46 40.6808 7.46921 4304.98 40.7452 7.27619 4374.62 40.8037 7.08744 4445.37 40.8569 6.90311 4517.27 40.9050 6.72304 4590.33 40.9484 6.54715 4664.58 40.9873 6.37543 4740.03 41.0220 6.20773 4816.69 41.0527 6.04409 4894.60 41.0798 5.88433 4973.77 41.1033 5.72842 5054.21 41.1236 5.57623 5135.96 41.1408 5.42782 5219.03 41.1551 5.28304 5303.44 41.1667 5.14184 5389.22 41.1757 5.00413 5476.39 41.1823 4.86990 5564.97 41.1868 4.73899 5654.98 41.1891 4.61144 5746.44 41.1895 4.48701 5839.39 41.1879 4.36576 5933.83 41.1847 4.24757 6029.81 41.1798 4.13246 6127.33 41.1734 4.02024 6226.44 41.1655 3.91095 6327.15 41.1563 3.80448 6429.48 41.1459 3.70072 6533.48 41.1342 3.59976 6639.15 41.1215 3.50134 6746.54 41.1078 3.40554 6855.65 41.0931 3.31225 6966.54 41.0776 3.22140 7079.22 41.0612 3.13295 7193.72 41.0440 3.04680 7310.07 41.0261 2.96296 7428.31 41.0074 2.88131 7548.45 40.9882 2.80200 7670.54 40.9684 2.72467 7794.61 40.9480 2.64944 7920.68 40.9271 2.57624 8048.79 40.9058 2.50498 8178.98 40.8840 2.43560 8311.26 40.8617 2.36808 8445.69 40.8390 2.30247 8582.29 40.8160 2.23858 8721.11 40.7925 2.17642 8862.16 40.7687 2.11602 9005.50 40.7447 2.05730 9151.16 40.7203 2.00004 9299.17 40.6956 1.94440 9449.58 40.6706 1.89027 9602.42 40.6453 1.83763 9757.73 40.6197 1.78644 9915.55 40.5938 1.73664 10075.9 40.5676 1.68821 10238.9 40.5411 1.64112 10404.5 40.5143 1.59532 10572.8 40.4871 1.55078 10743.8 40.4596 1.50747 10917.6 40.4317 1.46535 11094.2 40.4035 1.42439 11273.6 40.3748 1.38457 11455.9 40.3457 1.34585 11641.2 40.3161 1.30820 11829.5 40.2859 1.27159 12020.8 40.2552 1.23600 12215.3 40.2239 1.20139 12412.8 40.1918 1.16775 12613.6 40.1590 1.13504 12817.6 40.1253 1.10323 13025.0 40.0906 1.07231 13235.6 40.0549 1.04225 13449.7 40.0180 1.01303 13667.2 39.9797 0.984615 13888.3 39.9399 0.956994 14112.9 39.8983 0.930141 14341.2 39.8548 0.904036 14573.1 39.8090 0.878656 14808.9 39.7605 0.853984 15048.4 39.7091 0.829999 15291.8 39.6540 0.806682 15539.1 39.5948 0.784015 15790.4 39.5305 0.761978 16045.8 39.4602 0.740555 16305.4 39.3824 0.719728 16569.1 39.2953 0.699482 16837.1 39.1963 0.679799 17109.4 39.0816 0.660665 17386.1 38.9456 0.642062 17667.4 38.7789 0.623977 17953.1 38.5651 0.606396 18243.5 38.2701 0.589303 18538.6 37.8046 0.572686 18838.4 36.7415 0.556530 18985.5 29.3743 0.548862 18985.7 29.3745 3.74502 19143.1 36.9155 3.69724 19452.7 38.0837 3.60610 19767.4 38.6510 3.51666 20087.1 39.0322 3.42892 20412.0 39.3196 3.34287 20742.1 39.5496 3.25853 21077.6 39.7404 3.17587 21418.5 39.9026 3.09489 21765.0 40.0429 3.01558 22117.0 40.1657 2.93793 22474.7 40.2742 2.86193 22838.2 40.3709 2.78755 23207.6 40.4574 2.71480 23583.0 40.5353 2.64364 23964.4 40.6056 2.57406 24352.0 40.6693 2.50604 24745.9 40.7271 2.43957 25146.2 40.7797 2.37462 25552.9 40.8275 2.31116 25966.2 40.8711 2.24919 26386.1 40.9108 2.18867 26812.9 40.9470 2.12958 27246.6 40.9801 2.07190 27687.3 41.0102 2.01561 28135.1 41.0376 1.96069 28590.2 41.0627 1.90710 29052.6 41.0858 1.85482 29522.5 41.1116 1.80384 30000.0 41.1094 1.75412 periodictable-1.5.0/periodictable/xsf/nd.nff000066400000000000000000000316321310514471200210300ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.244484 10.1617 -9999. 0.251766 10.3261 -9999. 0.259264 10.4931 -9999. 0.266985 10.6628 -9999. 0.274936 10.8353 -9999. 0.283124 11.0106 -9999. 0.291556 11.1886 -9999. 0.300239 11.3696 -9999. 0.309181 11.5535 -9999. 0.318389 11.7404 -9999. 0.327872 11.9303 -9999. 0.337636 12.1232 -9999. 0.347692 12.3193 -9999. 0.357177 12.5186 -9999. 0.366207 12.7210 -9999. 0.375466 12.9268 -9999. 0.384959 13.1359 -9999. 0.394692 13.3483 -9999. 0.404671 13.5642 -9999. 0.414903 13.7836 -9999. 0.424290 14.0066 -9999. 0.433803 14.2331 -9999. 0.443529 14.4633 -9999. 0.453472 14.6973 -9999. 0.463640 14.9350 -9999. 0.474034 15.1765 -9999. 0.485487 15.4220 -9999. 0.498133 15.6714 -9999. 0.511107 15.9249 -9999. 0.524420 16.1825 -9999. 0.538079 16.4442 -9999. 0.552094 16.7102 -9999. 0.566475 16.9805 -9999. 0.580606 17.2551 -9999. 0.594768 17.5342 -9999. 0.609276 17.8178 -9999. 0.624137 18.1060 -9999. 0.646684 18.3989 -9999. 0.671013 18.6964 -9999. 0.709249 18.9988 -9999. 0.758040 19.3061 -9999. 0.848453 19.6184 -9999. 1.06744 19.9357 -9999. 1.27332 20.2582 -9999. 1.46377 20.5858 -9999. 1.64680 20.9188 -9999. 1.81237 21.2571 -9999. 1.99459 21.6009 -9999. 2.33527 21.9503 -9999. 3.04612 22.3053 -9999. 3.49011 22.6661 -9999. 4.14142 23.0327 -9999. 5.17605 23.4053 -9999. 6.16114 23.7838 -9999. 7.15928 24.1685 -9999. 7.85158 24.5594 -9999. 8.61083 24.9566 -9999. 9.82334 25.3603 -9999. 11.0464 25.7705 -9999. 11.7224 26.1873 -9999. 12.3365 26.6109 -9999. 12.8042 27.0413 -9999. 13.2404 27.4786 -9999. 13.3190 27.9231 -9999. 13.3981 28.3747 -9999. 13.3420 28.8337 -9999. 12.8943 29.3000 9.38600 12.4615 29.7739 9.92147 12.0196 30.2555 10.3493 11.5894 30.7449 10.6922 11.1779 31.2421 10.9616 10.7826 31.7475 11.1396 10.4013 32.2609 11.2595 10.1485 32.7827 11.4084 9.92065 33.3130 11.5515 9.69789 33.8518 11.6623 9.48734 34.3993 11.7735 9.33629 34.9557 11.9008 9.18765 35.5211 12.0344 9.04138 36.0956 12.1723 8.88657 36.6794 12.2960 8.72676 37.2727 12.4115 8.56983 37.8755 12.5214 8.41250 38.4882 12.6266 8.25626 39.1107 12.7408 8.08883 39.7432 12.8214 7.89087 40.3861 12.8685 7.69774 41.0393 12.8849 7.50934 41.7031 12.8713 7.34780 42.3776 12.8431 7.19795 43.0630 12.7673 7.05117 43.7595 12.6944 7.02900 44.4673 12.6718 7.00998 45.1865 12.6724 6.99101 45.9174 12.6906 6.97211 46.6600 12.7209 6.93785 47.4147 12.7460 6.89798 48.1816 12.7695 6.85834 48.9609 12.7922 6.81893 49.7528 12.8136 6.77974 50.5576 12.8330 6.74078 51.3753 12.8486 6.70509 52.2062 12.8662 6.67271 53.0506 12.8841 6.64049 53.9087 12.9015 6.60842 54.7806 12.9180 6.57633 55.6667 12.9328 6.54395 56.5670 12.9458 6.51174 57.4820 12.9567 6.47968 58.4117 12.9654 6.44778 59.3564 12.9716 6.41605 60.3165 12.9753 6.38446 61.2921 12.9761 6.35303 62.2834 12.9738 6.32176 63.2908 12.9684 6.29064 64.3145 12.9594 6.25967 65.3547 12.9468 6.22886 66.4118 12.9302 6.19820 67.4859 12.9094 6.16769 68.5775 12.8840 6.13732 69.6867 12.8537 6.10711 70.8138 12.8184 6.07750 71.9591 12.7779 6.04806 73.1230 12.7317 6.01877 74.3057 12.6796 5.98962 75.5076 12.6209 5.96062 76.7289 12.5555 5.93176 77.9699 12.4829 5.90303 79.2310 12.4029 5.87444 80.5125 12.3158 5.84599 81.8147 12.2237 5.81768 83.1380 12.1331 5.77593 84.4827 12.0138 5.71854 85.8491 11.8713 5.66173 87.2377 11.7075 5.60548 88.6487 11.5218 5.54979 90.0825 11.3128 5.49464 91.5395 11.0804 5.44005 93.0201 10.8322 5.37899 94.5246 10.5314 5.29125 96.0535 10.1552 5.21216 97.6071 9.74159 5.17421 99.1858 9.28917 5.13654 100.790 8.77535 5.10169 102.420 8.19357 5.07562 104.077 7.52319 5.04969 105.760 6.72969 5.02390 107.471 5.77393 5.01946 109.209 4.58498 5.02246 110.975 2.83310 5.02546 112.770 0.857600 6.34994 114.594 0.349530E-01 7.47349 116.448 -0.675786 7.69357 118.331 -4.04398 7.12416 120.245 -10.2082 10.0028 122.190 -14.3529 16.5170 124.166 -15.9152 25.8729 126.175 -11.6855 35.7180 128.215 -6.26161 40.4469 130.289 0.382138 45.8018 132.397 8.66970 47.3493 134.538 16.2755 46.2231 136.714 21.6282 43.8851 138.925 26.1873 40.9195 141.172 29.2001 37.5134 143.456 31.2653 34.3906 145.776 32.6920 31.5279 148.134 33.6528 28.9762 150.530 34.3414 26.6744 152.964 34.7930 24.5554 155.439 35.0428 22.6048 157.953 35.1084 20.8092 160.507 35.0143 19.2228 163.103 34.8648 17.7999 165.742 34.6587 16.4823 168.422 34.3782 15.2622 171.146 34.0138 14.1325 173.915 33.5219 13.1544 176.727 33.0844 12.3516 179.586 32.6523 11.5978 182.491 32.1819 10.8900 185.442 31.5751 10.2892 188.442 31.0838 9.94334 191.489 30.6804 9.60909 194.587 30.3183 9.28607 197.734 29.9697 8.97391 200.932 29.6163 8.67225 204.182 29.2257 8.38072 207.485 28.7266 8.22025 210.840 28.3514 8.20320 214.251 28.0789 8.18619 217.716 27.8481 8.16921 221.237 27.6486 8.15227 224.816 27.4731 8.13536 228.452 27.3165 8.11849 232.147 27.1748 8.10165 235.902 27.0448 8.08485 239.717 26.9237 8.06808 243.595 26.8088 8.05134 247.535 26.6972 8.03465 251.538 26.5856 8.01799 255.607 26.4686 8.00136 259.741 26.3096 7.98856 263.942 26.1707 8.05993 268.211 26.0713 8.13192 272.549 25.9910 8.20457 276.957 25.9240 8.27786 281.437 25.8672 8.35180 285.989 25.8179 8.42641 290.615 25.7734 8.50168 295.315 25.7198 8.57762 300.092 25.6718 8.68811 304.945 25.6498 8.80960 309.878 25.6460 8.93279 314.890 25.6573 9.05771 319.983 25.6830 9.18437 325.158 25.7233 9.31280 330.418 25.7800 9.44303 335.762 25.8572 9.57508 341.192 25.9758 9.69649 346.711 26.0862 9.77427 352.319 26.1919 9.85266 358.017 26.3027 9.93169 363.808 26.4281 10.0113 369.692 26.5967 10.0604 375.672 26.7369 10.0599 381.748 26.8468 10.0594 387.922 26.9463 10.0589 394.197 27.0374 10.0584 400.573 27.1210 10.0578 407.052 27.1970 10.0573 413.635 27.2634 10.0568 420.326 27.3005 10.0718 427.124 27.3546 10.1197 434.032 27.4290 10.1678 441.052 27.5121 10.2162 448.186 27.6042 10.2647 455.435 27.7062 10.3136 462.802 27.8456 10.3608 470.287 27.9763 10.3491 477.894 28.0829 10.3375 485.623 28.1802 10.3258 493.478 28.2715 10.3142 501.459 28.3583 10.3025 509.570 28.4416 10.2909 517.812 28.5222 10.2794 526.187 28.6010 10.2678 534.698 28.6787 10.2562 543.346 28.7642 10.2439 552.134 28.8435 10.2138 561.065 28.9121 10.1838 570.139 28.9752 10.1538 579.361 29.0341 10.1239 588.732 29.0899 10.0942 598.254 29.1441 10.0645 607.930 29.1988 10.0349 617.763 29.2629 10.0053 627.755 29.3541 9.95322 637.908 29.4087 9.84658 648.226 29.4301 9.74109 658.711 29.4299 9.63673 669.365 29.4114 9.53348 680.191 29.3763 9.43135 691.193 29.3255 9.33031 702.372 29.2636 9.23034 713.733 29.1962 9.12004 725.277 29.0937 8.98659 737.008 28.9565 8.85510 748.928 28.7880 8.72553 761.042 28.5873 8.59787 773.351 28.3520 8.47206 785.859 28.0785 8.34810 798.570 27.7613 8.22595 811.486 27.3907 8.10559 824.611 26.9618 8.00244 837.949 26.4780 7.90943 851.502 25.9263 7.81610 865.274 25.2829 7.72213 879.269 24.5191 7.62775 893.491 23.5963 7.53470 907.943 22.4533 7.44273 922.628 20.9847 7.35182 937.551 18.9853 7.26190 952.715 15.9668 7.17320 968.124 10.1461 7.08567 980.300 -25.8273 7.01823 980.500 -25.8174 30.7219 983.783 0.859304 30.6554 999.695 14.3488 30.3385 1015.86 19.2163 30.0249 1032.29 22.3241 29.7144 1048.99 24.6368 29.4026 1065.96 26.4843 29.0894 1083.20 28.0232 28.7791 1100.72 29.3419 28.4723 1118.52 30.4927 28.1687 1136.61 31.5091 27.8684 1155. 32.4129 27.5713 1173.68 33.2178 27.2773 1192.66 33.9308 26.9865 1211.95 34.5560 26.6988 1231.55 35.0253 26.4141 1251.47 35.4044 26.2596 1271.72 35.7000 26.2460 1292.29 36.0786 26.4066 1313.19 36.5792 26.5685 1334.43 37.1219 26.7313 1356.01 37.7021 26.8951 1377.94 38.3188 27.0598 1400.23 38.9752 27.2255 1422.88 39.6786 27.3925 1445.89 40.4682 27.5602 1469.28 41.3426 27.6703 1493.04 42.4056 27.6910 1517.19 43.3936 27.3355 1541.73 44.1311 26.9327 1566.67 44.5910 26.5355 1592.01 45.2242 26.6854 1617.76 46.2797 26.6496 1643.92 47.2114 26.0927 1670.51 47.9308 25.5476 1697.53 48.5550 25.0139 1724.99 49.1179 24.4911 1752.89 49.6298 23.9680 1781.24 50.0955 23.4524 1810.05 50.5201 22.9454 1839.32 50.9101 22.4491 1869.07 51.2701 21.9636 1899.30 51.6038 21.4888 1930.02 51.9139 21.0240 1961.24 52.2032 20.5692 1992.96 52.4700 20.1243 2025.20 52.7263 19.6972 2057.95 52.9696 19.2645 2091.24 53.1932 18.8393 2125.06 53.3999 18.4230 2159.43 53.5920 18.0145 2194.36 53.7704 17.6142 2229.85 53.9359 17.2215 2265.92 54.0892 16.8368 2302.57 54.2311 16.4598 2339.81 54.3625 16.0907 2377.66 54.4839 15.7286 2416.11 54.5951 15.3739 2455.19 54.6974 15.0270 2494.90 54.7909 14.6870 2535.26 54.8765 14.3546 2576.26 54.9545 14.0286 2617.93 55.0249 13.7097 2660.27 55.0883 13.3972 2703.30 55.1450 13.0916 2747.03 55.1951 12.7922 2791.46 55.2391 12.4994 2836.61 55.2772 12.2128 2882.49 55.3096 11.9324 2929.11 55.3365 11.6580 2976.48 55.3583 11.3898 3024.63 55.3751 11.1271 3073.55 55.3871 10.8703 3123.26 55.3946 10.6191 3173.78 55.3974 10.3730 3225.11 55.3957 10.1325 3277.27 55.3897 9.89734 3330.28 55.3796 9.66730 3384.15 55.3654 9.44227 3438.88 55.3471 9.22229 3494.50 55.3249 9.00711 3551.02 55.2987 8.79672 3608.46 55.2687 8.59094 3666.82 55.2348 8.38972 3726.13 55.1969 8.19303 3786.40 55.1552 8.00057 3847.64 55.1095 7.81246 3909.87 55.0596 7.62852 3973.11 55.0057 7.44875 4037.38 54.9476 7.27286 4102.68 54.8850 7.10092 4169.03 54.8178 6.93282 4236.46 54.7458 6.76845 4304.98 54.6687 6.60781 4374.62 54.5863 6.45068 4445.37 54.4981 6.29709 4517.27 54.4036 6.14683 4590.33 54.3024 6.00002 4664.58 54.1939 5.85642 4740.03 54.0771 5.71608 4816.69 53.9515 5.57886 4894.60 53.8157 5.44470 4973.77 53.6686 5.31339 5054.21 53.5083 5.18514 5135.96 53.3329 5.05973 5219.03 53.1399 4.93713 5303.44 52.9259 4.81724 5389.22 52.6865 4.69991 5476.39 52.4157 4.58522 5564.97 52.1050 4.47313 5654.98 51.7422 4.36354 5746.44 51.3081 4.25634 5839.39 50.7700 4.15152 5933.83 50.0657 4.04902 6029.81 49.0497 3.94875 6127.33 47.2044 3.85081 6207.80 31.7487 3.77297 6208. 31.7498 11.0531 6226.44 43.8759 10.9923 6327.15 48.1261 10.6691 6429.48 49.3300 10.3557 6533.48 49.7840 10.0514 6639.15 49.5221 9.75605 6721.40 42.2022 9.53530 6721.60 42.2035 13.1642 6746.54 48.7031 13.0766 6855.65 51.0062 12.7039 6966.54 51.8556 12.3419 7079.22 52.0080 11.9902 7125.90 49.0533 11.8491 7126.10 49.0562 13.5465 7193.72 52.8043 13.3659 7310.07 53.8693 13.0645 7428.31 54.5943 12.7674 7548.45 55.1767 12.4744 7670.54 55.6703 12.1855 7794.61 56.0998 11.9013 7920.68 56.4798 11.6218 8048.79 56.8197 11.3465 8178.98 57.1254 11.0758 8311.26 57.4023 10.8099 8445.69 57.6540 10.5490 8582.29 57.8837 10.2925 8721.11 58.0935 10.0406 8862.16 58.2855 9.79365 9005.50 58.4615 9.55146 9151.16 58.6230 9.31408 9299.17 58.7712 9.08115 9449.58 58.9072 8.85304 9602.42 59.0320 8.62965 9757.73 59.1464 8.41092 9915.55 59.2514 8.19703 10075.9 59.3478 7.98739 10238.9 59.4357 7.78227 10404.5 59.5160 7.58162 10572.8 59.5891 7.38539 10743.8 59.6556 7.19353 10917.6 59.7160 7.00599 11094.2 59.7705 6.82271 11273.6 59.8196 6.64362 11455.9 59.8637 6.46868 11641.2 59.9030 6.29781 11829.5 59.9378 6.13096 12020.8 59.9685 5.96805 12215.3 59.9954 5.80903 12412.8 60.0185 5.65384 12613.6 60.0382 5.50239 12817.6 60.0548 5.35463 13025.0 60.0683 5.21049 13235.6 60.0790 5.06991 13449.7 60.0870 4.93281 13667.2 60.0926 4.79912 13888.3 60.0958 4.66879 14112.9 60.0969 4.54173 14341.2 60.0959 4.41790 14573.1 60.0931 4.29722 14808.9 60.0884 4.17962 15048.4 60.0821 4.06505 15291.8 60.0742 3.95343 15539.1 60.0648 3.84470 15790.4 60.0541 3.73880 16045.8 60.0421 3.63566 16305.4 60.0290 3.53523 16569.1 60.0147 3.43744 16837.1 59.9993 3.34224 17109.4 59.9830 3.24956 17386.1 59.9658 3.15934 17667.4 59.9478 3.07153 17953.1 59.9289 2.98607 18243.5 59.9094 2.90290 18538.6 59.8891 2.82197 18838.4 59.8682 2.74323 19143.1 59.8468 2.66662 19452.7 59.8247 2.59209 19767.4 59.8022 2.51959 20087.1 59.7791 2.44907 20412.0 59.7556 2.38048 20742.1 59.7317 2.31377 21077.6 59.7073 2.24889 21418.5 59.6826 2.18580 21765.0 59.6574 2.12446 22117.0 59.6320 2.06481 22474.7 59.6061 2.00681 22838.2 59.5800 1.95043 23207.6 59.5535 1.89562 23583.0 59.5267 1.84233 23964.4 59.4995 1.79053 24352.0 59.4720 1.74019 24745.9 59.4442 1.69125 25146.2 59.4160 1.64369 25552.9 59.3875 1.59747 25966.2 59.3585 1.55255 26386.1 59.3292 1.50889 26812.9 59.2994 1.46647 27246.6 59.2691 1.42525 27687.3 59.2384 1.38520 28135.1 59.2070 1.34629 28590.2 59.1751 1.30848 29052.6 59.1425 1.27175 29522.5 59.1091 1.23606 30000.0 59.0749 1.20139 periodictable-1.5.0/periodictable/xsf/ne.nff000066400000000000000000000326571310514471200210410ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.479576E-15 10.1617 -9999. 0.487333E-15 10.3261 -9999. 0.495215E-15 10.4931 -9999. 0.503225E-15 10.6628 -9999. 0.511364E-15 10.8353 -9999. 0.519635E-15 11.0106 -9999. 0.528040E-15 11.1886 -9999. 0.536580E-15 11.3696 -9999. 0.545259E-15 11.5535 -9999. 0.554078E-15 11.7404 -9999. 0.563040E-15 11.9303 -9999. 0.572147E-15 12.1232 -9999. 0.581401E-15 12.3193 -9999. 0.590805E-15 12.5186 -9999. 0.600361E-15 12.7210 -9999. 0.610071E-15 12.9268 -9999. 0.619938E-15 13.1359 -9999. 0.629965E-15 13.3483 -9999. 0.640155E-15 13.5642 -9999. 0.650509E-15 13.7836 -9999. 0.661030E-15 14.0066 -9999. 0.671722E-15 14.2331 -9999. 0.682586E-15 14.4633 -9999. 0.693627E-15 14.6973 -9999. 0.704846E-15 14.9350 -9999. 0.716246E-15 15.1765 -9999. 0.727831E-15 15.4220 -9999. 0.739603E-15 15.6714 -9999. 0.751565E-15 15.9249 -9999. 0.763721E-15 16.1825 -9999. 0.776074E-15 16.4442 -9999. 0.788626E-15 16.7102 -9999. 0.801382E-15 16.9805 -9999. 0.814343E-15 17.2551 -9999. 0.827515E-15 17.5342 -9999. 0.840899E-15 17.8178 -9999. 0.854500E-15 18.1060 -9999. 0.868321E-15 18.3989 -9999. 0.882365E-15 18.6964 -9999. 0.896637E-15 18.9988 -9999. 0.911139E-15 19.3061 -9999. 0.925876E-15 19.6184 -9999. 0.940852E-15 19.9357 -9999. 0.956069E-15 20.2582 -9999. 0.971533E-15 20.5858 -9999. 0.987247E-15 20.9188 -9999. 0.100321E-14 21.2571 -9999. 0.101944E-14 21.5000 -9999. 0.103109E-14 21.7000 -9999. 1.79139 21.9503 -9999. 1.95643 22.3053 -9999. 2.21315 22.6661 -9999. 2.50079 23.0327 -9999. 2.64889 23.4053 -9999. 2.78606 23.7838 -9999. 2.90136 24.1685 -9999. 3.01168 24.5594 -9999. 3.10817 24.9566 -9999. 3.20074 25.3603 -9999. 3.28061 25.7705 -9999. 3.36247 26.1873 -9999. 3.44638 26.6109 -9999. 3.51648 27.0413 -9999. 3.57443 27.4786 -9999. 3.63332 27.9231 -9999. 3.69319 28.3747 -9999. 3.72541 28.8337 -9999. 3.75454 29.3000 -0.722786 3.78390 29.7739 -0.638325 3.80667 30.2555 -0.572576 3.80777 30.7449 -0.547169 3.80887 31.2421 -0.527238 3.86953 31.7475 -0.488279 3.93403 32.2609 -0.439885 4.00099 32.7827 -0.385659 4.06909 33.3130 -0.321160 4.13833 33.8518 -0.252235 4.19845 34.3993 -0.186891 4.25469 34.9557 -0.122622 4.31170 35.5211 -0.582012E-01 4.36946 36.0956 0.674596E-02 4.42800 36.6794 0.716378E-01 4.48853 37.2727 0.139639 4.55288 37.8755 0.212833 4.61816 38.4882 0.291005 4.68437 39.1107 0.377165 4.75153 39.7432 0.479881 4.81744 40.3861 0.583162 4.85348 41.0393 0.675584 4.88980 41.7031 0.785214 4.92638 42.3776 0.886627 4.92330 43.0630 0.950661 4.91981 43.7595 0.995369 4.92915 44.4673 1.04260 4.96679 45.1865 1.09860 5.00472 45.9174 1.15509 5.04294 46.6600 1.21056 5.08375 47.4147 1.26770 5.12979 48.1816 1.32690 5.17624 48.9609 1.38098 5.22312 49.7528 1.43043 5.27991 50.5576 1.49011 5.35683 51.3753 1.56422 5.43488 52.2062 1.65650 5.51407 53.0506 1.75929 5.57909 53.9087 1.85924 5.63469 54.7806 1.95960 5.69085 55.6667 2.06458 5.74756 56.5670 2.18172 5.80484 57.4820 2.30444 5.83933 58.4117 2.41966 5.86771 59.3564 2.53134 5.89623 60.3165 2.65269 5.92489 61.2921 2.76610 5.91786 62.2834 2.84275 5.90994 63.2908 2.91410 5.95107 64.3145 3.00481 5.99250 65.3547 3.10324 6.03421 66.4118 3.20810 6.07621 67.4859 3.31970 6.11849 68.5775 3.43868 6.16108 69.6867 3.58000 6.20396 70.8138 3.73593 6.22061 71.9591 3.87602 6.20429 73.1230 3.99693 6.18801 74.3057 4.10545 6.17671 75.5076 4.21230 6.17497 76.7289 4.32332 6.17323 77.9699 4.43449 6.17149 79.2310 4.54643 6.16951 80.5125 4.65930 6.16729 81.8147 4.77363 6.16507 83.1380 4.89047 6.16286 84.4827 5.01150 6.16065 85.8491 5.14335 6.15843 87.2377 5.27923 6.13190 88.6487 5.40393 6.09959 90.0825 5.52126 6.06745 91.5395 5.63579 6.03548 93.0201 5.74841 6.00367 94.5246 5.86002 5.97204 96.0535 5.96754 5.94057 97.6071 6.07102 5.91640 99.1858 6.21026 5.91586 100.790 6.36239 5.86022 102.420 6.49005 5.80511 104.077 6.62335 5.74533 105.760 6.74851 5.66045 107.471 6.85669 5.57681 109.209 6.95637 5.49442 110.975 7.04990 5.41324 112.770 7.13870 5.33326 114.594 7.22406 5.25446 116.448 7.30822 5.17522 118.331 7.38800 5.09217 120.245 7.46106 5.01045 122.190 7.53053 4.93005 124.166 7.59679 4.85093 126.175 7.66034 4.77309 128.215 7.72164 4.69648 130.289 7.78103 4.62112 132.397 7.84246 4.54697 134.538 7.90168 4.46606 136.714 7.95319 4.38620 138.925 8.00152 4.30777 141.172 8.04685 4.23074 143.456 8.08951 4.15509 145.776 8.12971 4.08079 148.134 8.16754 4.00782 150.530 8.20301 3.93615 152.964 8.23612 3.86577 155.439 8.26330 3.79664 157.953 8.28781 3.73619 160.507 8.31714 3.68212 163.103 8.35015 3.62882 165.742 8.38588 3.57630 168.422 8.42488 3.52453 171.146 8.46918 3.47352 173.915 8.52709 3.42324 176.727 8.60566 3.33971 179.586 8.63273 3.18737 182.491 8.60965 3.12893 185.442 8.61713 3.06989 188.442 8.62845 3.01163 191.489 8.64103 2.95426 194.587 8.65396 2.89868 197.734 8.66744 2.84434 200.932 8.68132 2.79115 204.182 8.69565 2.73904 207.485 8.71077 2.68788 210.840 8.72822 2.63765 214.251 8.74635 2.58158 217.716 8.76064 2.52530 221.237 8.77223 2.46916 224.816 8.78174 2.41430 228.452 8.78979 2.36065 232.147 8.79661 2.30819 235.902 8.80235 2.25686 239.717 8.80715 2.20669 243.595 8.81111 2.15765 247.535 8.81436 2.10972 251.538 8.81697 2.06282 255.607 8.81896 2.01694 259.741 8.82046 1.97218 263.942 8.82164 1.92836 268.211 8.82249 1.88543 272.549 8.82346 1.84358 276.957 8.82493 1.80142 281.437 8.82552 1.75865 285.989 8.82447 1.71610 290.615 8.82217 1.67444 295.315 8.81886 1.63373 300.092 8.81476 1.59405 304.945 8.81001 1.55535 309.878 8.80468 1.51761 314.890 8.79880 1.48071 319.983 8.79238 1.44471 325.158 8.78549 1.40962 330.418 8.77817 1.37537 335.762 8.77043 1.34195 341.192 8.76232 1.30936 346.711 8.75385 1.27755 352.319 8.74505 1.24651 358.017 8.73594 1.21623 363.808 8.72656 1.18669 369.692 8.71694 1.15786 375.672 8.70715 1.12973 381.748 8.69761 1.10229 387.922 8.68824 1.07477 394.197 8.67788 1.04635 400.573 8.66621 1.01886 407.052 8.65390 0.992161 413.635 8.64100 0.966161 420.326 8.62755 0.940839 427.124 8.61357 0.916181 434.032 8.59908 0.892172 441.052 8.58410 0.868792 448.186 8.56866 0.846004 455.435 8.55270 0.823712 462.802 8.53615 0.801953 470.287 8.51899 0.780739 477.894 8.50122 0.760082 485.623 8.48282 0.739973 493.478 8.46377 0.720396 501.459 8.44404 0.701336 509.570 8.42359 0.682789 517.812 8.40239 0.664740 526.187 8.38037 0.647177 534.698 8.35750 0.630129 543.346 8.33378 0.613550 552.134 8.30914 0.597392 561.065 8.28343 0.581446 570.139 8.25634 0.565869 579.361 8.22785 0.550989 588.732 8.19810 0.536590 598.254 8.16694 0.522623 607.930 8.13419 0.509022 617.763 8.09971 0.495782 627.755 8.06333 0.482858 637.908 8.02490 0.469866 648.226 7.98369 0.456687 658.711 7.93886 0.443532 669.365 7.88993 0.430757 680.191 7.83651 0.419564 691.193 7.77932 0.409597 702.372 7.71813 0.400185 713.733 7.65152 0.390453 725.277 7.57766 0.380595 737.008 7.49521 0.370963 748.928 7.40231 0.361591 761.042 7.29647 0.352460 773.351 7.17415 0.343481 785.859 7.03000 0.334490 798.570 6.85573 0.325538 811.486 6.63820 0.316826 824.611 6.35358 0.308346 837.949 5.95155 0.300094 851.502 5.29351 0.292063 865.274 3.59708 0.284248 870.100 -1.59786 0.281588 870.300 -1.59368 4.51161 879.269 4.56045 4.44449 893.491 5.91462 4.34146 907.943 6.62676 4.24078 922.628 7.11804 4.14240 937.551 7.49445 4.04632 952.715 7.79960 3.95247 968.124 8.05596 3.86078 983.783 8.27687 3.77122 999.695 8.47121 3.68310 1015.86 8.64476 3.59637 1032.29 8.79982 3.50583 1048.99 8.93632 3.41781 1065.96 9.05890 3.33231 1083.20 9.16978 3.24896 1100.72 9.27054 3.16769 1118.52 9.36245 3.08843 1136.61 9.44655 3.01119 1155. 9.52375 2.93587 1173.68 9.59478 2.86243 1192.66 9.66028 2.79083 1211.95 9.72084 2.72102 1231.55 9.77699 2.65295 1251.47 9.82924 2.58624 1271.72 9.87761 2.52088 1292.29 9.92223 2.45679 1313.19 9.96338 2.39428 1334.43 10.0014 2.33337 1356.01 10.0366 2.27403 1377.94 10.0693 2.21618 1400.23 10.0997 2.15980 1422.88 10.1279 2.10484 1445.89 10.1543 2.05128 1469.28 10.1790 1.99890 1493.04 10.2023 1.94758 1517.19 10.2240 1.89639 1541.73 10.2432 1.84637 1566.67 10.2607 1.79766 1592.01 10.2767 1.75022 1617.76 10.2912 1.70405 1643.92 10.3045 1.65912 1670.51 10.3167 1.61535 1697.53 10.3278 1.57273 1724.99 10.3383 1.53124 1752.89 10.3480 1.49017 1781.24 10.3563 1.44996 1810.05 10.3636 1.41060 1839.32 10.3699 1.37235 1869.07 10.3753 1.33513 1899.30 10.3800 1.29892 1930.02 10.3840 1.26371 1961.24 10.3874 1.22944 1992.96 10.3901 1.19608 2025.20 10.3926 1.16410 2057.95 10.3950 1.13218 2091.24 10.3964 1.10097 2125.06 10.3973 1.07062 2159.43 10.3978 1.04110 2194.36 10.3979 1.01223 2229.85 10.3976 0.984136 2265.92 10.3969 0.956770 2302.57 10.3958 0.930103 2339.81 10.3944 0.904127 2377.66 10.3927 0.878825 2416.11 10.3907 0.854188 2455.19 10.3885 0.830187 2494.90 10.3860 0.806817 2535.26 10.3833 0.784061 2576.26 10.3804 0.761901 2617.93 10.3774 0.740321 2660.27 10.3741 0.719320 2703.30 10.3707 0.698870 2747.03 10.3671 0.678965 2791.46 10.3634 0.659589 2836.61 10.3596 0.640726 2882.49 10.3557 0.622378 2929.11 10.3516 0.604504 2976.48 10.3475 0.587115 3024.63 10.3433 0.570193 3073.55 10.3390 0.553728 3123.26 10.3347 0.537703 3173.78 10.3303 0.522116 3225.11 10.3259 0.506956 3277.27 10.3214 0.492196 3330.28 10.3169 0.477824 3384.15 10.3124 0.463861 3438.88 10.3078 0.450268 3494.50 10.3032 0.437039 3551.02 10.2986 0.424180 3608.46 10.2940 0.411660 3666.82 10.2894 0.399495 3726.13 10.2848 0.387646 3786.40 10.2802 0.376136 3847.64 10.2756 0.364929 3909.87 10.2711 0.354038 3973.11 10.2665 0.343434 4037.38 10.2620 0.333068 4102.68 10.2574 0.323058 4169.03 10.2529 0.313321 4236.46 10.2483 0.303851 4304.98 10.2439 0.294663 4374.62 10.2394 0.285729 4445.37 10.2350 0.277040 4517.27 10.2306 0.268603 4590.33 10.2263 0.260404 4664.58 10.2220 0.252455 4740.03 10.2177 0.244712 4816.69 10.2135 0.237208 4894.60 10.2093 0.229920 4973.77 10.2052 0.222838 5054.21 10.2011 0.215963 5135.96 10.1970 0.209289 5219.03 10.1930 0.202809 5303.44 10.1891 0.196519 5389.22 10.1852 0.190412 5476.39 10.1813 0.184485 5564.97 10.1775 0.178735 5654.98 10.1738 0.173151 5746.44 10.1701 0.167735 5839.39 10.1664 0.162478 5933.83 10.1628 0.157379 6029.81 10.1593 0.152431 6127.33 10.1558 0.147632 6226.44 10.1524 0.142974 6327.15 10.1490 0.138457 6429.48 10.1457 0.134077 6533.48 10.1424 0.129827 6639.15 10.1392 0.125706 6746.54 10.1360 0.121709 6855.65 10.1329 0.117834 6966.54 10.1298 0.114074 7079.22 10.1268 0.110431 7193.72 10.1239 0.106898 7310.07 10.1210 0.103474 7428.31 10.1181 0.100154 7548.45 10.1153 0.969350E-01 7670.54 10.1126 0.938140E-01 7794.61 10.1099 0.907908E-01 7920.68 10.1072 0.878584E-01 8048.79 10.1046 0.850180E-01 8178.98 10.1021 0.822656E-01 8311.26 10.0996 0.795985E-01 8445.69 10.0971 0.770135E-01 8582.29 10.0947 0.745080E-01 8721.11 10.0923 0.720825E-01 8862.16 10.0900 0.697322E-01 9005.50 10.0878 0.674551E-01 9151.16 10.0855 0.652458E-01 9299.17 10.0834 0.631096E-01 9449.58 10.0812 0.610392E-01 9602.42 10.0791 0.590324E-01 9757.73 10.0771 0.570907E-01 9915.55 10.0751 0.552107E-01 10075.9 10.0731 0.533891E-01 10238.9 10.0712 0.516251E-01 10404.5 10.0693 0.499169E-01 10572.8 10.0675 0.482630E-01 10743.8 10.0657 0.466616E-01 10917.6 10.0639 0.451112E-01 11094.2 10.0622 0.436103E-01 11273.6 10.0605 0.421572E-01 11455.9 10.0588 0.407507E-01 11641.2 10.0572 0.393893E-01 11829.5 10.0556 0.380715E-01 12020.8 10.0541 0.367961E-01 12215.3 10.0526 0.355617E-01 12412.8 10.0511 0.343672E-01 12613.6 10.0496 0.332113E-01 12817.6 10.0482 0.320928E-01 13025.0 10.0468 0.310105E-01 13235.6 10.0455 0.299634E-01 13449.7 10.0442 0.289504E-01 13667.2 10.0429 0.279703E-01 13888.3 10.0416 0.270223E-01 14112.9 10.0404 0.261052E-01 14341.2 10.0392 0.252182E-01 14573.1 10.0380 0.243603E-01 14808.9 10.0369 0.235306E-01 15048.4 10.0357 0.227282E-01 15291.8 10.0346 0.219522E-01 15539.1 10.0336 0.212020E-01 15790.4 10.0325 0.204765E-01 16045.8 10.0315 0.197751E-01 16305.4 10.0305 0.190970E-01 16569.1 10.0295 0.184415E-01 16837.1 10.0286 0.178078E-01 17109.4 10.0277 0.171953E-01 17386.1 10.0268 0.166034E-01 17667.4 10.0259 0.160312E-01 17953.1 10.0250 0.154784E-01 18243.5 10.0242 0.149441E-01 18538.6 10.0234 0.144279E-01 18838.4 10.0226 0.139291E-01 19143.1 10.0218 0.134472E-01 19452.7 10.0210 0.129817E-01 19767.4 10.0203 0.125320E-01 20087.1 10.0195 0.121005E-01 20412.0 10.0188 0.116811E-01 20742.1 10.0182 0.112763E-01 21077.6 10.0175 0.108855E-01 21418.5 10.0168 0.105083E-01 21765.0 10.0162 0.101442E-01 22117.0 10.0156 0.979270E-02 22474.7 10.0150 0.945338E-02 22838.2 10.0144 0.912581E-02 23207.6 10.0138 0.880958E-02 23583.0 10.0132 0.850428E-02 23964.4 10.0127 0.820956E-02 24352.0 10.0122 0.792501E-02 24745.9 10.0117 0.765031E-02 25146.2 10.0112 0.738508E-02 25552.9 10.0107 0.712903E-02 25966.2 10.0102 0.688181E-02 26386.1 10.0097 0.664311E-02 26812.9 10.0093 0.641266E-02 27246.6 10.0088 0.619014E-02 27687.3 10.0084 0.597531E-02 28135.1 10.0080 0.576787E-02 28590.2 10.0076 0.556759E-02 29052.6 10.0072 0.537420E-02 29522.5 10.0068 0.518748E-02 30000.0 10.0064 0.500718E-02 periodictable-1.5.0/periodictable/xsf/ni.nff000066400000000000000000000314651310514471200210410ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.37727 10.1617 -9999. 1.38064 10.3261 -9999. 1.38401 10.4931 -9999. 1.38740 10.6628 -9999. 1.39079 10.8353 -9999. 1.39419 11.0106 -9999. 1.39982 11.1886 -9999. 1.44104 11.3696 -9999. 1.48347 11.5535 -9999. 1.52716 11.7404 -9999. 1.57212 11.9303 -9999. 1.61841 12.1232 -9999. 1.66663 12.3193 -9999. 1.71662 12.5186 -9999. 1.76810 12.7210 -9999. 1.82113 12.9268 -9999. 1.87575 13.1359 -9999. 1.93142 13.3483 -9999. 1.98842 13.5642 -9999. 2.04710 13.7836 -9999. 2.10752 14.0066 -9999. 2.16971 14.2331 -9999. 2.23204 14.4633 -9999. 2.28582 14.6973 -9999. 2.34091 14.9350 -9999. 2.39732 15.1765 -9999. 2.45509 15.4220 -9999. 2.51425 15.6714 -9999. 2.57140 15.9249 -9999. 2.62103 16.1825 -9999. 2.67162 16.4442 -9999. 2.72318 16.7102 -9999. 2.77574 16.9805 -9999. 2.82931 17.2551 -9999. 2.88392 17.5342 -9999. 2.93007 17.8178 -9999. 2.97110 18.1060 -9999. 3.01271 18.3989 -9999. 3.05491 18.6964 -9999. 3.09769 18.9988 -9999. 3.14107 19.3061 -9999. 3.11470 19.6184 -9999. 3.09192 19.9357 -9999. 3.09990 20.2582 -9999. 3.10790 20.5858 -9999. 3.11592 20.9188 -9999. 3.12491 21.2571 -9999. 3.16974 21.6009 -9999. 3.21521 21.9503 -9999. 3.26133 22.3053 -9999. 3.34677 22.6661 -9999. 3.44429 23.0327 -9999. 3.54465 23.4053 -9999. 3.64793 23.7838 -9999. 3.75422 24.1685 -9999. 3.80593 24.5594 -9999. 3.83313 24.9566 -9999. 3.86051 25.3603 -9999. 3.88809 25.7705 -9999. 3.91587 26.1873 -9999. 3.90685 26.6109 -9999. 3.88468 27.0413 -9999. 3.86263 27.4786 -9999. 3.84070 27.9231 -9999. 3.81412 28.3747 -9999. 3.77863 28.8337 -9999. 3.74347 29.3000 4.07489 3.70864 29.7739 4.11878 3.67413 30.2555 4.15559 3.63994 30.7449 4.18799 3.60945 31.2421 4.21844 3.57991 31.7475 4.24569 3.55062 32.2609 4.26954 3.52157 32.7827 4.28991 3.49275 33.3130 4.30665 3.46417 33.8518 4.31936 3.43582 34.3993 4.32706 3.40771 34.9557 4.33038 3.38228 35.5211 4.33103 3.36017 36.0956 4.32965 3.33819 36.6794 4.32479 3.31636 37.2727 4.31550 3.29467 37.8755 4.30020 3.27312 38.4882 4.27468 3.25172 39.1107 4.24425 3.25034 39.7432 4.21830 3.25005 40.3861 4.19406 3.24976 41.0393 4.16743 3.24947 41.7031 4.13541 3.24918 42.3776 4.09414 3.24888 43.0630 4.04770 3.26499 43.7595 4.00654 3.28972 44.4673 3.96885 3.31464 45.1865 3.93122 3.33976 45.9174 3.89203 3.36506 46.6600 3.85034 3.39055 47.4147 3.79831 3.41624 48.1816 3.73782 3.44854 48.9609 3.68007 3.50082 49.7528 3.62828 3.55389 50.5576 3.57767 3.60778 51.3753 3.52588 3.66247 52.2062 3.47153 3.71800 53.0506 3.41420 3.77753 53.9087 3.35497 3.83910 54.7806 3.29249 3.90168 55.6667 3.22528 3.96528 56.5670 3.15250 4.02991 57.4820 3.07820 4.09444 58.4117 2.98535 4.14027 59.3564 2.86335 4.18662 60.3165 2.70077 4.23349 61.2921 2.45011 4.30894 62.2834 2.18829 4.47415 63.2908 1.90363 4.64568 64.3145 1.52278 4.82379 65.3547 1.00050 5.35920 66.4118 0.712900 6.16858 67.4859 0.694467 7.10021 68.5775 1.10772 8.17252 69.6867 1.75751 8.50016 70.8138 2.26228 8.79611 71.9591 2.71469 9.08103 73.1230 3.15797 9.20206 74.3057 3.49643 9.32471 75.5076 3.81415 9.44899 76.7289 4.14091 9.57493 77.9699 4.46124 9.64899 79.2310 4.75594 9.70549 80.5125 5.03118 9.76232 81.8147 5.30150 9.81950 83.1380 5.58627 9.87699 84.4827 5.88145 9.86813 85.8491 6.12735 9.84309 87.2377 6.34846 9.81811 88.6487 6.55119 9.79320 90.0825 6.73894 9.76835 91.5395 6.90617 9.74356 93.0201 7.04896 9.73075 94.5246 7.19681 9.74377 96.0535 7.35361 9.75681 97.6071 7.51027 9.76987 99.1858 7.66641 9.78295 100.790 7.82189 9.79605 102.420 7.97682 9.80915 104.077 8.13160 9.82228 105.760 8.28712 9.83543 107.471 8.44647 9.84860 109.209 8.60494 9.84981 110.975 8.75933 9.84820 112.770 8.90703 9.84660 114.594 9.05240 9.84499 116.448 9.19571 9.84339 118.331 9.33813 9.84179 120.245 9.48087 9.84019 122.190 9.62523 9.82776 124.166 9.75819 9.81204 126.175 9.88397 9.79634 128.215 10.0028 9.78065 130.289 10.1138 9.76501 132.397 10.2099 9.74938 134.538 10.2682 9.73377 136.714 10.3327 9.79365 138.925 10.4316 9.86007 141.172 10.5474 9.92692 143.456 10.6757 9.99425 145.776 10.8152 10.0620 148.134 10.9657 10.1303 150.530 11.1282 10.1990 152.964 11.3049 10.2681 155.439 11.4992 10.3378 157.953 11.7511 10.3978 160.507 12.0042 10.3668 163.103 12.2017 10.3359 165.742 12.3889 10.3051 168.422 12.5688 10.2744 171.146 12.7435 10.2438 173.915 12.9142 10.2133 176.727 13.0823 10.1829 179.586 13.2484 10.1525 182.491 13.4134 10.1223 185.442 13.5780 10.0921 188.442 13.7429 10.0621 191.489 13.9091 10.0321 194.587 14.0776 10.0022 197.734 14.2497 9.97242 200.932 14.4351 9.94271 204.182 14.6388 9.91308 207.485 14.8440 9.82709 210.840 15.0233 9.73137 214.251 15.1866 9.63658 217.716 15.3400 9.54272 221.237 15.4860 9.44977 224.816 15.6259 9.35773 228.452 15.7608 9.26659 232.147 15.8913 9.17632 235.902 16.0179 9.08694 239.717 16.1412 8.99844 243.595 16.2616 8.91079 247.535 16.3794 8.82399 251.538 16.4950 8.73804 255.607 16.6088 8.65294 259.741 16.7212 8.56865 263.942 16.8328 8.48520 268.211 16.9440 8.40255 272.549 17.0559 8.32070 276.957 17.1684 8.23966 281.437 17.2961 8.15940 285.989 17.4280 8.06947 290.615 17.5535 7.94306 295.315 17.6582 7.81865 300.092 17.7522 7.69617 304.945 17.8383 7.57562 309.878 17.9182 7.45695 314.890 17.9926 7.34015 319.983 18.0622 7.22517 325.158 18.1275 7.11199 330.418 18.1890 7.00059 335.762 18.2469 6.89094 341.192 18.3016 6.78300 346.711 18.3535 6.67675 352.319 18.4028 6.57216 358.017 18.4502 6.46922 363.808 18.4964 6.36788 369.692 18.5455 6.26813 375.672 18.5909 6.15792 381.748 18.6295 6.04599 387.922 18.6603 5.93609 394.197 18.6861 5.82819 400.573 18.7075 5.72225 407.052 18.7250 5.61823 413.635 18.7389 5.51611 420.326 18.7492 5.41584 427.124 18.7562 5.31740 434.032 18.7599 5.22074 441.052 18.7606 5.12584 448.186 18.7582 5.03267 455.435 18.7530 4.94119 462.802 18.7451 4.85137 470.287 18.7346 4.76319 477.894 18.7219 4.67661 485.623 18.7078 4.59160 493.478 18.6944 4.50813 501.459 18.6841 4.41984 509.570 18.6676 4.31530 517.812 18.6345 4.21322 526.187 18.5923 4.11356 534.698 18.5425 4.01626 543.346 18.4853 3.92125 552.134 18.4207 3.82850 561.065 18.3488 3.73793 570.139 18.2691 3.64952 579.361 18.1812 3.56319 588.732 18.0845 3.47890 598.254 17.9775 3.39661 607.930 17.8558 3.31626 617.763 17.7261 3.25118 627.755 17.5904 3.19090 637.908 17.4496 3.13174 648.226 17.2992 3.07368 658.711 17.1372 3.01669 669.365 16.9618 2.96076 680.191 16.7709 2.90587 691.193 16.5627 2.85199 702.372 16.3354 2.79911 713.733 16.0924 2.74722 725.277 15.8265 2.66726 737.008 15.4916 2.54699 748.928 15.0476 2.43214 761.042 14.5541 2.40333 773.351 13.9833 2.35520 785.859 13.2954 2.31346 798.570 12.4407 2.27693 811.486 11.3146 2.24149 824.611 9.68933 2.20661 837.949 6.86521 2.17229 851.502 -4.77850 2.13850 852.600 -16.5847 2.13581 852.800 -16.5694 17.1612 865.274 6.89208 16.8200 879.269 10.6978 16.4508 893.491 12.9007 16.0897 907.943 14.4482 15.7365 922.628 15.6208 15.3911 937.551 16.5503 15.0686 952.715 17.2837 14.7422 968.124 17.7758 14.4139 983.783 18.0717 14.2733 999.695 18.1198 14.5442 1015.86 19.1887 15.2836 1032.29 20.4147 14.9622 1048.99 21.0748 14.6335 1065.96 21.6619 14.3064 1083.20 22.1779 13.9864 1100.72 22.6378 13.6735 1118.52 23.0529 13.3675 1136.61 23.4306 13.0684 1155. 23.7764 12.7760 1173.68 24.0946 12.4902 1192.66 24.3887 12.2108 1211.95 24.6617 11.9376 1231.55 24.9164 11.6705 1251.47 25.1548 11.4073 1271.72 25.3771 11.1477 1292.29 25.5830 10.8913 1313.19 25.7736 10.6408 1334.43 25.9511 10.3960 1356.01 26.1167 10.1568 1377.94 26.2716 9.92318 1400.23 26.4168 9.69489 1422.88 26.5534 9.47183 1445.89 26.6824 9.25396 1469.28 26.8062 9.03977 1493.04 26.9235 8.82853 1517.19 27.0337 8.61410 1541.73 27.1321 8.40382 1566.67 27.2219 8.19876 1592.01 27.3047 7.99863 1617.76 27.3809 7.80334 1643.92 27.4513 7.61278 1670.51 27.5164 7.42691 1697.53 27.5768 7.24564 1724.99 27.6340 7.06889 1752.89 27.6875 6.89317 1781.24 27.7356 6.72078 1810.05 27.7780 6.55195 1839.32 27.8161 6.38739 1869.07 27.8503 6.22694 1899.30 27.8808 6.07048 1930.02 27.9082 5.91807 1961.24 27.9323 5.76947 1992.96 27.9538 5.62449 2025.20 27.9735 5.48525 2057.95 27.9917 5.34614 2091.24 28.0074 5.21021 2125.06 28.0198 5.07749 2159.43 28.0301 4.94801 2194.36 28.0381 4.82139 2229.85 28.0443 4.69811 2265.92 28.0487 4.57759 2302.57 28.0512 4.45991 2339.81 28.0520 4.34528 2377.66 28.0512 4.23335 2416.11 28.0492 4.12431 2455.19 28.0457 4.01774 2494.90 28.0409 3.91381 2535.26 28.0351 3.81264 2576.26 28.0280 3.71371 2617.93 28.0198 3.61737 2660.27 28.0107 3.52337 2703.30 28.0006 3.43174 2747.03 27.9897 3.34237 2791.46 27.9780 3.25525 2836.61 27.9654 3.17028 2882.49 27.9522 3.08748 2929.11 27.9383 3.00673 2976.48 27.9237 2.92803 3024.63 27.9086 2.85132 3073.55 27.8929 2.77654 3123.26 27.8767 2.70362 3173.78 27.8600 2.63256 3225.11 27.8428 2.56329 3277.27 27.8251 2.49582 3330.28 27.8071 2.43004 3384.15 27.7887 2.36592 3438.88 27.7699 2.30341 3494.50 27.7507 2.24255 3551.02 27.7313 2.18319 3608.46 27.7115 2.12538 3666.82 27.6914 2.06903 3726.13 27.6710 2.01410 3786.40 27.6503 1.96060 3847.64 27.6293 1.90848 3909.87 27.6081 1.85767 3973.11 27.5866 1.80819 4037.38 27.5648 1.75993 4102.68 27.5427 1.71294 4169.03 27.5203 1.66712 4236.46 27.4977 1.62253 4304.98 27.4748 1.57905 4374.62 27.4516 1.53665 4445.37 27.4281 1.49540 4517.27 27.4043 1.45514 4590.33 27.3801 1.41597 4664.58 27.3555 1.37776 4740.03 27.3305 1.34054 4816.69 27.3052 1.30428 4894.60 27.2794 1.26897 4973.77 27.2531 1.23452 5054.21 27.2262 1.20094 5135.96 27.1988 1.16828 5219.03 27.1708 1.13642 5303.44 27.1421 1.10536 5389.22 27.1127 1.07511 5476.39 27.0824 1.04560 5564.97 27.0512 1.01693 5654.98 27.0190 0.988877 5746.44 26.9857 0.961612 5839.39 26.9511 0.935044 5933.83 26.9152 0.909130 6029.81 26.8777 0.883844 6127.33 26.8384 0.859254 6226.44 26.7972 0.835240 6327.15 26.7536 0.811858 6429.48 26.7075 0.789069 6533.48 26.6584 0.766841 6639.15 26.6058 0.745185 6746.54 26.5492 0.724075 6855.65 26.4878 0.703492 6966.54 26.4206 0.683436 7079.22 26.3466 0.663872 7193.72 26.2639 0.644803 7310.07 26.1706 0.626209 7428.31 26.0635 0.608093 7548.45 25.9382 0.590415 7670.54 25.7876 0.573185 7794.61 25.6001 0.556386 7920.68 25.3543 0.540007 8048.79 25.0030 0.524024 8178.98 24.4098 0.508444 8311.26 22.3857 0.493285 8332.70 16.7028 0.490893 8332.90 16.7033 3.83905 8445.69 24.2527 3.76427 8582.29 25.1541 3.67693 8721.11 25.6675 3.59086 8862.16 26.0303 3.50611 9005.50 26.3112 3.42271 9151.16 26.5399 3.34062 9299.17 26.7321 3.25979 9449.58 26.8971 3.18038 9602.42 27.0410 3.10241 9757.73 27.1679 3.02575 9915.55 27.2808 2.95068 10075.9 27.3820 2.87686 10238.9 27.4733 2.80444 10404.5 27.5558 2.73343 10572.8 27.6307 2.66382 10743.8 27.6989 2.59560 10917.6 27.7611 2.52878 11094.2 27.8180 2.46334 11273.6 27.8700 2.39927 11455.9 27.9176 2.33657 11641.2 27.9613 2.27521 11829.5 28.0013 2.21519 12020.8 28.0380 2.15650 12215.3 28.0716 2.09912 12412.8 28.1024 2.04303 12613.6 28.1306 1.98822 12817.6 28.1564 1.93467 13025.0 28.1800 1.88237 13235.6 28.2014 1.83129 13449.7 28.2210 1.78141 13667.2 28.2388 1.73273 13888.3 28.2549 1.68521 14112.9 28.2694 1.63884 14341.2 28.2826 1.59361 14573.1 28.2943 1.54948 14808.9 28.3048 1.50644 15048.4 28.3141 1.46447 15291.8 28.3224 1.42356 15539.1 28.3296 1.38367 15790.4 28.3358 1.34480 16045.8 28.3412 1.30691 16305.4 28.3457 1.26999 16569.1 28.3494 1.23403 16837.1 28.3524 1.19899 17109.4 28.3547 1.16487 17386.1 28.3564 1.13164 17667.4 28.3575 1.09928 17953.1 28.3581 1.06777 18243.5 28.3581 1.03710 18538.6 28.3577 1.00725 18838.4 28.3568 0.978188 19143.1 28.3555 0.949909 19452.7 28.3539 0.922391 19767.4 28.3518 0.895616 20087.1 28.3495 0.869567 20412.0 28.3468 0.844228 20742.1 28.3439 0.819580 21077.6 28.3407 0.795607 21418.5 28.3373 0.772295 21765.0 28.3336 0.749624 22117.0 28.3298 0.727581 22474.7 28.3257 0.706150 22838.2 28.3216 0.685315 23207.6 28.3172 0.665061 23583.0 28.3127 0.645374 23964.4 28.3081 0.626241 24352.0 28.3034 0.607644 24745.9 28.2986 0.589574 25146.2 28.2937 0.572013 25552.9 28.2888 0.554951 25966.2 28.2838 0.538374 26386.1 28.2787 0.522269 26812.9 28.2736 0.506624 27246.6 28.2684 0.491427 27687.3 28.2632 0.476665 28135.1 28.2581 0.462328 28590.2 28.2529 0.448404 29052.6 28.2480 0.434882 29522.5 28.2436 0.421750 30000.0 28.2337 0.408999 periodictable-1.5.0/periodictable/xsf/o.nff000066400000000000000000000324711310514471200206670ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.703280 10.1617 -9999. 0.707226 10.3261 -9999. 0.707377 10.4931 -9999. 0.707528 10.6628 -9999. 0.707678 10.8353 -9999. 0.707830 11.0106 -9999. 0.707980 11.1886 -9999. 0.708131 11.3696 -9999. 0.708282 11.5535 -9999. 0.708433 11.7404 -9999. 0.708584 11.9303 -9999. 0.710169 12.1232 -9999. 0.712421 12.3193 -9999. 0.714680 12.5186 -9999. 0.716947 12.7210 -9999. 0.719221 12.9268 -9999. 0.721502 13.1359 -9999. 0.723790 13.3483 -9999. 0.726085 13.5642 -9999. 0.733640 13.7836 -9999. 0.746066 14.0066 -9999. 0.758702 14.2331 -9999. 0.771553 14.4633 -9999. 0.784622 14.6973 -9999. 0.801406 14.9350 -9999. 0.832915 15.1765 -9999. 0.865663 15.4220 -9999. 0.899699 15.6714 -9999. 0.973496 15.9249 -9999. 1.07691 16.1825 -9999. 1.19131 16.4442 -9999. 1.31787 16.7102 -9999. 1.45787 16.9805 -9999. 1.61274 17.2551 -9999. 1.78407 17.5342 -9999. 1.97359 17.8178 -9999. 2.19084 18.1060 -9999. 2.44589 18.3989 -9999. 2.73065 18.6964 -9999. 3.04856 18.9988 -9999. 3.31541 19.3061 -9999. 3.47952 19.6184 -9999. 3.65175 19.9357 -9999. 3.77879 20.2582 -9999. 3.83650 20.5858 -9999. 3.89509 20.9188 -9999. 3.95457 21.2571 -9999. 4.01497 21.6009 -9999. 4.07078 21.9503 -9999. 4.11386 22.3053 -9999. 4.15739 22.6661 -9999. 4.20138 23.0327 -9999. 4.24585 23.4053 -9999. 4.29077 23.7838 -9999. 4.33618 24.1685 -9999. 4.37108 24.5594 -9999. 4.39198 24.9566 -9999. 4.41297 25.3603 -9999. 4.43407 25.7705 -9999. 4.45527 26.1873 -9999. 4.47657 26.6109 -9999. 4.49797 27.0413 -9999. 4.51948 27.4786 -9999. 4.54108 27.9231 -9999. 4.56280 28.3747 -9999. 4.58461 28.8337 -9999. 4.60653 29.3000 1.29108 4.62855 29.7739 1.37530 4.65068 30.2555 1.45987 4.67292 30.7449 1.54500 4.69526 31.2421 1.63089 4.71770 31.7475 1.71782 4.74026 32.2609 1.80604 4.76292 32.7827 1.89591 4.78569 33.3130 1.98784 4.80857 33.8518 2.08240 4.83156 34.3993 2.18037 4.85466 34.9557 2.28303 4.87787 35.5211 2.39360 4.90119 36.0956 2.51838 4.92462 36.6794 2.65940 4.90853 37.2727 2.77356 4.88177 37.8755 2.87789 4.85515 38.4882 2.97620 4.82868 39.1107 3.07020 4.80235 39.7432 3.16085 4.77617 40.3861 3.24882 4.75012 41.0393 3.33461 4.72423 41.7031 3.41860 4.69846 42.3776 3.50113 4.67285 43.0630 3.58251 4.64737 43.7595 3.66302 4.62203 44.4673 3.74299 4.59683 45.1865 3.82277 4.57176 45.9174 3.90281 4.54683 46.6600 3.98375 4.52204 47.4147 4.06668 4.49738 48.1816 4.15435 4.47286 48.9609 4.25303 4.43924 49.7528 4.34278 4.38530 50.5576 4.42066 4.33201 51.3753 4.49260 4.27937 52.2062 4.56033 4.22737 53.0506 4.62460 4.17601 53.9087 4.68591 4.12526 54.7806 4.74464 4.07514 55.6667 4.80103 4.02562 56.5670 4.85533 3.97670 57.4820 4.90769 3.92838 58.4117 4.95827 3.88065 59.3564 5.00720 3.83349 60.3165 5.05457 3.78691 61.2921 5.10049 3.74090 62.2834 5.14504 3.69544 63.2908 5.18829 3.65054 64.3145 5.23031 3.60618 65.3547 5.27115 3.56236 66.4118 5.31086 3.51907 67.4859 5.34947 3.47631 68.5775 5.38698 3.43407 69.6867 5.42322 3.39234 70.8138 5.45837 3.35206 71.9591 5.49332 3.31248 73.1230 5.52779 3.27336 74.3057 5.56170 3.23470 75.5076 5.59505 3.19651 76.7289 5.62788 3.15877 77.9699 5.66020 3.12146 79.2310 5.69205 3.08460 80.5125 5.72347 3.04818 81.8147 5.75450 3.01218 83.1380 5.78519 2.97661 84.4827 5.81559 2.94146 85.8491 5.84576 2.90673 87.2377 5.87577 2.87240 88.6487 5.90572 2.83848 90.0825 5.93570 2.80496 91.5395 5.96588 2.77184 93.0201 5.99646 2.73911 94.5246 6.02776 2.70676 96.0535 6.06038 2.67480 97.6071 6.09575 2.64321 99.1858 6.13917 2.60698 100.790 6.17528 2.55821 102.420 6.20520 2.51035 104.077 6.23136 2.46339 105.760 6.25498 2.41730 107.471 6.27656 2.37208 109.209 6.29640 2.32770 110.975 6.31474 2.28416 112.770 6.33175 2.24143 114.594 6.34755 2.19949 116.448 6.36224 2.15834 118.331 6.37593 2.11797 120.245 6.38867 2.07834 122.190 6.40053 2.03946 124.166 6.41155 2.00131 126.175 6.42176 1.96387 128.215 6.43119 1.92713 130.289 6.43983 1.89108 132.397 6.44761 1.85570 134.538 6.45377 1.82102 136.714 6.45983 1.78919 138.925 6.46640 1.75791 141.172 6.47299 1.72717 143.456 6.47949 1.69698 145.776 6.48585 1.66731 148.134 6.49207 1.63816 150.530 6.49816 1.60952 152.964 6.50413 1.58138 155.439 6.51001 1.55374 157.953 6.51583 1.52657 160.507 6.52164 1.49989 163.103 6.52749 1.47366 165.742 6.53347 1.44790 168.422 6.53968 1.42259 171.146 6.54628 1.39772 173.915 6.55353 1.37328 176.727 6.56188 1.34927 179.586 6.57285 1.32568 182.491 6.59062 1.29775 185.442 6.60126 1.25985 188.442 6.60656 1.22306 191.489 6.60890 1.18734 194.587 6.60909 1.15266 197.734 6.60756 1.11900 200.932 6.60459 1.08632 204.182 6.60037 1.05459 207.485 6.59504 1.02379 210.840 6.58869 0.993894 214.251 6.58141 0.964869 217.716 6.57324 0.936690 221.237 6.56421 0.909335 224.816 6.55434 0.882777 228.452 6.54358 0.856997 232.147 6.53186 0.831968 235.902 6.51910 0.807672 239.717 6.50289 0.785141 243.595 6.48780 0.767050 247.535 6.47469 0.749377 251.538 6.46187 0.732111 255.607 6.44917 0.715246 259.741 6.43647 0.698766 263.942 6.42370 0.682666 268.211 6.41077 0.666936 272.549 6.39774 0.651568 276.957 6.38453 0.636390 281.437 6.37093 0.621360 285.989 6.35684 0.606567 290.615 6.34223 0.592106 295.315 6.32710 0.577987 300.092 6.31143 0.564206 304.945 6.29521 0.550756 309.878 6.27839 0.537625 314.890 6.26093 0.524809 319.983 6.24279 0.512296 325.158 6.22392 0.500078 330.418 6.20424 0.488156 335.762 6.18372 0.476518 341.192 6.16227 0.465160 346.711 6.13982 0.454068 352.319 6.11627 0.443240 358.017 6.09153 0.432677 363.808 6.06550 0.422359 369.692 6.03805 0.412287 375.672 6.00904 0.402455 381.748 5.97834 0.392859 387.922 5.94581 0.383399 394.197 5.91108 0.373965 400.573 5.87378 0.364734 407.052 5.83371 0.355718 413.635 5.79051 0.346911 420.326 5.74378 0.338332 427.124 5.69301 0.329966 434.032 5.63760 0.321805 441.052 5.57677 0.313842 448.186 5.50955 0.306078 455.435 5.43473 0.298525 462.802 5.35075 0.291171 470.287 5.25548 0.284004 477.894 5.14604 0.277005 485.623 5.01831 0.270184 493.478 4.86623 0.263535 501.459 4.68029 0.257056 509.570 4.44433 0.250722 517.812 4.12757 0.244542 526.187 3.65977 0.238528 534.698 2.81057 0.232662 543.000 -2.97417 0.227165 543.200 -2.96820 4.41017 543.346 -1.76427 4.40843 552.134 3.14873 4.30605 561.065 4.13655 4.20603 570.139 4.73493 4.10874 579.361 5.16768 4.01631 588.732 5.50836 3.92668 598.254 5.78966 3.83948 607.930 6.02905 3.75417 617.763 6.23761 3.67071 627.755 6.42270 3.58878 637.908 6.59031 3.50519 648.226 6.74023 3.41851 658.711 6.87017 3.33072 669.365 6.98234 3.24518 680.191 7.07900 3.17061 691.193 7.17176 3.10440 702.372 7.26537 3.04097 713.733 7.35632 2.97253 725.277 7.43725 2.90138 737.008 7.51096 2.83210 748.928 7.57923 2.76441 761.042 7.64278 2.69824 773.351 7.70301 2.63299 785.859 7.75952 2.56707 798.570 7.81002 2.50097 811.486 7.85560 2.43656 824.611 7.89685 2.37381 837.949 7.93400 2.31267 851.502 7.96689 2.25490 865.274 7.99727 2.20048 879.269 8.02738 2.14904 893.491 8.05676 2.09880 907.943 8.08546 2.04974 922.628 8.11385 2.00183 937.551 8.14164 1.95125 952.715 8.16639 1.90102 968.124 8.18822 1.85129 983.783 8.20773 1.80284 999.695 8.22524 1.75575 1015.86 8.24110 1.71001 1032.29 8.25591 1.66625 1048.99 8.27017 1.62304 1065.96 8.28286 1.58035 1083.20 8.29421 1.53877 1100.72 8.30443 1.49828 1118.52 8.31363 1.45885 1136.61 8.32191 1.42048 1155. 8.32937 1.38311 1173.68 8.33606 1.34671 1192.66 8.34205 1.31127 1211.95 8.34741 1.27676 1231.55 8.35226 1.24316 1251.47 8.35670 1.21022 1271.72 8.36065 1.17789 1292.29 8.36377 1.14609 1313.19 8.36620 1.11516 1334.43 8.36809 1.08507 1356.01 8.36949 1.05579 1377.94 8.37047 1.02732 1400.23 8.37109 0.999604 1422.88 8.37136 0.972611 1445.89 8.37135 0.946380 1469.28 8.37123 0.920766 1493.04 8.37088 0.895701 1517.19 8.37025 0.870806 1541.73 8.36901 0.846549 1566.67 8.36742 0.822997 1592.01 8.36555 0.800062 1617.76 8.36340 0.777767 1643.92 8.36104 0.756111 1670.51 8.35851 0.735037 1697.53 8.35582 0.714548 1724.99 8.35305 0.694627 1752.89 8.35021 0.675030 1781.24 8.34710 0.655908 1810.05 8.34378 0.637270 1839.32 8.34028 0.619158 1869.07 8.33665 0.601560 1899.30 8.33291 0.584462 1930.02 8.32907 0.567849 1961.24 8.32516 0.551708 1992.96 8.32116 0.536027 2025.20 8.31719 0.520980 2057.95 8.31332 0.506059 2091.24 8.30931 0.491524 2125.06 8.30523 0.477384 2159.43 8.30109 0.463634 2194.36 8.29692 0.450251 2229.85 8.29272 0.437232 2265.92 8.28851 0.424568 2302.57 8.28427 0.412245 2339.81 8.28002 0.400261 2377.66 8.27576 0.388605 2416.11 8.27151 0.377269 2455.19 8.26726 0.366239 2494.90 8.26301 0.355523 2535.26 8.25878 0.345085 2576.26 8.25456 0.334943 2617.93 8.25035 0.325079 2660.27 8.24617 0.315489 2703.30 8.24200 0.306159 2747.03 8.23786 0.297084 2791.46 8.23375 0.288266 2836.61 8.22967 0.279693 2882.49 8.22562 0.271352 2929.11 8.22161 0.263238 2976.48 8.21762 0.255349 3024.63 8.21367 0.247687 3073.55 8.20976 0.240232 3123.26 8.20589 0.232981 3173.78 8.20205 0.225931 3225.11 8.19826 0.219077 3277.27 8.19450 0.212417 3330.28 8.19079 0.205937 3384.15 8.18711 0.199644 3438.88 8.18349 0.193525 3494.50 8.17991 0.187574 3551.02 8.17636 0.181787 3608.46 8.17287 0.176160 3666.82 8.16942 0.170681 3726.13 8.16599 0.165363 3786.40 8.16262 0.160196 3847.64 8.15929 0.155167 3909.87 8.15601 0.150282 3973.11 8.15276 0.145531 4037.38 8.14954 0.140899 4102.68 8.14635 0.136421 4169.03 8.14321 0.132079 4236.46 8.14011 0.127871 4304.98 8.13705 0.123789 4374.62 8.13404 0.119833 4445.37 8.13108 0.115998 4517.27 8.12816 0.112280 4590.33 8.12529 0.108678 4664.58 8.12246 0.105185 4740.03 8.11969 0.101800 4816.69 8.11695 0.985193E-01 4894.60 8.11427 0.953398E-01 4973.77 8.11163 0.922592E-01 5054.21 8.10904 0.892732E-01 5135.96 8.10649 0.863801E-01 5219.03 8.10400 0.835779E-01 5303.44 8.10154 0.808620E-01 5389.22 8.09913 0.782309E-01 5476.39 8.09677 0.756813E-01 5564.97 8.09445 0.732117E-01 5654.98 8.09218 0.708205E-01 5746.44 8.08995 0.685040E-01 5839.39 8.08776 0.662596E-01 5933.83 8.08562 0.640857E-01 6029.81 8.08351 0.619792E-01 6127.33 8.08146 0.599416E-01 6226.44 8.07944 0.579659E-01 6327.15 8.07746 0.560545E-01 6429.48 8.07552 0.542032E-01 6533.48 8.07362 0.524097E-01 6639.15 8.07176 0.506725E-01 6746.54 8.06994 0.489916E-01 6855.65 8.06816 0.473650E-01 6966.54 8.06642 0.457894E-01 7079.22 8.06471 0.442644E-01 7193.72 8.06304 0.427875E-01 7310.07 8.06140 0.413582E-01 7428.31 8.05980 0.399759E-01 7548.45 8.05824 0.386359E-01 7670.54 8.05670 0.373402E-01 7794.61 8.05521 0.360851E-01 7920.68 8.05374 0.348710E-01 8048.79 8.05231 0.336980E-01 8178.98 8.05091 0.325612E-01 8311.26 8.04954 0.314612E-01 8445.69 8.04820 0.303967E-01 8582.29 8.04689 0.293670E-01 8721.11 8.04561 0.283707E-01 8862.16 8.04436 0.274070E-01 9005.50 8.04313 0.264746E-01 9151.16 8.04194 0.255728E-01 9299.17 8.04077 0.247005E-01 9449.58 8.03963 0.238566E-01 9602.42 8.03852 0.230406E-01 9757.73 8.03743 0.222513E-01 9915.55 8.03637 0.214883E-01 10075.9 8.03533 0.207501E-01 10238.9 8.03432 0.200363E-01 10404.5 8.03333 0.193461E-01 10572.8 8.03236 0.186788E-01 10743.8 8.03142 0.180336E-01 10917.6 8.03049 0.174099E-01 11094.2 8.02960 0.168069E-01 11273.6 8.02872 0.162240E-01 11455.9 8.02786 0.156607E-01 11641.2 8.02703 0.151161E-01 11829.5 8.02621 0.145898E-01 12020.8 8.02541 0.140812E-01 12215.3 8.02464 0.135897E-01 12412.8 8.02388 0.131147E-01 12613.6 8.02314 0.126558E-01 12817.6 8.02242 0.122124E-01 13025.0 8.02172 0.117841E-01 13235.6 8.02103 0.113702E-01 13449.7 8.02036 0.109705E-01 13667.2 8.01971 0.105844E-01 13888.3 8.01907 0.102115E-01 14112.9 8.01845 0.985132E-02 14341.2 8.01785 0.950352E-02 14573.1 8.01726 0.916766E-02 14808.9 8.01668 0.884339E-02 15048.4 8.01612 0.853030E-02 15291.8 8.01557 0.822805E-02 15539.1 8.01504 0.793628E-02 15790.4 8.01452 0.765465E-02 16045.8 8.01402 0.738283E-02 16305.4 8.01352 0.712049E-02 16569.1 8.01304 0.686735E-02 16837.1 8.01257 0.662308E-02 17109.4 8.01212 0.638742E-02 17386.1 8.01167 0.616006E-02 17667.4 8.01124 0.594073E-02 17953.1 8.01082 0.572919E-02 18243.5 8.01041 0.552516E-02 18538.6 8.01001 0.532841E-02 18838.4 8.00962 0.513869E-02 19143.1 8.00924 0.495577E-02 19452.7 8.00887 0.477943E-02 19767.4 8.00851 0.460945E-02 20087.1 8.00816 0.444652E-02 20412.0 8.00782 0.428858E-02 20742.1 8.00749 0.413632E-02 21077.6 8.00717 0.398954E-02 21418.5 8.00686 0.384804E-02 21765.0 8.00655 0.371162E-02 22117.0 8.00626 0.358009E-02 22474.7 8.00597 0.345328E-02 22838.2 8.00569 0.333100E-02 23207.6 8.00541 0.321310E-02 23583.0 8.00515 0.309941E-02 23964.4 8.00489 0.298978E-02 24352.0 8.00464 0.288407E-02 24745.9 8.00439 0.278212E-02 25146.2 8.00416 0.268380E-02 25552.9 8.00393 0.258899E-02 25966.2 8.00370 0.249755E-02 26386.1 8.00348 0.240935E-02 26812.9 8.00327 0.232429E-02 27246.6 8.00307 0.224225E-02 27687.3 8.00286 0.216311E-02 28135.1 8.00267 0.208678E-02 28590.2 8.00248 0.201316E-02 29052.6 8.00230 0.194214E-02 29522.5 8.00212 0.187363E-02 30000.0 8.00194 0.180754E-02 periodictable-1.5.0/periodictable/xsf/os.nff000066400000000000000000000320601310514471200210440ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.88117 10.1617 -9999. 1.93789 10.3261 -9999. 1.99632 10.4931 -9999. 2.05652 10.6628 -9999. 2.13032 10.8353 -9999. 2.20812 11.0106 -9999. 2.28877 11.1886 -9999. 2.37237 11.3696 -9999. 2.45796 11.5535 -9999. 2.53755 11.7404 -9999. 2.61972 11.9303 -9999. 2.70455 12.1232 -9999. 2.79265 12.3193 -9999. 2.88764 12.5186 -9999. 2.98586 12.7210 -9999. 3.08742 12.9268 -9999. 3.18938 13.1359 -9999. 3.27352 13.3483 -9999. 3.35989 13.5642 -9999. 3.44854 13.7836 -9999. 3.53952 14.0066 -9999. 3.63291 14.2331 -9999. 3.72876 14.4633 -9999. 3.85803 14.6973 -9999. 3.99605 14.9350 -9999. 4.13902 15.1765 -9999. 4.28709 15.4220 -9999. 4.44047 15.6714 -9999. 4.59933 15.9249 -9999. 4.74683 16.1825 -9999. 4.88583 16.4442 -9999. 5.02890 16.7102 -9999. 5.17615 16.9805 -9999. 5.32771 17.2551 -9999. 5.48372 17.5342 -9999. 5.64981 17.8178 -9999. 5.82342 18.1060 -9999. 6.00238 18.3989 -9999. 6.18683 18.6964 -9999. 6.37696 18.9988 -9999. 6.57292 19.3061 -9999. 6.77240 19.6184 -9999. 6.93116 19.9357 -9999. 7.09364 20.2582 -9999. 7.25993 20.5858 -9999. 7.43012 20.9188 -9999. 7.60429 21.2571 -9999. 7.78255 21.6009 -9999. 7.90657 21.9503 -9999. 8.03206 22.3053 -9999. 8.15954 22.6661 -9999. 8.28905 23.0327 -9999. 8.42062 23.4053 -9999. 8.54747 23.7838 -9999. 8.61003 24.1685 -9999. 8.67305 24.5594 -9999. 8.73653 24.9566 -9999. 8.80047 25.3603 -9999. 8.80932 25.7705 -9999. 8.77179 26.1873 -9999. 8.73442 26.6109 -9999. 8.69721 27.0413 -9999. 8.66016 27.4786 -9999. 8.61796 27.9231 -9999. 8.52126 28.3747 -9999. 8.42565 28.8337 -9999. 8.33111 29.3000 8.30011 8.23764 29.7739 8.46473 8.14521 30.2555 8.63796 8.05382 30.7449 8.82533 7.91400 31.2421 8.96486 7.75190 31.7475 9.07920 7.59314 32.2609 9.17666 7.43762 32.7827 9.26315 7.28529 33.3130 9.34599 7.13549 33.8518 9.41616 6.96557 34.3993 9.46870 6.79969 34.9557 9.51340 6.63776 35.5211 9.55919 6.47969 36.0956 9.64713 6.32538 36.6794 9.83850 6.01324 37.2727 9.81542 5.59144 37.8755 9.67760 5.19925 38.4882 9.47666 4.80283 39.1107 9.16386 4.41435 39.7432 8.73078 4.02078 40.3861 8.05795 3.81918 41.0393 7.47199 3.76150 41.7031 6.82659 3.79178 42.3776 6.22162 3.90690 43.0630 5.52323 4.08295 43.7595 4.86151 4.46673 44.4673 4.20301 4.95063 45.1865 3.63012 5.55802 45.9174 3.08782 6.23996 46.6600 2.60760 7.11975 47.4147 2.25412 8.12406 48.1816 2.06738 9.25093 48.9609 2.05441 10.4803 49.7528 2.36027 11.8200 50.5576 2.90469 13.0355 51.3753 3.89401 14.3258 52.2062 4.99879 14.8253 53.0506 6.00564 15.3422 53.9087 6.96794 15.6000 54.7806 7.87184 15.8485 55.6667 8.75760 15.9634 56.5670 9.60952 16.0575 57.4820 10.5680 16.0828 58.4117 11.4106 15.8633 59.3564 12.1479 15.6467 60.3165 12.9033 15.3642 61.2921 13.5281 14.9819 62.2834 14.0943 14.6090 63.2908 14.6607 14.1379 64.3145 15.0549 13.6021 65.3547 15.3173 13.0867 66.4118 15.4420 12.6485 67.4859 15.5892 12.3170 68.5775 15.7324 11.9942 69.6867 15.8512 11.6799 70.8138 15.9181 11.4066 71.9591 16.0131 11.1827 73.1230 16.1162 10.9631 74.3057 16.2191 10.7479 75.5076 16.3199 10.5370 76.7289 16.4188 10.3301 77.9699 16.5184 10.1273 79.2310 16.6260 9.92852 80.5125 16.7724 9.71818 81.8147 16.8780 9.40813 83.1380 16.9272 9.10796 84.4827 16.9373 8.81738 85.8491 16.9185 8.53606 87.2377 16.8731 8.26371 88.6487 16.8014 8.00007 90.0825 16.7015 7.74481 91.5395 16.5651 7.49773 93.0201 16.3560 7.25851 94.5246 16.1386 7.15794 96.0535 15.9682 7.07017 97.6071 15.8106 6.98347 99.1858 15.6520 6.89783 100.790 15.4792 6.81324 102.420 15.2626 6.76245 104.077 15.0766 6.75365 105.760 14.9056 6.74487 107.471 14.7268 6.73610 109.209 14.5069 6.74813 110.975 14.3123 6.81111 112.770 14.1356 6.87469 114.594 13.9525 6.93885 116.448 13.7175 7.03657 118.331 13.5297 7.19876 120.245 13.3782 7.36469 122.190 13.2424 7.53445 124.166 13.1186 7.70811 126.175 13.0038 7.88579 128.215 12.8957 8.06755 130.289 12.7909 8.25351 132.397 12.6765 8.44814 134.538 12.5765 8.67514 136.714 12.4952 8.90823 138.925 12.4261 9.14759 141.172 12.3679 9.39337 143.456 12.3202 9.64577 145.776 12.2829 9.90494 148.134 12.2565 10.1711 150.530 12.2430 10.4429 152.964 12.2391 10.7194 155.439 12.2460 11.0033 157.953 12.2663 11.2948 160.507 12.3030 11.5939 163.103 12.3660 11.9010 165.742 12.4462 12.1821 168.422 12.5275 12.4636 171.146 12.6160 12.7517 173.915 12.7232 13.0464 176.727 12.8916 13.3202 179.586 13.0304 13.5421 182.491 13.1451 13.7676 185.442 13.2550 13.9969 188.442 13.3624 14.2300 191.489 13.4688 14.4669 194.587 13.5748 14.7079 197.734 13.6804 14.9528 200.932 13.7788 15.2018 204.182 13.8823 15.4751 207.485 13.9983 15.7545 210.840 14.1236 16.0389 214.251 14.2570 16.3284 217.716 14.3986 16.6232 221.237 14.5407 16.9233 224.816 14.7054 17.2553 228.452 14.9089 17.5676 232.147 15.1102 17.8649 235.902 15.3106 18.1672 239.717 15.5196 18.4746 243.595 15.7390 18.7872 247.535 15.9710 19.1051 251.538 16.2179 19.4284 255.607 16.4834 19.7572 259.741 16.7801 20.0915 263.942 17.0982 20.4037 268.211 17.4288 20.7152 272.549 17.7918 21.0315 276.957 18.2271 21.3000 281.437 18.6435 21.5050 285.989 19.0271 21.6704 290.615 19.3876 21.8307 295.315 19.7315 21.9916 300.092 20.0676 22.1539 304.945 20.3990 22.3176 309.878 20.7284 22.4830 314.890 21.0571 22.6491 319.983 21.3858 22.8164 325.158 21.7164 22.9854 330.418 22.0494 23.1549 335.762 22.3852 23.3258 341.192 22.7253 23.4983 346.711 23.0711 23.6723 352.319 23.4238 23.8475 358.017 23.7841 24.0236 363.808 24.1542 24.2013 369.692 24.5368 24.3804 375.672 24.9355 24.5606 381.748 25.3583 24.7422 387.922 25.8224 24.9123 394.197 26.3422 25.0548 400.573 26.8700 25.0755 407.052 27.3217 25.0477 413.635 27.7278 25.0203 420.326 28.1038 24.9933 427.124 28.4540 24.9664 434.032 28.7764 24.9384 441.052 29.0680 24.9111 448.186 29.2623 24.9046 455.435 29.4579 25.0013 462.802 29.6805 25.1714 470.287 29.9620 25.3824 477.894 30.3002 25.5955 485.623 30.6740 25.8094 493.478 31.0818 26.0249 501.459 31.5292 26.2435 509.570 32.0271 26.4632 517.812 32.6164 26.6627 526.187 33.2724 26.7855 534.698 33.9416 26.7616 543.346 34.5211 26.6647 552.134 35.0551 26.5680 561.065 35.5655 26.4551 570.139 36.0567 26.3319 579.361 36.5170 26.1883 588.732 36.9502 26.0406 598.254 37.3561 25.8907 607.930 37.7365 25.7416 617.763 38.0871 25.5935 627.755 38.3808 25.4527 637.908 38.6309 25.3914 648.226 38.8914 25.4475 658.711 39.2793 25.5818 669.365 39.8099 25.7167 680.191 40.4717 25.6782 691.193 41.0949 25.5018 702.372 41.6194 25.2659 713.733 42.0997 25.0169 725.277 42.5374 24.7597 737.008 42.9464 24.5053 748.928 43.3352 24.2534 761.042 43.7102 24.0036 773.351 44.0779 23.7521 785.859 44.4360 23.4881 798.570 44.7705 23.2146 811.486 45.0867 22.9443 824.611 45.3897 22.6769 837.949 45.6840 22.4124 851.502 45.9705 22.1443 865.274 46.2476 21.8718 879.269 46.5087 21.5959 893.491 46.7574 21.3232 907.943 46.9980 21.0538 922.628 47.2384 20.7875 937.551 47.4686 20.5020 952.715 47.6838 20.2146 968.124 47.8814 19.9261 983.783 48.0660 19.6414 999.695 48.2416 19.3586 1015.86 48.4119 19.0776 1032.29 48.5690 18.7836 1048.99 48.7106 18.4894 1065.96 48.8334 18.1949 1083.20 48.9403 17.9048 1100.72 49.0335 17.6191 1118.52 49.1139 17.3378 1136.61 49.1818 17.0603 1155. 49.2376 16.7870 1173.68 49.2815 16.5179 1192.66 49.3138 16.2529 1211.95 49.3351 15.9918 1231.55 49.3459 15.7343 1251.47 49.3460 15.4774 1271.72 49.3340 15.2204 1292.29 49.3043 14.9624 1313.19 49.2572 14.7084 1334.43 49.1935 14.4584 1356.01 49.1130 14.2123 1377.94 49.0148 13.9700 1400.23 48.8981 13.7317 1422.88 48.7623 13.4974 1445.89 48.6059 13.2663 1469.28 48.4273 13.0384 1493.04 48.2251 12.8136 1517.19 47.9942 12.5879 1541.73 47.7305 12.3656 1566.67 47.4309 12.1471 1592.01 47.0914 11.9319 1617.76 46.7060 11.7204 1643.92 46.2680 11.5126 1670.51 45.7678 11.3081 1697.53 45.1931 11.1069 1724.99 44.5300 10.9091 1752.89 43.7514 10.7088 1781.24 42.8208 10.5100 1810.05 41.6859 10.3130 1839.32 40.2606 10.1196 1869.07 38.3881 9.92978 1899.30 35.7236 9.74376 1930.02 31.1911 9.56069 1960. -1.98025 9.38809 1960.20 -1.98254 27.2515 1961.24 11.8393 27.2332 1992.96 29.2638 26.6867 2025.20 26.2824 26.1511 2030.70 11.3960 26.0616 2030.90 11.4284 38.2496 2057.95 35.3998 37.5516 2091.24 40.5370 36.7223 2125.06 43.8181 35.9116 2159.43 46.2639 35.1185 2194.36 48.1990 34.3429 2229.85 49.7737 33.5850 2265.92 51.0658 32.8439 2302.57 52.1137 32.1200 2339.81 52.9230 31.4120 2377.66 53.4462 30.7196 2416.11 53.4741 30.0439 2455.19 49.8736 29.3835 2457.10 45.4669 29.3519 2457.30 45.4811 34.0900 2494.90 55.2587 33.3130 2535.26 57.1055 32.5112 2576.26 58.3803 31.7290 2617.93 59.3702 30.9661 2660.27 60.1587 30.2234 2703.30 60.7601 29.4980 2747.03 61.1059 28.7916 2791.46 59.4194 28.1032 2792.10 58.3216 28.0934 2792.30 58.3305 29.8666 2836.61 62.3282 29.1908 2882.49 63.2281 28.5177 2929.11 63.8798 27.8603 2976.48 64.3562 27.2200 3024.63 64.5395 26.5947 3048.40 62.7987 26.2948 3048.60 62.8009 27.4437 3073.55 65.0879 27.1357 3123.26 65.9748 26.5392 3173.78 66.6126 25.9541 3225.11 67.1525 25.3787 3277.27 67.6292 24.8139 3330.28 68.0594 24.2603 3384.15 68.4519 23.7169 3438.88 68.8114 23.1832 3494.50 69.1422 22.6601 3551.02 69.4469 22.1465 3608.46 69.7283 21.6442 3666.82 69.9891 21.1514 3726.13 70.2302 20.6681 3786.40 70.4535 20.1946 3847.64 70.6594 19.7302 3909.87 70.8496 19.2760 3973.11 71.0260 18.8312 4037.38 71.1891 18.3950 4102.68 71.3384 17.9671 4169.03 71.4754 17.5490 4236.46 71.6016 17.1396 4304.98 71.7170 16.7386 4374.62 71.8221 16.3462 4445.37 71.9177 15.9619 4517.27 72.0041 15.5860 4590.33 72.0820 15.2181 4664.58 72.1516 14.8581 4740.03 72.2135 14.5059 4816.69 72.2680 14.1613 4894.60 72.3154 13.8242 4973.77 72.3561 13.4946 5054.21 72.3904 13.1722 5135.96 72.4186 12.8569 5219.03 72.4410 12.5487 5303.44 72.4578 12.2473 5389.22 72.4693 11.9526 5476.39 72.4755 11.6646 5564.97 72.4770 11.3831 5654.98 72.4737 11.1078 5746.44 72.4657 10.8389 5839.39 72.4532 10.5760 5933.83 72.4365 10.3192 6029.81 72.4157 10.0684 6127.33 72.3908 9.82320 6226.44 72.3619 9.58373 6327.15 72.3292 9.34973 6429.48 72.2926 9.12121 6533.48 72.2523 8.89782 6639.15 72.2081 8.67966 6746.54 72.1601 8.46669 6855.65 72.1084 8.25845 6966.54 72.0527 8.05531 7079.22 71.9933 7.85688 7193.72 71.9300 7.66294 7310.07 71.8623 7.47358 7428.31 71.7905 7.28887 7548.45 71.7143 7.10827 7670.54 71.6335 6.93217 7794.61 71.5477 6.76002 7920.68 71.4567 6.59216 8048.79 71.3601 6.42788 8178.98 71.2571 6.26762 8311.26 71.1475 6.11119 8445.69 71.0303 5.95852 8582.29 70.9049 5.80942 8721.11 70.7702 5.66397 8862.16 70.6248 5.52170 9005.50 70.4669 5.38297 9151.16 70.2946 5.24744 9299.17 70.1052 5.11523 9449.58 69.8950 4.98608 9602.42 69.6592 4.86006 9757.73 69.3909 4.73670 9915.55 69.0803 4.61647 10075.9 68.7099 4.49461 10238.9 68.2477 4.37581 10404.5 67.6403 4.25999 10572.8 66.7528 4.14707 10743.8 65.0731 4.03701 10870.8 50.7973 3.95824 10871.0 50.7979 10.2630 10917.6 63.1798 10.1836 11094.2 66.3357 9.89108 11273.6 67.4493 9.60696 11455.9 68.0632 9.33101 11641.2 68.4090 9.06299 11829.5 68.5474 8.80266 12020.8 68.4566 8.54982 12215.3 67.9632 8.30424 12384.9 60.6457 8.09878 12385.1 60.6470 11.3583 12412.8 66.3113 11.3152 12613.6 68.5697 11.0114 12817.6 69.0675 10.7157 12967.9 65.8850 10.5059 12968.1 65.8856 12.0780 13025.0 69.2207 11.9986 13235.6 70.4931 11.7120 13449.7 71.1982 11.4307 13667.2 71.7342 11.1548 13888.3 72.1746 10.8842 14112.9 72.5498 10.6189 14341.2 72.8763 10.3589 14573.1 73.1641 10.1041 14808.9 73.4204 9.85458 15048.4 73.6500 9.61021 15291.8 73.8568 9.37098 15539.1 74.0438 9.13682 15790.4 74.2132 8.90768 16045.8 74.3671 8.68351 16305.4 74.5071 8.46424 16569.1 74.6345 8.24981 16837.1 74.7505 8.04015 17109.4 74.8562 7.83521 17386.1 74.9524 7.63491 17667.4 75.0399 7.43917 17953.1 75.1195 7.24794 18243.5 75.1917 7.06114 18538.6 75.2571 6.87869 18838.4 75.3163 6.70052 19143.1 75.3696 6.52656 19452.7 75.4174 6.35673 19767.4 75.4603 6.19095 20087.1 75.4985 6.02916 20412.0 75.5324 5.87127 20742.1 75.5622 5.71723 21077.6 75.5882 5.56693 21418.5 75.6107 5.42032 21765.0 75.6299 5.27731 22117.0 75.6460 5.13785 22474.7 75.6593 5.00185 22838.2 75.6699 4.86923 23207.6 75.6780 4.73994 23583.0 75.6837 4.61389 23964.4 75.6873 4.49102 24352.0 75.6888 4.37126 24745.9 75.6884 4.25454 25146.2 75.6863 4.14079 25552.9 75.6825 4.02994 25966.2 75.6771 3.92194 26386.1 75.6703 3.81671 26812.9 75.6621 3.71419 27246.6 75.6527 3.61431 27687.3 75.6421 3.51703 28135.1 75.6305 3.42226 28590.2 75.6179 3.32997 29052.6 75.6050 3.24008 29522.5 75.5995 3.15253 30000.0 75.5481 3.06728 periodictable-1.5.0/periodictable/xsf/p.nff000066400000000000000000000322001310514471200206560ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 8.47738 10.1617 -9999. 8.27092 10.3261 -9999. 8.06949 10.4931 -9999. 7.87297 10.6628 -9999. 7.68123 10.8353 -9999. 7.49416 11.0106 -9999. 7.31165 11.1886 -9999. 7.13359 11.3696 -9999. 6.95985 11.5535 -9999. 6.79035 11.7404 -9999. 6.62498 11.9303 -9999. 6.46364 12.1232 -9999. 6.30623 12.3193 -9999. 6.14279 12.5186 -9999. 5.96938 12.7210 -9999. 5.80087 12.9268 -9999. 5.63711 13.1359 -9999. 5.47797 13.3483 -9999. 5.32059 13.5642 -9999. 5.10232 13.7836 -9999. 4.89300 14.0066 -9999. 4.69227 14.2331 -9999. 4.49977 14.4633 -9999. 4.31517 14.6973 -9999. 4.13815 14.9350 -9999. 3.96838 15.1765 -9999. 3.80558 15.4220 -9999. 3.64946 15.6714 -9999. 3.49498 15.9249 -9999. 3.33559 16.1825 -9999. 3.18347 16.4442 -9999. 3.03828 16.7102 -9999. 2.89419 16.9805 -9999. 2.69318 17.2551 -9999. 2.50614 17.5342 -9999. 2.31986 17.8178 -9999. 2.10076 18.1060 -9999. 1.90237 18.3989 -9999. 1.70008 18.6964 -9999. 1.51572 18.9988 -9999. 1.37184 19.3061 -9999. 1.24320 19.6184 -9999. 1.12494 19.9357 -9999. 1.01574 20.2582 -9999. 0.914288 20.5858 -9999. 0.816119 20.9188 -9999. 0.731590 21.2571 -9999. 0.661629 21.6009 -9999. 0.597179 21.9503 -9999. 0.537266 22.3053 -9999. 0.483365 22.6661 -9999. 0.438116 23.0327 -9999. 0.397524 23.4053 -9999. 0.362656 23.7838 -9999. 0.334441 24.1685 -9999. 0.308421 24.5594 -9999. 0.282182 24.9566 -9999. 0.257009 25.3603 -9999. 0.236594 25.7705 -9999. 0.222772 26.1873 -9999. 0.209917 26.6109 -9999. 0.206460 27.0413 -9999. 0.203059 27.4786 -9999. 0.204255 27.9231 -9999. 0.209753 28.3747 -9999. 0.215399 28.8337 -9999. 0.221196 29.3000 4.97805 0.229708 29.7739 4.94245 0.238708 30.2555 4.90915 0.248061 30.7449 4.87753 0.258073 31.2421 4.84809 0.268995 31.7475 4.82071 0.280380 32.2609 4.79531 0.292247 32.7827 4.77233 0.304615 33.3130 4.75285 0.316307 33.8518 4.73345 0.325368 34.3993 4.71416 0.334688 34.9557 4.69575 0.343738 35.5211 4.67746 0.352639 36.0956 4.65958 0.361769 36.6794 4.64218 0.371136 37.2727 4.62528 0.380746 37.8755 4.60889 0.390605 38.4882 4.59301 0.400718 39.1107 4.57763 0.411094 39.7432 4.56276 0.421739 40.3861 4.54841 0.432658 41.0393 4.53459 0.443861 41.7031 4.52133 0.455354 42.3776 4.50872 0.467145 43.0630 4.49696 0.479240 43.7595 4.48618 0.490690 44.4673 4.47517 0.501872 45.1865 4.46431 0.513308 45.9174 4.45372 0.525005 46.6600 4.44348 0.536968 47.4147 4.43366 0.549204 48.1816 4.42433 0.561719 48.9609 4.41557 0.574519 49.7528 4.40751 0.587610 50.5576 4.40035 0.601000 51.3753 4.39447 0.614695 52.2062 4.39076 0.628703 53.0506 4.39223 0.639288 53.9087 4.38977 0.644138 54.7806 4.38494 0.649026 55.6667 4.37881 0.653950 56.5670 4.37180 0.658911 57.4820 4.36411 0.663911 58.4117 4.35588 0.668948 59.3564 4.34726 0.674023 60.3165 4.33842 0.679137 61.2921 4.32979 0.684290 62.2834 4.32275 0.688005 63.2908 4.31322 0.688515 64.3145 4.30156 0.689024 65.3547 4.28832 0.689535 66.4118 4.27373 0.690045 67.4859 4.25786 0.690556 68.5775 4.24072 0.691067 69.6867 4.22231 0.691579 70.8138 4.20263 0.692091 71.9591 4.18164 0.692603 73.1230 4.15933 0.693116 74.3057 4.13568 0.693629 75.5076 4.11073 0.694143 76.7289 4.08472 0.694657 77.9699 4.05772 0.693818 79.2310 4.02776 0.692060 80.5125 3.99527 0.690306 81.8147 3.96034 0.688558 83.1380 3.92293 0.686813 84.4827 3.88292 0.685073 85.8491 3.84018 0.683337 87.2377 3.79457 0.681605 88.6487 3.74590 0.679879 90.0825 3.69399 0.678156 91.5395 3.63867 0.676438 93.0201 3.57976 0.674723 94.5246 3.51745 0.673014 96.0535 3.45338 0.669023 97.6071 3.38116 0.661918 99.1858 3.30117 0.654888 100.790 3.21387 0.647932 102.420 3.11870 0.641051 104.077 3.01492 0.634243 105.760 2.90159 0.627507 107.471 2.77760 0.620842 109.209 2.64162 0.614248 110.975 2.49249 0.607725 112.770 2.32708 0.598330 114.594 2.14049 0.588439 116.448 1.92932 0.578712 118.331 1.68884 0.569145 120.245 1.41189 0.559736 122.190 1.08814 0.550483 124.166 0.701791 0.541383 126.175 0.227104 0.532433 128.215 -0.382396 0.523631 130.289 -1.22512 0.514975 132.397 -2.58099 0.506462 134.538 -6.42991 0.498089 134.900 -9.75036 0.496701 135.100 -9.78040 7.24821 136.714 -3.80688 7.37624 138.925 -2.11871 7.55281 141.172 -1.19700 7.73360 143.456 -0.541382 7.91872 145.776 -0.141602E-01 8.10828 148.134 0.444985 8.30236 150.530 0.872470 8.50110 152.964 1.31326 8.70460 155.439 1.73013 8.80797 157.953 2.10106 8.91101 160.507 2.44414 9.01526 163.103 2.77746 9.12073 165.742 3.11313 9.22744 168.422 3.48135 9.33539 171.146 3.90962 9.32404 173.915 4.22455 9.22128 176.727 4.43798 9.11966 179.586 4.57084 9.01915 182.491 4.48835 8.91977 185.442 4.43827 9.23234 188.442 4.56813 9.57278 191.489 4.81079 9.92577 194.587 5.17514 10.2918 197.734 5.79093 10.6365 200.932 6.36132 10.5513 204.182 6.81058 10.4668 207.485 7.18838 10.3830 210.840 7.53860 10.2999 214.251 7.89918 10.2010 217.716 8.21430 10.0610 221.237 8.48864 9.92281 224.816 8.73923 9.78655 228.452 8.96913 9.65218 232.147 9.17702 9.51964 235.902 9.36814 9.40594 239.717 9.55750 9.30022 243.595 9.74455 9.19568 247.535 9.92636 9.09233 251.538 10.1032 8.99012 255.607 10.2756 8.88907 259.741 10.4440 8.78916 263.942 10.6092 8.69037 268.211 10.7723 8.59270 272.549 10.9346 8.49611 276.957 11.0992 8.40062 281.437 11.2799 8.29784 285.989 11.4420 8.16494 290.615 11.5876 8.03417 295.315 11.7225 7.90550 300.092 11.8494 7.77888 304.945 11.9696 7.65429 309.878 12.0840 7.53171 314.890 12.1932 7.41108 319.983 12.2978 7.29238 325.158 12.3980 7.17559 330.418 12.4944 7.06067 335.762 12.5873 6.94758 341.192 12.6769 6.83631 346.711 12.7636 6.72682 352.319 12.8477 6.61909 358.017 12.9295 6.51308 363.808 13.0092 6.40876 369.692 13.0874 6.30612 375.672 13.1645 6.20512 381.748 13.2415 6.10575 387.922 13.3212 6.00635 394.197 13.4025 5.90391 400.573 13.4811 5.79178 407.052 13.5497 5.67735 413.635 13.6120 5.56536 420.326 13.6701 5.45550 427.124 13.7248 5.34777 434.032 13.7766 5.24210 441.052 13.8263 5.13855 448.186 13.8765 5.03630 455.435 13.9240 4.93239 462.802 13.9681 4.82790 470.287 14.0080 4.72416 477.894 14.0439 4.62251 485.623 14.0772 4.52320 493.478 14.1082 4.42610 501.459 14.1376 4.33116 509.570 14.1656 4.23809 517.812 14.1929 4.14664 526.187 14.2195 4.05603 534.698 14.2448 3.96511 543.346 14.2676 3.87511 552.134 14.2909 3.78720 561.065 14.3127 3.69300 570.139 14.3245 3.59832 579.361 14.3322 3.51289 588.732 14.3394 3.43156 598.254 14.3476 3.35339 607.930 14.3561 3.27701 617.763 14.3652 3.20235 627.755 14.3764 3.12899 637.908 14.3889 3.05264 648.226 14.3997 2.97138 658.711 14.4026 2.88794 669.365 14.3978 2.80681 680.191 14.3872 2.73538 691.193 14.3787 2.67141 702.372 14.3760 2.61054 713.733 14.3752 2.54730 725.277 14.3721 2.48306 737.008 14.3676 2.42045 748.928 14.3622 2.35942 761.042 14.3564 2.29987 773.351 14.3508 2.24135 785.859 14.3448 2.18267 798.570 14.3367 2.12420 811.486 14.3271 2.06731 824.611 14.3164 2.01193 837.949 14.3048 1.95803 851.502 14.2922 1.90579 865.274 14.2790 1.85517 879.269 14.2654 1.80610 893.491 14.2514 1.75835 907.943 14.2370 1.71185 922.628 14.2224 1.66658 937.551 14.2073 1.62225 952.715 14.1917 1.57906 968.124 14.1756 1.53698 983.783 14.1592 1.49604 999.695 14.1423 1.45621 1015.86 14.1251 1.41747 1032.29 14.1079 1.37983 1048.99 14.0905 1.34273 1065.96 14.0724 1.30615 1083.20 14.0535 1.27056 1100.72 14.0341 1.23596 1118.52 14.0142 1.20232 1136.61 13.9939 1.16956 1155. 13.9730 1.13770 1173.68 13.9516 1.10673 1192.66 13.9297 1.07657 1211.95 13.9072 1.04723 1231.55 13.8841 1.01867 1251.47 13.8604 0.990996 1271.72 13.8360 0.964146 1292.29 13.8110 0.938107 1313.19 13.7854 0.912775 1334.43 13.7591 0.888128 1356.01 13.7319 0.864145 1377.94 13.7039 0.840814 1400.23 13.6748 0.818112 1422.88 13.6447 0.796024 1445.89 13.6134 0.774530 1469.28 13.5807 0.753673 1493.04 13.5465 0.733458 1517.19 13.5108 0.714144 1541.73 13.4736 0.695386 1566.67 13.4345 0.677114 1592.01 13.3933 0.659332 1617.76 13.3497 0.642015 1643.92 13.3032 0.625148 1670.51 13.2536 0.608723 1697.53 13.2004 0.592732 1724.99 13.1430 0.577164 1752.89 13.0806 0.561479 1781.24 13.0118 0.546048 1810.05 12.9355 0.530917 1839.32 12.8501 0.516200 1869.07 12.7535 0.501889 1899.30 12.6426 0.487977 1930.02 12.5132 0.474448 1961.24 12.3588 0.461296 1992.96 12.1687 0.448513 2025.20 11.9249 0.436361 2057.95 11.5895 0.423895 2091.24 11.0676 0.411665 2125.06 9.95415 0.399700 2145.40 3.54595 0.392762 2145.60 3.54765 4.22284 2159.43 9.60959 4.18509 2194.36 11.2187 4.09233 2229.85 11.9423 4.00067 2265.92 12.4219 3.91021 2302.57 12.7826 3.82100 2339.81 13.0719 3.73293 2377.66 13.3127 3.64605 2416.11 13.5186 3.56055 2455.19 13.6976 3.47630 2494.90 13.8553 3.39339 2535.26 13.9957 3.31185 2576.26 14.1216 3.23175 2617.93 14.2352 3.15296 2660.27 14.3383 3.07576 2703.30 14.4321 2.99968 2747.03 14.5177 2.92512 2791.46 14.5961 2.85195 2836.61 14.6679 2.78022 2882.49 14.7340 2.70992 2929.11 14.7947 2.64091 2976.48 14.8506 2.57341 3024.63 14.9020 2.50731 3073.55 14.9496 2.44270 3123.26 14.9935 2.37924 3173.78 15.0339 2.31715 3225.11 15.0710 2.25649 3277.27 15.1053 2.19715 3330.28 15.1369 2.13910 3384.15 15.1660 2.08237 3438.88 15.1927 2.02691 3494.50 15.2172 1.97273 3551.02 15.2397 1.91981 3608.46 15.2603 1.86811 3666.82 15.2791 1.81762 3726.13 15.2962 1.76833 3786.40 15.3118 1.72021 3847.64 15.3259 1.67325 3909.87 15.3387 1.62743 3973.11 15.3502 1.58274 4037.38 15.3605 1.53914 4102.68 15.3697 1.49661 4169.03 15.3778 1.45515 4236.46 15.3850 1.41472 4304.98 15.3912 1.37529 4374.62 15.3966 1.33687 4445.37 15.4011 1.29943 4517.27 15.4049 1.26295 4590.33 15.4080 1.22742 4664.58 15.4105 1.19278 4740.03 15.4123 1.15906 4816.69 15.4135 1.12621 4894.60 15.4142 1.09423 4973.77 15.4144 1.06306 5054.21 15.4141 1.03274 5135.96 15.4134 1.00323 5219.03 15.4123 0.974505 5303.44 15.4108 0.946528 5389.22 15.4090 0.919310 5476.39 15.4068 0.892828 5564.97 15.4043 0.867047 5654.98 15.4016 0.841986 5746.44 15.3985 0.817583 5839.39 15.3953 0.793881 5933.83 15.3918 0.770795 6029.81 15.3882 0.748323 6127.33 15.3843 0.726532 6226.44 15.3803 0.705292 6327.15 15.3761 0.684670 6429.48 15.3718 0.664605 6533.48 15.3674 0.645071 6639.15 15.3628 0.626122 6746.54 15.3582 0.607680 6855.65 15.3534 0.589768 6966.54 15.3486 0.572384 7079.22 15.3437 0.555427 7193.72 15.3388 0.539000 7310.07 15.3338 0.523022 7428.31 15.3288 0.507494 7548.45 15.3237 0.492406 7670.54 15.3186 0.477750 7794.61 15.3135 0.463515 7920.68 15.3084 0.449684 8048.79 15.3033 0.436244 8178.98 15.2981 0.423194 8311.26 15.2930 0.410515 8445.69 15.2879 0.398208 8582.29 15.2828 0.386248 8721.11 15.2777 0.374638 8862.16 15.2727 0.363359 9005.50 15.2676 0.352411 9151.16 15.2626 0.341780 9299.17 15.2577 0.331457 9449.58 15.2527 0.321431 9602.42 15.2478 0.311700 9757.73 15.2430 0.302254 9915.55 15.2382 0.293089 10075.9 15.2334 0.284185 10238.9 15.2287 0.275543 10404.5 15.2240 0.267153 10572.8 15.2194 0.259010 10743.8 15.2148 0.251106 10917.6 15.2103 0.243435 11094.2 15.2059 0.235989 11273.6 15.2015 0.228764 11455.9 15.1971 0.221751 11641.2 15.1928 0.214946 11829.5 15.1886 0.208342 12020.8 15.1844 0.201934 12215.3 15.1803 0.195715 12412.8 15.1763 0.189681 12613.6 15.1723 0.183827 12817.6 15.1684 0.178146 13025.0 15.1645 0.172634 13235.6 15.1607 0.167287 13449.7 15.1569 0.162099 13667.2 15.1532 0.157065 13888.3 15.1496 0.152182 14112.9 15.1460 0.147445 14341.2 15.1425 0.142849 14573.1 15.1391 0.138391 14808.9 15.1357 0.134067 15048.4 15.1324 0.129871 15291.8 15.1291 0.125802 15539.1 15.1259 0.121855 15790.4 15.1227 0.118027 16045.8 15.1196 0.114313 16305.4 15.1166 0.110711 16569.1 15.1136 0.107218 16837.1 15.1106 0.103829 17109.4 15.1078 0.100543 17386.1 15.1049 0.973559E-01 17667.4 15.1022 0.942647E-01 17953.1 15.0994 0.912668E-01 18243.5 15.0968 0.883594E-01 18538.6 15.0942 0.855399E-01 18838.4 15.0916 0.828055E-01 19143.1 15.0891 0.801538E-01 19452.7 15.0866 0.775824E-01 19767.4 15.0842 0.750886E-01 20087.1 15.0818 0.726802E-01 20412.0 15.0795 0.703366E-01 20742.1 15.0772 0.680665E-01 21077.6 15.0750 0.658673E-01 21418.5 15.0728 0.637371E-01 21765.0 15.0706 0.616736E-01 22117.0 15.0685 0.596750E-01 22474.7 15.0665 0.577392E-01 22838.2 15.0645 0.558643E-01 23207.6 15.0625 0.540484E-01 23583.0 15.0606 0.522897E-01 23964.4 15.0587 0.505865E-01 24352.0 15.0568 0.489371E-01 24745.9 15.0550 0.473398E-01 25146.2 15.0532 0.457930E-01 25552.9 15.0515 0.442953E-01 25966.2 15.0498 0.428450E-01 26386.1 15.0482 0.414407E-01 26812.9 15.0465 0.400810E-01 27246.6 15.0450 0.387645E-01 27687.3 15.0434 0.374899E-01 28135.1 15.0419 0.362558E-01 28590.2 15.0404 0.350612E-01 29052.6 15.0390 0.339046E-01 29522.5 15.0377 0.327849E-01 30000.0 15.0359 0.317011E-01 periodictable-1.5.0/periodictable/xsf/pa.nff000066400000000000000000000320671310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.75788 10.1617 -9999. 1.76101 10.3261 -9999. 1.76414 10.4931 -9999. 1.76728 10.6628 -9999. 1.73466 10.8353 -9999. 1.69295 11.0106 -9999. 1.65224 11.1886 -9999. 1.61457 11.3696 -9999. 1.58512 11.5535 -9999. 1.55620 11.7404 -9999. 1.52780 11.9303 -9999. 1.49993 12.1232 -9999. 1.47256 12.3193 -9999. 1.44569 12.5186 -9999. 1.41932 12.7210 -9999. 1.39337 12.9268 -9999. 1.36694 13.1359 -9999. 1.34101 13.3483 -9999. 1.31557 13.5642 -9999. 1.29062 13.7836 -9999. 1.26613 14.0066 -9999. 1.24212 14.2331 -9999. 1.21856 14.4633 -9999. 1.19751 14.6973 -9999. 1.17807 14.9350 -9999. 1.15894 15.1765 -9999. 1.14013 15.4220 -9999. 1.12162 15.6714 -9999. 1.10769 15.9249 -9999. 1.10134 16.1825 -9999. 1.09502 16.4442 -9999. 1.10166 16.7102 -9999. 1.12178 16.9805 -9999. 1.16065 17.2551 -9999. 1.23959 17.5342 -9999. 1.46231 17.8178 -9999. 1.77156 18.1060 -9999. 2.14619 18.3989 -9999. 2.55993 18.6964 -9999. 2.86887 18.9988 -9999. 3.21508 19.3061 -9999. 3.60308 19.6184 -9999. 3.95479 19.9357 -9999. 4.21245 20.2582 -9999. 4.48692 20.5858 -9999. 4.77925 20.9188 -9999. 5.09063 21.2571 -9999. 5.39216 21.6009 -9999. 5.68568 21.9503 -9999. 5.99517 22.3053 -9999. 6.32151 22.6661 -9999. 6.66561 23.0327 -9999. 7.02845 23.4053 -9999. 7.39578 23.7838 -9999. 7.75707 24.1685 -9999. 8.13601 24.5594 -9999. 8.53346 24.9566 -9999. 8.95032 25.3603 -9999. 9.38755 25.7705 -9999. 9.78338 26.1873 -9999. 10.1541 26.6109 -9999. 10.5389 27.0413 -9999. 10.9382 27.4786 -9999. 11.3527 27.9231 -9999. 11.7828 28.3747 -9999. 12.0963 28.8337 -9999. 12.3524 29.3000 5.69681 12.6139 29.7739 6.06336 12.8809 30.2555 6.44653 13.1535 30.7449 6.86048 13.4320 31.2421 7.33106 13.7163 31.7475 7.87932 13.8995 32.2609 8.36798 14.0259 32.7827 8.84589 14.1536 33.3130 9.33515 14.2824 33.8518 9.85791 14.4123 34.3993 10.4555 14.5435 34.9557 11.1828 14.4993 35.5211 11.7980 14.3241 36.0956 12.3177 14.0694 36.6794 12.7570 13.8192 37.2727 13.1475 13.5734 37.8755 13.5017 13.3320 38.4882 13.8272 13.0949 39.1107 14.1290 12.8621 39.7432 14.4111 12.6333 40.3861 14.6772 12.4097 41.0393 14.9324 12.1904 41.7031 15.1810 11.9750 42.3776 15.4383 11.7635 43.0630 15.7411 11.5211 43.7595 15.9750 11.1833 44.4673 16.1362 10.8554 45.1865 16.2354 10.5372 45.9174 16.3150 10.3105 46.6600 16.4150 10.0903 47.4147 16.5258 9.87476 48.1816 16.6493 9.64493 48.9609 16.7514 9.40358 49.7528 16.8462 9.16827 50.5576 16.9490 8.93884 51.3753 17.1020 8.67122 52.2062 17.1733 8.29968 53.0506 17.1593 7.94407 53.9087 17.0934 7.65749 54.7806 17.0364 7.39714 55.6667 16.9783 7.14563 56.5670 16.9180 6.90269 57.4820 16.8733 6.65806 58.4117 16.7944 6.36509 59.3564 16.6730 6.08500 60.3165 16.5241 5.81735 61.2921 16.3535 5.56366 62.2834 16.1646 5.32105 63.2908 15.9611 5.08742 64.3145 15.7353 4.85534 65.3547 15.4867 4.63386 66.4118 15.2199 4.41995 67.4859 14.9263 4.20854 68.5775 14.6049 4.00724 69.6867 14.2548 3.81873 70.8138 13.8808 3.64163 71.9591 13.4796 3.47273 73.1230 13.0481 3.31138 74.3057 12.5795 3.15347 75.5076 12.0659 3.00310 76.7289 11.4926 2.86924 77.9699 10.8788 2.75745 79.2310 10.2028 2.65084 80.5125 9.46612 2.57996 81.8147 8.65612 2.51098 83.1380 7.75103 2.46452 84.4827 6.71093 2.43997 85.8491 5.54216 2.44792 87.2377 4.17601 2.47442 88.6487 2.47095 2.52226 90.0825 0.242954 2.69166 91.5395 -3.03708 3.19078 93.0201 -7.30723 6.66410 94.5246 -9.19053 12.1025 96.0535 -8.64618 19.4572 97.6071 3.74738 21.5624 99.1858 1.90889 13.0480 100.790 -2.80788 10.7145 102.420 -11.0462 9.98412 104.077 -19.2765 15.6696 105.760 -27.0710 24.5923 107.471 -34.3952 41.0199 109.209 -25.9329 72.5933 110.975 1.04438 82.1200 112.770 28.6279 77.2142 114.594 40.5394 59.8823 116.448 41.3985 49.6453 118.331 42.2590 43.3427 120.245 43.0836 37.8400 122.190 43.0491 33.0361 124.166 41.8547 28.8420 126.175 40.5733 26.8644 128.215 40.0477 25.2383 130.289 39.7590 23.7107 132.397 39.5516 22.2755 134.538 39.3685 20.9272 136.714 39.1850 19.6605 138.925 38.9883 18.4704 141.172 38.7730 17.3524 143.456 38.5356 16.3021 145.776 38.2740 15.3154 148.134 37.9791 14.3889 150.530 37.6734 13.5541 152.964 37.3640 12.7678 155.439 37.0452 12.0272 157.953 36.7105 11.3295 160.507 36.3528 10.6722 163.103 35.9425 10.0531 165.742 35.5131 9.60267 168.422 35.1834 9.21813 171.146 34.8897 8.78432 173.915 34.5787 8.37254 176.727 34.2621 7.99889 179.586 33.9222 7.64191 182.491 33.6117 7.40175 185.442 33.3673 7.17319 188.442 33.1999 6.89638 191.489 32.9934 6.57284 194.587 32.7560 6.24973 197.734 32.4825 5.93075 200.932 32.1569 5.66383 204.182 31.8602 5.45172 207.485 31.5719 5.25357 210.840 31.3137 5.09675 214.251 31.1134 4.94462 217.716 30.9732 4.69581 221.237 30.6429 4.37115 224.816 30.3032 4.20355 228.452 30.0013 4.04239 232.147 29.7017 3.88411 235.902 29.3938 3.73021 239.717 29.0677 3.58957 243.595 28.7422 3.46910 247.535 28.4061 3.35267 251.538 28.0407 3.26395 255.607 27.6860 3.20531 259.741 27.3044 3.15900 263.942 26.9465 3.17519 268.211 26.6171 3.19146 272.549 26.2917 3.20908 276.957 25.9733 3.23796 281.437 25.6594 3.26710 285.989 25.3436 3.29727 290.615 25.0250 3.32995 295.315 24.6992 3.36295 300.092 24.3556 3.39628 304.945 24.0017 3.45841 309.878 23.6491 3.52754 314.890 23.2929 3.59805 319.983 22.9252 3.67020 325.158 22.5417 3.74415 330.418 22.1362 3.81958 335.762 21.6944 3.90448 341.192 21.2287 4.00542 346.711 20.7114 4.10898 352.319 20.1471 4.26868 358.017 19.5126 4.45693 363.808 18.8611 4.79612 369.692 18.2957 5.17279 375.672 17.7026 5.51844 381.748 16.9494 5.89683 387.922 16.2422 6.55048 394.197 15.6382 7.20718 400.573 15.0693 7.89955 407.052 14.4629 8.56930 413.635 13.7260 9.33297 420.326 12.9539 10.4147 427.124 12.6306 11.9210 434.032 12.4540 12.9305 441.052 12.2392 14.0254 448.186 12.0270 15.2127 455.435 11.8629 16.5401 462.802 12.1325 18.0811 470.287 12.5808 19.1598 477.894 12.8805 20.1442 485.623 13.1479 21.1791 493.478 13.4455 22.2675 501.459 13.8120 23.4122 509.570 14.4357 24.5780 517.812 15.0639 25.5104 526.187 15.6604 26.4782 534.698 16.3992 27.4600 543.346 17.1328 28.2504 552.134 17.8555 29.0635 561.065 18.6741 29.9001 570.139 19.6137 30.5966 579.361 20.4641 31.1335 588.732 21.2683 31.6799 598.254 22.1286 32.2358 607.930 23.0583 32.6637 617.763 23.8708 32.9446 627.755 24.5940 33.2278 637.908 25.2960 33.5136 648.226 25.9221 33.7184 658.711 26.4054 33.9113 669.365 26.6159 34.1053 680.191 26.6210 34.9189 691.193 27.0026 36.1366 702.372 27.9761 37.3524 713.733 29.1282 38.3799 725.277 30.8761 39.4357 737.008 32.6412 39.5144 748.928 34.0070 39.4660 761.042 35.2190 39.4131 773.351 36.3610 39.3602 785.859 37.5192 39.3073 798.570 38.6119 39.0733 811.486 39.6036 38.8279 824.611 40.5186 38.5841 837.949 41.3905 38.3455 851.502 42.2397 38.1101 865.274 43.1196 37.8728 879.269 43.9249 37.4780 893.491 44.6174 37.0873 907.943 45.2164 36.7603 922.628 45.8050 36.4864 937.551 46.3959 36.2145 952.715 46.9683 35.9447 968.124 47.5162 35.6691 983.783 48.0434 35.3949 999.695 48.4276 35.1227 1015.86 49.0123 35.1464 1032.29 49.5467 34.7117 1048.99 49.8807 34.4394 1065.96 50.2608 34.3457 1083.20 50.7013 34.2519 1100.72 51.1666 34.1579 1118.52 51.6478 34.0637 1136.61 52.1415 33.9690 1155. 52.6469 33.8742 1173.68 53.1647 33.7791 1192.66 53.6968 33.6836 1211.95 54.2485 33.5880 1231.55 54.8376 33.4922 1251.47 55.4628 33.3448 1271.72 56.1059 33.1416 1292.29 56.6971 32.8705 1313.19 57.2487 32.6007 1334.43 57.7802 32.3328 1356.01 58.2996 32.0666 1377.94 58.8114 31.8012 1400.23 59.3204 31.5377 1422.88 59.8332 31.2761 1445.89 60.3601 31.0153 1469.28 60.9214 30.7334 1493.04 61.5235 30.4193 1517.19 62.0832 29.9644 1541.73 62.5695 29.4961 1566.67 62.9986 29.0343 1592.01 63.3939 28.5788 1617.76 63.7618 28.1299 1643.92 64.1065 27.6872 1670.51 64.4314 27.2509 1697.53 64.7393 26.8208 1724.99 65.0439 26.3965 1752.89 65.3319 25.9550 1781.24 65.5942 25.5126 1810.05 65.8330 25.0712 1839.32 66.0490 24.6363 1869.07 66.2469 24.2085 1899.30 66.4282 23.7876 1930.02 66.5939 23.3733 1961.24 66.7448 22.9660 1992.96 66.8779 22.5654 2025.20 67.0164 22.1842 2057.95 67.1448 21.7807 2091.24 67.2484 21.3801 2125.06 67.3347 20.9837 2159.43 67.4049 20.5917 2194.36 67.4591 20.2030 2229.85 67.4964 19.8179 2265.92 67.5165 19.4367 2302.57 67.5185 19.0599 2339.81 67.5035 18.6882 2377.66 67.4701 18.3196 2416.11 67.4171 17.9556 2455.19 67.3438 17.5957 2494.90 67.2495 17.2406 2535.26 67.1322 16.8891 2576.26 66.9906 16.5425 2617.93 66.8230 16.2004 2660.27 66.6270 15.8625 2703.30 66.3995 15.5286 2747.03 66.1373 15.1994 2791.46 65.8361 14.8744 2836.61 65.4907 14.5542 2882.49 65.0949 14.2380 2929.11 64.6398 13.9263 2976.48 64.1144 13.6190 3024.63 63.5040 13.3162 3073.55 62.7883 13.0175 3123.26 61.9371 12.7228 3173.78 60.9056 12.4326 3225.11 59.6206 12.1468 3277.27 57.9495 11.8649 3330.28 55.6072 11.5869 3384.15 51.7403 11.3130 3438.88 35.5703 11.0445 3441.70 17.8608 11.0309 3441.90 17.8638 27.5264 3494.50 49.8414 26.8431 3551.02 51.3518 26.1388 3608.46 40.7739 25.4538 3611.10 26.5659 25.4230 3611.30 26.5766 39.0237 3666.82 55.9203 38.0491 3726.13 60.5736 37.0506 3786.40 63.5618 36.0796 3847.64 65.7663 35.1362 3909.87 67.4736 34.2195 3973.11 68.8043 33.3285 4037.38 69.7893 32.4616 4102.68 70.3285 31.6203 4169.03 68.6896 30.8033 4173.70 64.9312 30.7471 4173.90 64.9340 33.8557 4236.46 72.1577 33.1241 4304.98 73.7076 32.3528 4374.62 74.8572 31.5984 4445.37 75.8039 30.8637 4517.27 76.6113 30.1450 4590.33 77.3072 29.4446 4664.58 77.9073 28.7613 4740.03 78.4149 28.0937 4816.69 78.8211 27.4418 4894.60 79.0828 26.8041 4973.77 78.9275 26.1816 5000.80 76.5532 25.9746 5001. 76.5542 27.3857 5054.21 79.6418 26.9834 5135.96 80.4144 26.3848 5219.03 80.9160 25.7996 5303.44 81.3681 25.2272 5366.80 80.1518 24.8117 5367. 80.1579 25.7340 5389.22 81.4111 25.5858 5476.39 82.2860 25.0184 5564.97 82.8540 24.4608 5654.98 83.3264 23.9115 5746.44 83.7406 23.3701 5839.39 84.1117 22.8376 5933.83 84.4479 22.3138 6029.81 84.7545 21.7986 6127.33 85.0347 21.2924 6226.44 85.2914 20.7948 6327.15 85.5265 20.3064 6429.48 85.7422 19.8272 6533.48 85.9398 19.3567 6639.15 86.1207 18.8953 6746.54 86.2858 18.4428 6855.65 86.4363 17.9995 6966.54 86.5732 17.5648 7079.22 86.6970 17.1393 7193.72 86.8089 16.7224 7310.07 86.9094 16.3145 7428.31 86.9993 15.9150 7548.45 87.0788 15.5243 7670.54 87.1490 15.1423 7794.61 87.2104 14.7685 7920.68 87.2631 14.4029 8048.79 87.3078 14.0459 8178.98 87.3450 13.6967 8311.26 87.3751 13.3558 8445.69 87.3987 13.0226 8582.29 87.4159 12.6972 8721.11 87.4273 12.3797 8862.16 87.4335 12.0697 9005.50 87.4346 11.7668 9151.16 87.4313 11.4715 9299.17 87.4242 11.1832 9449.58 87.4138 10.9018 9602.42 87.4016 10.6279 9757.73 87.3887 10.3603 9915.55 87.3964 10.0994 10075.9 87.4019 9.79338 10238.9 87.3583 9.49798 10404.5 87.3044 9.21309 10572.8 87.2389 8.93854 10743.8 87.1637 8.67422 10917.6 87.0799 8.41993 11094.2 86.9884 8.17552 11273.6 86.8899 7.94082 11455.9 86.7850 7.71565 11641.2 86.6739 7.49983 11829.5 86.5570 7.29317 12020.8 86.4345 7.09550 12215.3 86.3065 6.90661 12412.8 86.1729 6.72632 12613.6 86.0337 6.55443 12817.6 85.8887 6.39075 13025.0 85.7374 6.23509 13235.6 85.5795 6.08725 13449.7 85.4142 5.94705 13667.2 85.2404 5.81427 13888.3 85.0571 5.68875 14112.9 84.8624 5.57027 14341.2 84.6540 5.45866 14573.1 84.4287 5.35372 14808.9 84.1821 5.25528 15048.4 83.9075 5.16314 15291.8 83.5949 5.07712 15539.1 83.2281 4.99704 15790.4 82.7785 4.92273 16045.8 82.1879 4.85401 16305.4 81.3094 4.79070 16569.1 79.5209 4.73264 16733.0 65.0377 4.69737 16733.2 65.0383 10.8982 16837.1 78.8509 10.7825 17109.4 81.4888 10.4883 17386.1 82.6011 10.2021 17667.4 83.2849 9.92377 17953.1 83.7492 9.65301 18243.5 84.0704 9.38963 18538.6 84.2820 9.13346 18838.4 84.3970 8.88427 19143.1 84.4130 8.64189 19452.7 84.3077 8.40613 19767.4 84.0113 8.17681 20087.1 83.2474 7.95375 20313.6 75.5413 7.80148 20313.8 75.5420 11.0231 20412.0 82.4780 10.9443 20742.1 83.9576 10.6860 21077.6 83.6331 10.4337 21104.5 81.7519 10.4139 21104.7 81.7530 11.7091 21418.5 85.1984 11.4720 21765.0 85.9308 11.2198 22117.0 86.4627 10.9707 22474.7 86.8928 10.7249 22838.2 87.2567 10.4824 23207.6 87.5725 10.2433 23583.0 87.8510 10.0078 23964.4 88.0993 9.77588 24352.0 88.3224 9.54764 24745.9 88.5239 9.32313 25146.2 88.7068 9.10238 25552.9 88.8731 8.88544 25966.2 89.0248 8.67233 26386.1 89.1633 8.46306 26812.9 89.2899 8.25765 27246.6 89.4057 8.05611 27687.3 89.5117 7.85843 28135.1 89.6086 7.66460 28590.2 89.6975 7.47463 29052.6 89.7798 7.28848 29522.5 89.8730 7.10613 30000.0 89.8623 6.92757 periodictable-1.5.0/periodictable/xsf/pb.nff000066400000000000000000000321431310514471200210260ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 4.66990 10.1617 -9999. 4.72735 10.3261 -9999. 4.78551 10.4931 -9999. 4.84439 10.6628 -9999. 4.83957 10.8353 -9999. 4.83203 11.0106 -9999. 4.82451 11.1886 -9999. 4.81700 11.3696 -9999. 4.78890 11.5535 -9999. 4.75960 11.7404 -9999. 4.73047 11.9303 -9999. 4.70302 12.1232 -9999. 4.68370 12.3193 -9999. 4.66446 12.5186 -9999. 4.64530 12.7210 -9999. 4.62536 12.9268 -9999. 4.44257 13.1359 -9999. 4.26699 13.3483 -9999. 4.09837 13.5642 -9999. 3.88200 13.7836 -9999. 3.63921 14.0066 -9999. 3.41159 14.2331 -9999. 3.17766 14.4633 -9999. 2.94365 14.6973 -9999. 2.72688 14.9350 -9999. 2.47076 15.1765 -9999. 2.21678 15.4220 -9999. 2.01143 15.6714 -9999. 1.90378 15.9249 -9999. 1.80189 16.1825 -9999. 1.70546 16.4442 -9999. 1.63656 16.7102 -9999. 1.58570 16.9805 -9999. 1.55533 17.2551 -9999. 1.57052 17.5342 -9999. 1.60673 17.8178 -9999. 1.71786 18.1060 -9999. 1.98335 18.3989 -9999. 3.14900 18.6964 -9999. 3.91298 18.9988 -9999. 4.10506 19.3061 -9999. 4.30658 19.6184 -9999. 4.47521 19.9357 -9999. 4.62493 20.2582 -9999. 4.77966 20.5858 -9999. 4.87039 20.9188 -9999. 4.91556 21.2571 -9999. 4.96116 21.6009 -9999. 5.00718 21.9503 -9999. 4.96749 22.3053 -9999. 4.90712 22.6661 -9999. 4.84749 23.0327 -9999. 4.80021 23.4053 -9999. 4.77166 23.7838 -9999. 4.74329 24.1685 -9999. 4.71508 24.5594 -9999. 4.69254 24.9566 -9999. 4.67400 25.3603 -9999. 4.65553 25.7705 -9999. 4.66380 26.1873 -9999. 4.71894 26.6109 -9999. 4.77472 27.0413 -9999. 4.85873 27.4786 -9999. 5.00257 27.9231 -9999. 5.15068 28.3747 -9999. 5.30316 28.8337 -9999. 5.46017 29.3000 -0.190469E-01 5.62182 29.7739 -0.197996 5.81943 30.2555 -0.350369 6.06052 30.7449 -0.484374 6.31159 31.2421 -0.607477 6.57307 31.7475 -0.721675 6.84538 32.2609 -0.828426 7.12897 32.7827 -0.928105 7.42430 33.3130 -1.02446 7.73187 33.8518 -1.11200 8.06111 34.3993 -1.18669 8.40549 34.9557 -1.24877 8.76457 35.5211 -1.29792 9.13900 36.0956 -1.33196 9.52942 36.6794 -1.34888 9.93651 37.2727 -1.34422 10.3610 37.8755 -1.29478 10.8036 38.4882 -1.22953 11.2102 39.1107 -1.16711 11.6277 39.7432 -1.09395 12.0606 40.3861 -1.00394 12.5097 41.0393 -0.890645 12.9755 41.7031 -0.745923 13.4587 42.3776 -0.543576 13.9598 43.0630 -0.296529 14.3933 43.7595 -0.633823E-01 14.8078 44.4673 0.162851 15.2343 45.1865 0.404636 15.6730 45.9174 0.670428 16.1244 46.6600 0.977847 16.5888 47.4147 1.35655 17.0083 48.1816 1.71333 17.3743 48.9609 2.04922 17.7481 49.7528 2.39283 18.1300 50.5576 2.74979 18.5201 51.3753 3.12624 18.9186 52.2062 3.52846 19.3257 53.0506 3.96465 19.7416 53.9087 4.49624 20.1664 54.7806 5.03778 20.4618 55.6667 5.54640 20.7546 56.5670 6.05597 21.0516 57.4820 6.57968 21.3528 58.4117 7.12846 21.6584 59.3564 7.71713 21.9683 60.3165 8.39292 22.2826 61.2921 9.11791 22.4414 62.2834 9.79515 22.5474 63.2908 10.4385 22.6540 64.3145 11.0902 22.7611 65.3547 11.8141 22.8686 66.4118 12.5747 22.8385 67.4859 13.2446 22.7256 68.5775 13.8601 22.6134 69.6867 14.4464 22.5016 70.8138 15.0129 22.3905 71.9591 15.5674 22.2836 73.1230 16.1181 22.1787 74.3057 16.6702 22.0744 75.5076 17.2288 21.9706 76.7289 17.8016 21.8673 77.9699 18.3972 21.7644 79.2310 19.1184 21.6620 80.5125 19.8246 21.3316 81.8147 20.4169 20.9720 83.1380 20.9561 20.6185 84.4827 21.4659 20.2709 85.8491 21.9597 19.9292 87.2377 22.4493 19.5933 88.6487 22.9445 19.2630 90.0825 23.5796 18.9170 91.5395 24.1311 18.3324 93.0201 24.5460 17.7658 94.5246 24.9067 17.2168 96.0535 25.2341 16.6847 97.6071 25.5494 16.1691 99.1858 25.9016 15.6111 100.790 26.1721 14.9817 102.420 26.3580 14.3776 104.077 26.5099 13.7979 105.760 26.6449 13.2416 107.471 26.8026 12.7078 109.209 26.9990 12.0481 110.975 27.0515 11.2957 112.770 26.9562 10.5903 114.594 26.7866 9.92901 116.448 26.4624 9.33377 118.331 26.1632 8.92792 120.245 25.9252 8.53970 122.190 25.6884 8.16837 124.166 25.4441 7.81320 126.175 25.1874 7.47345 128.215 24.8457 7.15676 130.289 24.5382 6.98801 132.397 24.2996 6.82325 134.538 24.0848 6.66236 136.714 23.8864 6.50527 138.925 23.7011 6.35188 141.172 23.5300 6.20212 143.456 23.3925 6.05588 145.776 23.2499 5.83434 148.134 23.0656 5.60294 150.530 22.8410 5.38071 152.964 22.5782 5.16729 155.439 22.3000 5.00637 157.953 22.0239 4.85968 160.507 21.7449 4.71729 163.103 21.4528 4.57907 165.742 21.1114 4.44490 168.422 20.7659 4.38366 171.146 20.4408 4.33065 173.915 20.1123 4.27828 176.727 19.7458 4.22654 179.586 19.3527 4.23214 182.491 18.9888 4.28425 185.442 18.6393 4.33701 188.442 18.2782 4.39229 191.489 17.9117 4.46330 194.587 17.5069 4.53545 197.734 17.0794 4.67279 200.932 16.6730 4.85109 204.182 16.2564 5.03619 207.485 15.8217 5.29026 210.840 15.4172 5.59582 214.251 15.0443 5.91903 217.716 14.6842 6.26091 221.237 14.3222 6.62253 224.816 13.9619 7.02794 228.452 13.6286 7.48200 232.147 13.3246 7.96542 235.902 13.0473 8.48005 239.717 12.8034 9.02793 243.595 12.6029 9.61123 247.535 12.4964 10.2322 251.538 12.4204 10.7417 255.607 12.3243 11.2556 259.741 12.2171 11.7942 263.942 12.1223 12.3584 268.211 12.0466 12.9497 272.549 12.0081 13.5693 276.957 11.9950 14.1793 281.437 11.9967 14.8084 285.989 12.0186 15.4653 290.615 12.0755 16.1514 295.315 12.1774 16.8680 300.092 12.3313 17.6163 304.945 12.6954 18.3951 309.878 13.0611 18.9175 314.890 13.3331 19.4547 319.983 13.5960 20.0072 325.158 13.8628 20.5753 330.418 14.1441 21.1596 335.762 14.4475 21.7604 341.192 14.7887 22.3784 346.711 15.1596 22.9883 352.319 15.5648 23.6148 358.017 16.0206 24.2584 363.808 16.5521 24.9196 369.692 17.2953 25.5065 375.672 17.9936 25.8526 381.748 18.5700 26.2034 387.922 19.1362 26.5590 394.197 19.7123 26.9193 400.573 20.3436 27.2651 407.052 20.9434 27.5050 413.635 21.4993 27.7470 420.326 22.0373 27.9911 427.124 22.5667 28.2373 434.032 23.0830 28.4857 441.052 23.6030 28.7548 448.186 24.1409 29.0301 455.435 24.6970 29.3081 462.802 25.2767 29.5887 470.287 25.8826 29.8720 477.894 26.6174 30.1581 485.623 27.3693 30.2584 493.478 28.0247 30.3011 501.459 28.6345 30.3439 509.570 29.2198 30.3867 517.812 29.7900 30.4296 526.187 30.3535 30.4726 534.698 30.9248 30.5098 543.346 31.4781 30.5114 552.134 32.0088 30.5130 561.065 32.5266 30.5146 570.139 33.0349 30.5162 579.361 33.5360 30.5178 588.732 34.0325 30.5194 598.254 34.5296 30.5161 607.930 35.0171 30.5018 617.763 35.4915 30.4876 627.755 35.9573 30.4733 637.908 36.4129 30.4591 648.226 36.8461 30.4449 658.711 37.2768 30.4754 669.365 37.7271 30.5171 680.191 38.1957 30.5589 691.193 38.6759 30.6007 702.372 39.1686 30.6426 713.733 39.6763 30.6846 725.277 40.2046 30.7266 737.008 40.7789 30.7687 748.928 41.3642 30.7284 761.042 41.9263 30.6716 773.351 42.4766 30.6148 785.859 43.0405 30.5581 798.570 43.6263 30.4589 811.486 44.1861 30.3133 824.611 44.7075 30.1684 837.949 45.2161 30.0242 851.502 45.7079 29.8708 865.274 46.1576 29.7313 879.269 46.6299 29.6754 893.491 47.1570 29.6188 907.943 47.7334 29.5621 922.628 48.4206 29.5053 937.551 49.1309 29.2356 952.715 49.7778 28.9114 968.124 50.3491 28.5412 983.783 50.8717 28.1749 999.695 51.3693 27.8069 1015.86 51.8629 27.4369 1032.29 52.3204 27.0066 1048.99 52.7278 26.5799 1065.96 53.0993 26.1572 1083.20 53.4421 25.7403 1100.72 53.7600 25.3299 1118.52 54.0566 24.9258 1136.61 54.3335 24.5275 1155. 54.5921 24.1351 1173.68 54.8337 23.7486 1192.66 55.0592 23.3680 1211.95 55.2695 22.9932 1231.55 55.4648 22.6243 1251.47 55.6456 22.2625 1271.72 55.8136 21.9081 1292.29 55.9712 21.5614 1313.19 56.1187 21.2198 1334.43 56.2559 20.8834 1356.01 56.3829 20.5520 1377.94 56.5001 20.2255 1400.23 56.6079 19.9039 1422.88 56.7069 19.5870 1445.89 56.7988 19.2751 1469.28 56.8859 18.9645 1493.04 56.9697 18.6533 1517.19 57.0382 18.3246 1541.73 57.0835 17.9986 1566.67 57.1098 17.6781 1592.01 57.1202 17.3633 1617.76 57.1157 17.0540 1643.92 57.0962 16.7496 1670.51 57.0618 16.4507 1697.53 57.0125 16.1571 1724.99 56.9534 15.8686 1752.89 56.8780 15.5744 1781.24 56.7787 15.2820 1810.05 56.6564 14.9920 1839.32 56.5093 14.7078 1869.07 56.3380 14.4290 1899.30 56.1407 14.1553 1930.02 55.9154 13.8869 1961.24 55.6592 13.6235 1992.96 55.3668 13.3650 2025.20 55.0434 13.1185 2057.95 54.6797 12.8632 2091.24 54.2571 12.6103 2125.06 53.7720 12.3611 2159.43 53.2117 12.1153 2194.36 52.5593 11.8730 2229.85 51.7911 11.6340 2265.92 50.8725 11.3989 2302.57 49.7492 11.1668 2339.81 48.3300 10.9385 2377.66 46.4421 10.7132 2416.11 43.6817 10.4912 2455.19 38.5802 10.2727 2483.90 7.55536 10.1172 2484.10 7.55545 27.1005 2494.90 32.7224 26.9285 2535.26 39.4912 26.3021 2576.26 36.9488 25.6922 2585.50 20.8428 25.5580 2585.70 20.8582 37.1626 2617.93 44.0586 36.5035 2660.27 48.9258 35.6671 2703.30 51.9651 34.8512 2747.03 54.2035 34.0545 2791.46 55.9517 33.2771 2836.61 57.3468 32.5188 2882.49 58.4533 31.7787 2929.11 59.2865 31.0559 2976.48 59.7967 30.3501 3024.63 59.8782 29.6607 3066.30 52.2055 29.0851 3066.50 52.2198 33.7226 3073.55 58.1504 33.6102 3123.26 61.9965 32.8347 3173.78 63.6676 32.0774 3225.11 64.8856 31.3389 3277.27 65.8627 30.6172 3330.28 66.6690 29.9126 3384.15 67.3318 29.2257 3438.88 67.8473 28.5547 3494.50 68.1485 27.8995 3551.02 67.1984 27.2592 3554.10 65.4185 27.2250 3554.30 65.4207 28.8681 3608.46 69.2095 28.2577 3666.82 70.0404 27.6241 3726.13 70.6325 27.0039 3786.40 71.2018 26.3988 3847.64 70.5957 25.8082 3850.60 70.0014 25.7802 3850.80 70.0105 26.9029 3909.87 72.0749 26.3307 3973.11 72.7886 25.7409 4037.38 73.3590 25.1637 4102.68 73.8532 24.5952 4169.03 74.2923 24.0380 4236.46 74.6888 23.4915 4304.98 75.0501 22.9555 4374.62 75.3804 22.4299 4445.37 75.6838 21.9144 4517.27 75.9624 21.4086 4590.33 76.2187 20.9140 4664.58 76.4553 20.4285 4740.03 76.6730 19.9531 4816.69 76.8734 19.4874 4894.60 77.0577 19.0313 4973.77 77.2271 18.5848 5054.21 77.3825 18.1474 5135.96 77.5246 17.7195 5219.03 77.6546 17.3007 5303.44 77.7730 16.8908 5389.22 77.8805 16.4899 5476.39 77.9778 16.0974 5564.97 78.0653 15.7138 5654.98 78.1437 15.3386 5746.44 78.2137 14.9716 5839.39 78.2753 14.6127 5933.83 78.3291 14.2620 6029.81 78.3757 13.9191 6127.33 78.4153 13.5837 6226.44 78.4481 13.2562 6327.15 78.4748 12.9361 6429.48 78.4954 12.6231 6533.48 78.5102 12.3174 6639.15 78.5196 12.0188 6746.54 78.5237 11.7269 6855.65 78.5227 11.4420 6966.54 78.5171 11.1635 7079.22 78.5066 10.8916 7193.72 78.4918 10.6259 7310.07 78.4724 10.3665 7428.31 78.4489 10.1134 7548.45 78.4215 9.86598 7670.54 78.3900 9.62445 7794.61 78.3545 9.38862 7920.68 78.3152 9.15857 8048.79 78.2721 8.93357 8178.98 78.2250 8.71414 8311.26 78.1742 8.50001 8445.69 78.1198 8.29100 8582.29 78.0614 8.08675 8721.11 77.9992 7.88755 8862.16 77.9328 7.69289 9005.50 77.8622 7.50323 9151.16 77.7877 7.31784 9299.17 77.7086 7.13700 9449.58 77.6250 6.96041 9602.42 77.5366 6.78811 9757.73 77.4434 6.61995 9915.55 77.3469 6.45597 10075.9 77.2448 6.28685 10238.9 77.1286 6.12209 10404.5 77.0024 5.96160 10572.8 76.8651 5.80528 10743.8 76.7155 5.65305 10917.6 76.5520 5.50481 11094.2 76.3724 5.36048 11273.6 76.1736 5.21995 11455.9 75.9513 5.08316 11641.2 75.6997 4.95001 11829.5 75.4099 4.82040 12020.8 75.0682 4.69427 12215.3 74.6520 4.57153 12412.8 74.1185 4.45209 12613.6 73.3727 4.33588 12817.6 72.1273 4.22282 13025.0 66.2656 4.11283 13035.1 57.3925 4.10756 13035.3 57.3934 10.2182 13235.6 72.1211 9.94988 13449.7 73.5107 9.67521 13667.2 74.2555 9.40812 13888.3 74.7157 9.14841 14112.9 74.9955 8.89587 14341.2 75.1292 8.65032 14573.1 75.1116 8.41153 14808.9 74.8802 8.17935 15048.4 74.1340 7.95357 15199.9 67.1548 7.81578 15200.1 67.1557 10.8971 15291.8 73.7601 10.8014 15539.1 75.0244 10.5499 15790.4 75.0876 10.3043 15860.7 72.1981 10.2374 15860.9 72.1987 11.7048 16045.8 76.1119 11.5060 16305.4 76.9637 11.2365 16569.1 77.5480 10.9716 16837.1 78.0109 10.7114 17109.4 78.3979 10.4559 17386.1 78.7308 10.2051 17667.4 79.0223 9.95896 17953.1 79.2805 9.71754 18243.5 79.5111 9.48079 18538.6 79.7183 9.24872 18838.4 79.9053 9.02127 19143.1 80.0746 8.79845 19452.7 80.2283 8.58020 19767.4 80.3680 8.36648 20087.1 80.4952 8.15726 20412.0 80.6110 7.95250 20742.1 80.7165 7.75215 21077.6 80.8126 7.55615 21418.5 80.9001 7.36446 21765.0 80.9796 7.17701 22117.0 81.0518 6.99377 22474.7 81.1173 6.81465 22838.2 81.1765 6.63961 23207.6 81.2299 6.46858 23583.0 81.2779 6.30150 23964.4 81.3210 6.13832 24352.0 81.3594 5.97895 24745.9 81.3934 5.82334 25146.2 81.4234 5.67142 25552.9 81.4497 5.52314 25966.2 81.4724 5.37841 26386.1 81.4918 5.23718 26812.9 81.5082 5.09938 27246.6 81.5217 4.96494 27687.3 81.5325 4.83380 28135.1 81.5408 4.70590 28590.2 81.5468 4.58116 29052.6 81.5506 4.45953 29522.5 81.5523 4.34093 30000.0 81.5521 4.22531 periodictable-1.5.0/periodictable/xsf/pd.nff000066400000000000000000000315331310514471200210320ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.15058 10.1617 -9999. 1.20950 10.3261 -9999. 1.27144 10.4931 -9999. 1.33655 10.6628 -9999. 1.40499 10.8353 -9999. 1.47694 11.0106 -9999. 1.54695 11.1886 -9999. 1.61473 11.3696 -9999. 1.68548 11.5535 -9999. 1.75934 11.7404 -9999. 1.83643 11.9303 -9999. 1.91689 12.1232 -9999. 2.00089 12.3193 -9999. 2.08948 12.5186 -9999. 2.18421 12.7210 -9999. 2.28325 12.9268 -9999. 2.38677 13.1359 -9999. 2.49498 13.3483 -9999. 2.60810 13.5642 -9999. 2.72635 13.7836 -9999. 2.84283 14.0066 -9999. 2.96107 14.2331 -9999. 3.08423 14.4633 -9999. 3.21251 14.6973 -9999. 3.34613 14.9350 -9999. 3.48531 15.1765 -9999. 3.61751 15.4220 -9999. 3.73784 15.6714 -9999. 3.86218 15.9249 -9999. 3.99066 16.1825 -9999. 4.12341 16.4442 -9999. 4.26057 16.7102 -9999. 4.40230 16.9805 -9999. 4.54875 17.2551 -9999. 4.69059 17.5342 -9999. 4.83211 17.8178 -9999. 4.97790 18.1060 -9999. 5.12808 18.3989 -9999. 5.28280 18.6964 -9999. 5.44219 18.9988 -9999. 5.60638 19.3061 -9999. 5.75266 19.6184 -9999. 5.88940 19.9357 -9999. 6.02939 20.2582 -9999. 6.17270 20.5858 -9999. 6.31942 20.9188 -9999. 6.46962 21.2571 -9999. 6.62340 21.6009 -9999. 6.76795 21.9503 -9999. 6.90829 22.3053 -9999. 7.05155 22.6661 -9999. 7.19776 23.0327 -9999. 7.34702 23.4053 -9999. 7.49937 23.7838 -9999. 7.65487 24.1685 -9999. 7.80737 24.5594 -9999. 7.94154 24.9566 -9999. 8.07801 25.3603 -9999. 8.21683 25.7705 -9999. 8.35803 26.1873 -9999. 8.50167 26.6109 -9999. 8.64777 27.0413 -9999. 8.77838 27.4786 -9999. 8.88318 27.9231 -9999. 8.98924 28.3747 -9999. 9.09656 28.8337 -9999. 9.20517 29.3000 1.54728 9.31507 29.7739 1.68191 9.41939 30.2555 1.80849 9.51027 30.7449 1.92773 9.60203 31.2421 2.04259 9.69467 31.7475 2.15374 9.78821 32.2609 2.26086 9.88265 32.7827 2.36175 9.97801 33.3130 2.45390 10.0842 33.8518 2.55068 10.2026 34.3993 2.65431 10.3223 34.9557 2.75947 10.4435 35.5211 2.86507 10.5661 36.0956 2.96999 10.6901 36.6794 3.06759 10.8156 37.2727 3.15221 10.9541 37.8755 3.25131 11.1255 38.4882 3.36839 11.2995 39.1107 3.49690 11.4763 39.7432 3.63564 11.6559 40.3861 3.78429 11.8382 41.0393 3.94343 12.0234 41.7031 4.11395 12.2116 42.3776 4.29793 12.4026 43.0630 4.49925 12.5966 43.7595 4.73652 12.7937 44.4673 4.98501 12.9330 45.1865 5.21655 13.0611 45.9174 5.43655 13.1905 46.6600 5.65494 13.3211 47.4147 5.87331 13.4531 48.1816 6.09288 13.5863 48.9609 6.31409 13.7209 49.7528 6.53706 13.8568 50.5576 6.76072 13.9940 51.3753 6.97936 14.1326 52.2062 7.19439 14.2972 53.0506 7.42998 14.4824 53.9087 7.69204 14.6700 54.7806 7.97198 14.8601 55.6667 8.27205 15.0526 56.5670 8.59953 15.2476 57.4820 8.95274 15.4188 58.4117 9.31093 15.5794 59.3564 9.67671 15.7417 60.3165 10.0600 15.9057 61.2921 10.4650 16.0714 62.2834 10.8979 16.2388 63.2908 11.3689 16.4079 64.3145 11.9115 16.5788 65.3547 12.5064 16.6155 66.4118 13.0495 16.6350 67.4859 13.5961 16.6546 68.5775 14.1718 16.6743 69.6867 14.8297 16.6679 70.8138 15.4959 16.5029 71.9591 16.0761 16.3395 73.1230 16.6625 16.1777 74.3057 17.3141 16.0175 75.5076 17.9868 15.7013 76.7289 18.5638 15.3840 77.9699 19.1489 15.0731 79.2310 19.8604 14.7684 80.5125 20.6699 14.2592 81.8147 21.3079 13.4450 83.1380 21.7471 12.6117 84.4827 22.0123 11.7998 85.8491 22.1785 11.0402 87.2377 22.2740 10.3295 88.6487 22.3160 9.66450 90.0825 22.3177 9.04232 91.5395 22.2892 8.46021 93.0201 22.2542 7.91556 94.5246 22.2132 7.37038 96.0535 22.1152 6.81841 97.6071 21.9737 6.30776 99.1858 21.8074 5.83537 100.790 21.6238 5.39834 102.420 21.4290 4.99406 104.077 21.2277 4.62004 105.760 21.0284 4.27404 107.471 20.8437 3.95395 109.209 20.6693 3.57216 110.975 20.4177 3.20927 112.770 20.1303 2.88323 114.594 19.8166 2.59807 116.448 19.5046 2.37804 118.331 19.2058 2.17665 120.245 18.9069 1.99231 122.190 18.5989 1.82358 124.166 18.2778 1.70309 126.175 17.9801 1.60183 128.215 17.6774 1.51630 130.289 17.3804 1.46311 132.397 17.0840 1.43291 134.538 16.8050 1.42282 136.714 16.5328 1.44663 138.925 16.2850 1.47786 141.172 16.0365 1.52489 143.456 15.8119 1.60388 145.776 15.6137 1.68697 148.134 15.4329 1.77342 150.530 15.2666 1.86419 152.964 15.1153 1.95962 155.439 14.9777 2.05160 157.953 14.8474 2.14652 160.507 14.7271 2.24584 163.103 14.6188 2.34976 165.742 14.5317 2.45848 168.422 14.4757 2.54546 171.146 14.3999 2.61446 173.915 14.3202 2.68532 176.727 14.2412 2.75811 179.586 14.1640 2.83287 182.491 14.0904 2.90965 185.442 14.0224 2.98517 188.442 13.9533 3.05947 191.489 13.8854 3.13562 194.587 13.8199 3.21367 197.734 13.7575 3.29366 200.932 13.6998 3.37565 204.182 13.6503 3.45967 207.485 13.6103 3.52937 210.840 13.5608 3.59298 214.251 13.5081 3.65772 217.716 13.4542 3.72364 221.237 13.4004 3.79075 224.816 13.3478 3.85907 228.452 13.3003 3.92861 232.147 13.2669 3.99075 235.902 13.2217 4.03150 239.717 13.1651 4.07267 243.595 13.1029 4.11368 247.535 13.0360 4.15465 251.538 12.9685 4.19602 255.607 12.9117 4.23068 259.741 12.8371 4.23599 263.942 12.7418 4.24130 268.211 12.6358 4.24663 272.549 12.5155 4.23541 276.957 12.3687 4.22070 281.437 12.1968 4.20605 285.989 11.9988 4.19311 290.615 11.7768 4.18333 295.315 11.5255 4.17356 300.092 11.2344 4.16914 304.945 10.9093 4.17285 309.878 10.5229 4.17656 314.890 10.0920 4.24602 319.983 9.63853 4.32807 325.158 9.11353 4.41976 330.418 8.54787 4.59013 335.762 7.92781 4.76707 341.192 7.19761 4.97110 346.711 6.26083 5.20196 352.319 5.13398 5.81284 358.017 3.94907 6.76628 363.808 2.88486 8.08133 369.692 2.01484 9.88670 375.672 2.07770 11.9362 381.748 2.23414 13.5957 387.922 2.81952 15.3743 394.197 3.48331 16.7201 400.573 4.43753 18.1839 407.052 5.45854 19.0507 413.635 6.52308 19.8902 420.326 7.46246 20.3621 427.124 8.23898 20.8451 434.032 8.99365 21.3314 441.052 9.70207 21.7520 448.186 10.3764 22.1809 455.435 11.0414 22.6182 462.802 11.7178 23.0642 470.287 12.5083 23.4911 477.894 13.2552 23.7729 485.623 13.9364 24.0582 493.478 14.6063 24.3469 501.459 15.2777 24.6391 509.570 15.9716 24.9323 517.812 16.6705 25.1937 526.187 17.3791 25.4578 534.698 18.1157 25.7247 543.346 18.9230 25.9943 552.134 19.8177 26.1282 561.065 20.6488 26.1468 570.139 21.4066 26.1654 579.361 22.1528 26.1840 588.732 22.9600 26.2026 598.254 23.7710 26.0913 607.930 24.4911 25.9169 617.763 25.1519 25.7437 627.755 25.7721 25.5717 637.908 26.3405 25.4008 648.226 26.9051 25.3047 658.711 27.4954 25.2167 669.365 28.1418 25.1291 680.191 28.8295 24.9808 691.193 29.4775 24.7535 702.372 30.0909 24.5283 713.733 30.7639 24.3052 725.277 31.4196 23.9481 737.008 31.9759 23.5530 748.928 32.4762 23.1645 761.042 32.9200 22.7823 773.351 33.3473 22.4450 785.859 33.7918 22.0922 798.570 34.2082 21.7092 811.486 34.5821 21.3311 824.611 34.9332 20.9601 837.949 35.2658 20.5959 851.502 35.5817 20.2361 865.274 35.8817 19.8809 879.269 36.1664 19.5302 893.491 36.4372 19.1859 907.943 36.6961 18.8475 922.628 36.9480 18.5151 937.551 37.1902 18.1814 952.715 37.4192 17.8520 968.124 37.6386 17.5271 983.783 37.8511 17.2081 999.695 38.0578 16.8916 1015.86 38.2687 16.5776 1032.29 38.4705 16.2403 1048.99 38.6446 15.9060 1065.96 38.8044 15.5747 1083.20 38.9490 15.2502 1100.72 39.0822 14.9324 1118.52 39.2049 14.6212 1136.61 39.3183 14.3168 1155. 39.4232 14.0186 1173.68 39.5202 13.7266 1192.66 39.6098 13.4406 1211.95 39.6924 13.1606 1231.55 39.7681 12.8863 1251.47 39.8375 12.6181 1271.72 39.9012 12.3559 1292.29 39.9596 12.0994 1313.19 40.0131 11.8483 1334.43 40.0619 11.6026 1356.01 40.1062 11.3619 1377.94 40.1461 11.1260 1400.23 40.1818 10.8951 1422.88 40.2136 10.6690 1445.89 40.2416 10.4475 1469.28 40.2661 10.2304 1493.04 40.2872 10.0175 1517.19 40.3050 9.80804 1541.73 40.3184 9.60281 1566.67 40.3284 9.40189 1592.01 40.3352 9.20504 1617.76 40.3387 9.01229 1643.92 40.3394 8.82359 1670.51 40.3374 8.63894 1697.53 40.3335 8.45820 1724.99 40.3288 8.28132 1752.89 40.3238 8.10126 1781.24 40.3114 7.92277 1810.05 40.2932 7.74642 1839.32 40.2696 7.57420 1869.07 40.2417 7.40586 1899.30 40.2097 7.24131 1930.02 40.1739 7.08028 1961.24 40.1341 6.92281 1992.96 40.0902 6.76886 2025.20 40.0435 6.62217 2057.95 39.9975 6.47064 2091.24 39.9435 6.32088 2125.06 39.8833 6.17393 2159.43 39.8174 6.02983 2194.36 39.7458 5.88782 2229.85 39.6676 5.74790 2265.92 39.5825 5.61058 2302.57 39.4902 5.47561 2339.81 39.3898 5.34289 2377.66 39.2808 5.21235 2416.11 39.1622 5.08409 2455.19 39.0332 4.95804 2494.90 38.8921 4.83414 2535.26 38.7377 4.71230 2576.26 38.5680 4.59257 2617.93 38.3809 4.47494 2660.27 38.1732 4.35936 2703.30 37.9412 4.24569 2747.03 37.6801 4.13399 2791.46 37.3833 4.02424 2836.61 37.0413 3.91646 2882.49 36.6409 3.81048 2929.11 36.1614 3.70628 2976.48 35.5691 3.60401 3024.63 34.8015 3.50349 3073.55 33.7207 3.40473 3123.26 31.8949 3.30764 3173.20 16.3951 3.21438 3173.40 16.3958 10.9859 3173.78 20.2530 10.9839 3225.11 31.5760 10.7176 3277.27 32.5883 10.4575 3330.20 26.0278 10.2043 3330.40 26.0320 14.0589 3384.15 34.5501 13.7240 3438.88 35.9648 13.3964 3494.50 36.8336 13.0763 3551.02 37.3079 12.7644 3604.20 34.7592 12.4820 3604.40 34.7614 14.0806 3608.46 36.7045 14.0598 3666.82 38.6802 13.7658 3726.13 39.5432 13.4765 3786.40 40.2126 13.1884 3847.64 40.7757 12.9036 3909.87 41.2672 12.6220 3973.11 41.7024 12.3439 4037.38 42.0935 12.0690 4102.68 42.4474 11.7972 4169.03 42.7695 11.5290 4236.46 43.0634 11.2648 4304.98 43.3333 11.0052 4374.62 43.5813 10.7482 4445.37 43.8097 10.4957 4517.27 44.0202 10.2475 4590.33 44.2144 10.0034 4664.58 44.3940 9.76322 4740.03 44.5598 9.52728 4816.69 44.7130 9.29577 4894.60 44.8547 9.06847 4973.77 44.9855 8.84528 5054.21 45.1063 8.62641 5135.96 45.2178 8.41177 5219.03 45.3205 8.20146 5303.44 45.4150 7.99517 5389.22 45.5019 7.79324 5476.39 45.5817 7.59548 5564.97 45.6548 7.40188 5654.98 45.7217 7.21234 5746.44 45.7826 7.02677 5839.39 45.8380 6.84535 5933.83 45.8881 6.66786 6029.81 45.9333 6.49442 6127.33 45.9741 6.32485 6226.44 46.0104 6.15900 6327.15 46.0427 5.99712 6429.48 46.0712 5.83885 6533.48 46.0960 5.68428 6639.15 46.1175 5.53335 6746.54 46.1357 5.38604 6855.65 46.1511 5.24231 6966.54 46.1636 5.10187 7079.22 46.1734 4.96486 7193.72 46.1808 4.83124 7310.07 46.1858 4.70079 7428.31 46.1886 4.57368 7548.45 46.1893 4.44963 7670.54 46.1881 4.32883 7794.61 46.1851 4.21098 7920.68 46.1803 4.09600 8048.79 46.1741 3.98408 8178.98 46.1662 3.87492 8311.26 46.1570 3.76863 8445.69 46.1465 3.66501 8582.29 46.1348 3.56415 8721.11 46.1219 3.46582 8862.16 46.1079 3.37009 9005.50 46.0929 3.27674 9151.16 46.0769 3.18607 9299.17 46.0601 3.09768 9449.58 46.0426 3.01168 9602.42 46.0242 2.92782 9757.73 46.0050 2.84634 9915.55 45.9853 2.76702 10075.9 45.9649 2.68981 10238.9 45.9439 2.61468 10404.5 45.9224 2.54158 10572.8 45.9004 2.47046 10743.8 45.8779 2.40127 10917.6 45.8549 2.33397 11094.2 45.8315 2.26851 11273.6 45.8078 2.20485 11455.9 45.7836 2.14293 11641.2 45.7591 2.08272 11829.5 45.7342 2.02417 12020.8 45.7091 1.96724 12215.3 45.6835 1.91189 12412.8 45.6577 1.85808 12613.6 45.6316 1.80577 12817.6 45.6051 1.75493 13025.0 45.5784 1.70550 13235.6 45.5513 1.65746 13449.7 45.5239 1.61077 13667.2 45.4962 1.56539 13888.3 45.4682 1.52129 14112.9 45.4397 1.47844 14341.2 45.4109 1.43680 14573.1 45.3817 1.39634 14808.9 45.3521 1.35703 15048.4 45.3219 1.31884 15291.8 45.2913 1.28174 15539.1 45.2600 1.24569 15790.4 45.2282 1.21067 16045.8 45.1957 1.17666 16305.4 45.1624 1.14361 16569.1 45.1282 1.11152 16837.1 45.0931 1.08035 17109.4 45.0570 1.05007 17386.1 45.0196 1.02067 17667.4 44.9809 0.992113 17953.1 44.9407 0.964380 18243.5 44.8988 0.937448 18538.6 44.8548 0.911296 18838.4 44.8086 0.885900 19143.1 44.7597 0.861240 19452.7 44.7077 0.837296 19767.4 44.6520 0.814046 20087.1 44.5920 0.791473 20412.0 44.5268 0.769556 20742.1 44.4553 0.748277 21077.6 44.3758 0.727617 21418.5 44.2865 0.707561 21765.0 44.1842 0.688089 22117.0 44.0647 0.669186 22474.7 43.9211 0.650836 22838.2 43.7419 0.633022 23207.6 43.5051 0.615730 23583.0 43.1610 0.598944 23964.4 42.5497 0.582650 24350.2 34.6455 0.566870 24350.4 34.6456 3.61141 24352.0 37.4012 3.61104 24745.9 42.7370 3.52351 25146.2 43.4626 3.43753 25552.9 43.8977 3.35311 25966.2 44.2104 3.27026 26386.1 44.4542 3.18896 26812.9 44.6531 3.10924 27246.6 44.8204 3.03108 27687.3 44.9638 2.95447 28135.1 45.0887 2.87941 28590.2 45.1986 2.80589 29052.6 45.2962 2.73391 29522.5 45.3833 2.66344 30000.0 45.4616 2.59448 periodictable-1.5.0/periodictable/xsf/pm.nff000066400000000000000000000316221310514471200210420ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.216409 10.1617 -9999. 0.224290 10.3261 -9999. 0.232458 10.4931 -9999. 0.240924 10.6628 -9999. 0.249698 10.8353 -9999. 0.258791 11.0106 -9999. 0.268216 11.1886 -9999. 0.277984 11.3696 -9999. 0.288107 11.5535 -9999. 0.298599 11.7404 -9999. 0.309474 11.9303 -9999. 0.320744 12.1232 -9999. 0.332425 12.3193 -9999. 0.342577 12.5186 -9999. 0.351995 12.7210 -9999. 0.361672 12.9268 -9999. 0.371615 13.1359 -9999. 0.381831 13.3483 -9999. 0.392328 13.5642 -9999. 0.403114 13.7836 -9999. 0.413580 14.0066 -9999. 0.422763 14.2331 -9999. 0.432149 14.4633 -9999. 0.441745 14.6973 -9999. 0.454608 14.9350 -9999. 0.467940 15.1765 -9999. 0.481663 15.4220 -9999. 0.495789 15.6714 -9999. 0.510328 15.9249 -9999. 0.525294 16.1825 -9999. 0.540699 16.4442 -9999. 0.557512 16.7102 -9999. 0.575659 16.9805 -9999. 0.594396 17.2551 -9999. 0.613743 17.5342 -9999. 0.635334 17.8178 -9999. 0.669871 18.1060 -9999. 0.706284 18.3989 -9999. 0.744677 18.6964 -9999. 0.797210 18.9988 -9999. 0.886072 19.3061 -9999. 0.984840 19.6184 -9999. 1.11359 19.9357 -9999. 1.35765 20.2582 -9999. 1.65520 20.5858 -9999. 2.03967 20.9188 -9999. 2.62362 21.2571 -9999. 3.22731 21.6009 -9999. 3.82803 21.9503 -9999. 4.54056 22.3053 -9999. 5.39840 22.6661 -9999. 6.42938 23.0327 -9999. 7.59968 23.4053 -9999. 8.88775 23.7838 -9999. 10.3218 24.1685 -9999. 11.9352 24.5594 -9999. 12.9530 24.9566 -9999. 13.6096 25.3603 -9999. 14.2995 25.7705 -9999. 14.6770 26.1873 -9999. 14.9654 26.6109 -9999. 15.2594 27.0413 -9999. 15.4623 27.4786 -9999. 15.1782 27.9231 -9999. 14.8994 28.3747 -9999. 14.6256 28.8337 -9999. 14.3569 29.3000 8.45615 14.0932 29.7739 9.08674 13.7903 30.2555 9.62563 13.4041 30.7449 10.0872 13.0287 31.2421 10.4990 12.6638 31.7475 10.8837 12.3092 32.2609 11.2703 11.9645 32.7827 11.6222 11.5060 33.3130 11.8689 11.0499 33.8518 12.0472 10.6119 34.3993 12.1621 10.1913 34.9557 12.1930 9.82892 35.5211 12.2432 9.54370 36.0956 12.2969 9.26675 36.6794 12.3407 8.99784 37.2727 12.3646 8.73673 37.8755 12.3543 8.48321 38.4882 12.3351 8.30142 39.1107 12.3359 8.12735 39.7432 12.3395 7.95692 40.3861 12.3397 7.79007 41.0393 12.3331 7.62671 41.7031 12.3160 7.46678 42.3776 12.2767 7.31020 43.0630 12.1873 7.19367 43.7595 12.1414 7.13115 44.4673 12.1209 7.06918 45.1865 12.1102 7.00775 45.9174 12.1063 6.94686 46.6600 12.1090 6.88559 47.4147 12.1123 6.81833 48.1816 12.1138 6.75173 48.9609 12.1138 6.68578 49.7528 12.1123 6.62047 50.5576 12.1090 6.55580 51.3753 12.1038 6.49176 52.2062 12.0970 6.42675 53.0506 12.0846 6.36093 53.9087 12.0665 6.29579 54.7806 12.0411 6.23133 55.6667 12.0031 6.16750 56.5670 11.9579 6.12616 57.4820 11.9206 6.09029 58.4117 11.8836 6.05465 59.3564 11.8412 6.01921 60.3165 11.7976 5.99766 61.2921 11.7590 5.97768 62.2834 11.7215 5.95777 63.2908 11.6833 5.93793 64.3145 11.6437 5.91815 65.3547 11.6018 5.89843 66.4118 11.5571 5.87879 67.4859 11.5088 5.85920 68.5775 11.4556 5.83969 69.6867 11.3958 5.82396 70.8138 11.3352 5.81106 71.9591 11.2719 5.79819 73.1230 11.2046 5.78535 74.3057 11.1325 5.77254 75.5076 11.0551 5.75976 76.7289 10.9718 5.74701 77.9699 10.8822 5.73427 79.2310 10.7859 5.72158 80.5125 10.6825 5.70890 81.8147 10.5726 5.69627 83.1380 10.4605 5.68365 84.4827 10.3360 5.64880 85.8491 10.1889 5.61309 87.2377 10.0212 5.57760 88.6487 9.83378 5.54234 90.0825 9.62541 5.50730 91.5395 9.39424 5.47248 93.0201 9.13798 5.43788 94.5246 8.85386 5.40350 96.0535 8.53861 5.36934 97.6071 8.18845 5.33539 99.1858 7.79915 5.30166 100.790 7.36771 5.26814 102.420 6.90213 5.23483 104.077 6.37205 5.14058 105.760 5.71711 5.03015 107.471 4.93525 4.92209 109.209 4.00708 4.81635 110.975 2.89932 4.70689 112.770 1.53841 4.59202 114.594 -0.187683 4.51662 116.448 -2.29892 4.51673 118.331 -5.05465 4.51684 120.245 -9.05336 4.57800 122.190 -15.5338 4.99732 124.166 -27.3019 10.2291 126.175 -38.8972 26.5721 128.215 -22.7101 57.1104 130.289 -4.71095 56.8664 132.397 7.37775 54.5017 134.538 14.8744 50.2126 136.714 19.5442 46.2611 138.925 22.6048 42.6859 141.172 24.9585 40.0198 143.456 26.9095 37.5202 145.776 28.5041 35.1767 148.134 29.7677 32.9797 150.530 30.7368 30.9198 152.964 31.4670 29.0538 155.439 32.0637 27.3351 157.953 32.5279 25.7179 160.507 32.8699 24.1965 163.103 33.1022 22.7650 165.742 33.2365 21.4183 168.422 33.2810 20.1511 171.146 33.2415 18.9590 173.915 33.1172 17.8374 176.727 32.8936 16.7822 179.586 32.4733 15.8826 182.491 32.1736 15.2489 185.442 31.9417 14.6406 188.442 31.7317 14.0564 191.489 31.5248 13.4956 194.587 31.3114 12.9571 197.734 31.0838 12.4402 200.932 30.8342 11.9438 204.182 30.5489 11.4673 207.485 30.1287 11.0440 210.840 29.7770 10.8367 214.251 29.5185 10.6332 217.716 29.2917 10.4336 221.237 29.0816 10.2377 224.816 28.8784 10.0455 228.452 28.6735 9.85694 232.147 28.4565 9.67188 235.902 28.1793 9.49030 239.717 27.8855 9.43913 243.595 27.6702 9.43755 247.535 27.4975 9.43598 251.538 27.3493 9.43439 255.607 27.2174 9.43282 259.741 27.0960 9.43124 263.942 26.9801 9.42967 268.211 26.8635 9.42810 272.549 26.7317 9.42652 276.957 26.5625 9.47945 281.437 26.4420 9.58710 285.989 26.3664 9.69597 290.615 26.3123 9.80607 295.315 26.2762 9.91744 300.092 26.2559 10.0301 304.945 26.2498 10.1440 309.878 26.2572 10.2591 314.890 26.2774 10.3756 319.983 26.3101 10.4935 325.158 26.3555 10.6126 330.418 26.4139 10.7332 335.762 26.4861 10.8550 341.192 26.5740 10.9783 346.711 26.6814 11.1030 352.319 26.8260 11.2224 358.017 26.9696 11.2973 363.808 27.1102 11.3728 369.692 27.2560 11.4487 375.672 27.4145 11.5251 381.748 27.5954 11.6020 387.922 27.8375 11.6794 394.197 28.0709 11.6206 400.573 28.2572 11.5534 407.052 28.4085 11.4865 413.635 28.5414 11.4200 420.326 28.6587 11.3539 427.124 28.7616 11.2882 434.032 28.8314 11.2230 441.052 28.9023 11.2044 448.186 28.9877 11.1857 455.435 29.0773 11.1671 462.802 29.1689 11.1485 470.287 29.2621 11.1300 477.894 29.3567 11.1114 485.623 29.4535 11.0929 493.478 29.5539 11.0745 501.459 29.6632 11.0560 509.570 29.7807 11.0183 517.812 29.8915 10.9676 526.187 29.9937 10.9115 534.698 30.0897 10.8456 543.346 30.1737 10.7751 552.134 30.2509 10.7052 561.065 30.3220 10.6290 570.139 30.3830 10.5501 579.361 30.4340 10.4711 588.732 30.4770 10.3925 598.254 30.5125 10.3145 607.930 30.5412 10.2372 617.763 30.5640 10.1604 627.755 30.5835 10.0836 637.908 30.5985 10.0001 648.226 30.6040 9.90672 658.711 30.5898 9.80720 669.365 30.5551 9.70863 680.191 30.5019 9.62524 691.193 30.4457 9.55332 702.372 30.3959 9.48314 713.733 30.3410 9.39624 725.277 30.2625 9.29832 737.008 30.1630 9.20140 748.928 30.0444 9.10546 761.042 29.9068 9.01035 773.351 29.7502 8.91471 785.859 29.5710 8.81474 798.570 29.3613 8.71151 811.486 29.1193 8.60958 824.611 28.8427 8.50874 837.949 28.5276 8.40898 851.502 28.1681 8.30883 865.274 27.7560 8.20775 879.269 27.2792 8.10604 893.491 26.7251 8.00569 907.943 26.0762 7.90664 922.628 25.3084 7.80888 937.551 24.3802 7.70707 952.715 23.2288 7.60544 968.124 21.7470 7.50418 983.783 19.7266 7.40404 999.695 16.6575 7.30526 1015.86 10.4971 7.20783 1026.80 -21.7185 7.14352 1027. -21.7164 28.7355 1032.29 5.61243 28.7481 1048.99 15.3585 28.7874 1065.96 19.3789 28.8269 1083.20 22.0202 28.8662 1100.72 24.0292 28.9056 1118.52 25.6767 28.9450 1136.61 27.0919 28.9844 1155. 28.3467 29.0239 1173.68 29.4853 29.0635 1192.66 30.5373 29.1032 1211.95 31.5232 29.1429 1231.55 32.4583 29.1829 1251.47 33.3542 29.2227 1271.72 34.2203 29.2624 1292.29 35.0641 29.3022 1313.19 35.8931 29.3423 1334.43 36.7142 29.3824 1356.01 37.5335 29.4221 1377.94 38.3587 29.4624 1400.23 39.1997 29.5027 1422.88 40.0705 29.5429 1445.89 41.0000 29.5832 1469.28 42.0467 29.5578 1493.04 43.2259 29.4322 1517.19 44.2904 28.8901 1541.73 45.1410 28.3009 1566.67 45.8092 27.7236 1592.01 46.3196 27.1582 1617.76 46.5234 26.8739 1643.92 47.1862 27.1221 1670.51 48.1538 26.6954 1697.53 48.9244 26.1554 1724.99 49.5444 25.6264 1752.89 50.1026 25.0944 1781.24 50.6061 24.5687 1810.05 51.0648 24.0502 1839.32 51.4851 23.5429 1869.07 51.8739 23.0464 1899.30 52.2351 22.5603 1930.02 52.5718 22.0844 1961.24 52.8862 21.6187 1992.96 53.1777 21.1629 2025.20 53.4649 20.7267 2057.95 53.7374 20.2788 2091.24 53.9859 19.8383 2125.06 54.2171 19.4056 2159.43 54.4321 18.9804 2194.36 54.6325 18.5634 2229.85 54.8190 18.1537 2265.92 54.9924 17.7520 2302.57 55.1538 17.3576 2339.81 55.3033 16.9707 2377.66 55.4419 16.5915 2416.11 55.5701 16.2196 2455.19 55.6887 15.8552 2494.90 55.7976 15.4973 2535.26 55.8975 15.1473 2576.26 55.9892 14.8043 2617.93 56.0730 14.4680 2660.27 56.1490 14.1383 2703.30 56.2172 13.8154 2747.03 56.2784 13.4997 2791.46 56.3333 13.1904 2836.61 56.3814 12.8873 2882.49 56.4238 12.5913 2929.11 56.4606 12.3008 2976.48 56.4911 12.0163 3024.63 56.5162 11.7387 3073.55 56.5365 11.4666 3123.26 56.5516 11.2001 3173.78 56.5617 10.9398 3225.11 56.5673 10.6851 3277.27 56.5684 10.4359 3330.28 56.5650 10.1922 3384.15 56.5575 9.95373 3438.88 56.5457 9.72056 3494.50 56.5299 9.49256 3551.02 56.5101 9.26961 3608.46 56.4864 9.05160 3666.82 56.4589 8.83845 3726.13 56.4274 8.63000 3786.40 56.3922 8.42630 3847.64 56.3532 8.22715 3909.87 56.3103 8.03236 3973.11 56.2635 7.84205 4037.38 56.2128 7.65602 4102.68 56.1582 7.47420 4169.03 56.0994 7.29641 4236.46 56.0364 7.12277 4304.98 55.9690 6.95294 4374.62 55.8969 6.78696 4445.37 55.8200 6.62483 4517.27 55.7380 6.46631 4590.33 55.6505 6.31138 4664.58 55.5572 6.16008 4740.03 55.4575 6.01213 4816.69 55.3509 5.86756 4894.60 55.2367 5.72638 4973.77 55.1141 5.58828 5054.21 54.9821 5.45343 5135.96 54.8396 5.32159 5219.03 54.6851 5.19278 5303.44 54.5167 5.06681 5389.22 54.3322 4.94382 5476.39 54.1287 4.82361 5564.97 53.9024 4.70617 5654.98 53.6483 4.59137 5746.44 53.3593 4.47929 5839.39 53.0254 4.36970 5933.83 52.6315 4.26247 6029.81 52.1527 4.15778 6127.33 51.5453 4.05558 6226.44 50.7172 3.95562 6327.15 49.4124 3.85796 6429.48 46.0453 3.76244 6459.20 33.1901 3.73542 6459.40 33.1911 10.8415 6533.48 48.1440 10.6158 6639.15 49.9780 10.3062 6746.54 50.6958 10.0055 6855.65 50.7949 9.71357 6966.54 49.7355 9.43029 7012.70 41.0760 9.31608 7012.90 41.0789 13.9235 7079.22 51.0072 13.5142 7193.72 52.7798 12.8441 7310.07 53.4313 12.2070 7427.80 49.6437 11.6041 7428. 49.6436 13.5704 7428.31 50.5195 13.5694 7548.45 54.5514 13.2272 7670.54 55.4394 12.8932 7794.61 56.0965 12.5669 7920.68 56.6337 12.2479 8048.79 57.0905 11.9359 8178.98 57.4874 11.6311 8311.26 57.8369 11.3333 8445.69 58.1473 11.0425 8582.29 58.4247 10.7585 8721.11 58.6738 10.4811 8862.16 58.8980 10.2103 9005.50 59.1000 9.94601 9151.16 59.2818 9.68785 9299.17 59.4449 9.43598 9449.58 59.5893 9.19003 9602.42 59.7129 8.95034 9757.73 59.7927 8.71623 9915.55 59.9187 8.59018 10075.9 60.1180 8.36483 10238.9 60.2096 8.14506 10404.5 60.3070 7.93073 10572.8 60.3951 7.72172 10743.8 60.4746 7.51793 10917.6 60.5461 7.31925 11094.2 60.6104 7.12556 11273.6 60.6682 6.93675 11455.9 60.7199 6.75273 11641.2 60.7661 6.57337 11829.5 60.8071 6.39857 12020.8 60.8434 6.22823 12215.3 60.8753 6.06225 12412.8 60.9031 5.90053 12613.6 60.9271 5.74296 12817.6 60.9476 5.58946 13025.0 60.9648 5.43992 13235.6 60.9790 5.29425 13449.7 60.9903 5.15237 13667.2 60.9989 5.01416 13888.3 61.0051 4.87956 14112.9 61.0090 4.74847 14341.2 61.0108 4.62080 14573.1 61.0105 4.49647 14808.9 61.0084 4.37541 15048.4 61.0046 4.25752 15291.8 60.9991 4.14273 15539.1 60.9921 4.03096 15790.4 60.9838 3.92214 16045.8 60.9741 3.81619 16305.4 60.9632 3.71304 16569.1 60.9512 3.61262 16837.1 60.9381 3.51486 17109.4 60.9240 3.41969 17386.1 60.9090 3.32705 17667.4 60.8932 3.23686 17953.1 60.8765 3.14907 18243.5 60.8592 3.06362 18538.6 60.8411 2.98044 18838.4 60.8224 2.89947 19143.1 60.8031 2.82066 19452.7 60.7832 2.74395 19767.4 60.7629 2.66929 20087.1 60.7420 2.59662 20412.0 60.7206 2.52589 20742.1 60.6989 2.45704 21077.6 60.6767 2.39004 21418.5 60.6541 2.32482 21765.0 60.6312 2.26135 22117.0 60.6079 2.19957 22474.7 60.5842 2.13945 22838.2 60.5602 2.08093 23207.6 60.5359 2.02397 23583.0 60.5113 1.96854 23964.4 60.4863 1.91458 24352.0 60.4611 1.86207 24745.9 60.4355 1.81096 25146.2 60.4095 1.76122 25552.9 60.3832 1.71281 25966.2 60.3566 1.66568 26386.1 60.3296 1.61982 26812.9 60.3022 1.57518 27246.6 60.2743 1.53173 27687.3 60.2460 1.48943 28135.1 60.2173 1.44827 28590.2 60.1879 1.40820 29052.6 60.1580 1.36919 29522.5 60.1275 1.33123 30000.0 60.0962 1.29427 periodictable-1.5.0/periodictable/xsf/po.nff000066400000000000000000000321371310514471200210460ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 4.92763 10.1617 -9999. 4.95784 10.3261 -9999. 4.98823 10.4931 -9999. 5.01881 10.6628 -9999. 5.04957 10.8353 -9999. 5.10634 11.0106 -9999. 5.17368 11.1886 -9999. 5.24191 11.3696 -9999. 5.31104 11.5535 -9999. 5.38108 11.7404 -9999. 5.41889 11.9303 -9999. 5.44883 12.1232 -9999. 5.47894 12.3193 -9999. 5.50922 12.5186 -9999. 5.53966 12.7210 -9999. 5.52245 12.9268 -9999. 5.48902 13.1359 -9999. 5.45580 13.3483 -9999. 5.42278 13.5642 -9999. 5.38984 13.7836 -9999. 5.35112 14.0066 -9999. 5.31267 14.2331 -9999. 5.27449 14.4633 -9999. 5.23660 14.6973 -9999. 5.19897 14.9350 -9999. 5.17213 15.1765 -9999. 5.14602 15.4220 -9999. 5.12004 15.6714 -9999. 5.09419 15.9249 -9999. 5.06848 16.1825 -9999. 5.04289 16.4442 -9999. 5.01793 16.7102 -9999. 4.99641 16.9805 -9999. 4.97498 17.2551 -9999. 4.95363 17.5342 -9999. 4.93239 17.8178 -9999. 4.84446 18.1060 -9999. 4.71919 18.3989 -9999. 4.59717 18.6964 -9999. 4.47829 18.9988 -9999. 4.36091 19.3061 -9999. 4.24339 19.6184 -9999. 4.12903 19.9357 -9999. 4.01776 20.2582 -9999. 3.90948 20.5858 -9999. 3.78132 20.9188 -9999. 3.65318 21.2571 -9999. 3.52938 21.6009 -9999. 3.39749 21.9503 -9999. 3.18359 22.3053 -9999. 2.98315 22.6661 -9999. 2.79534 23.0327 -9999. 2.63800 23.4053 -9999. 2.50103 23.7838 -9999. 2.37117 24.1685 -9999. 2.24361 24.5594 -9999. 2.11749 24.9566 -9999. 1.99846 25.3603 -9999. 1.89902 25.7705 -9999. 1.81138 26.1873 -9999. 1.72779 26.6109 -9999. 1.71417 27.0413 -9999. 1.71027 27.4786 -9999. 1.69468 27.9231 -9999. 1.66248 28.3747 -9999. 1.65659 28.8337 -9999. 1.69668 29.3000 -0.327474 1.73976 29.7739 -0.805751 1.80621 30.2555 -1.43387 1.87520 30.7449 -2.38848 2.31378 31.2421 -3.05800 3.36804 31.7475 -2.95232 4.85098 32.2609 -2.42557 5.18313 32.7827 -2.15657 5.50492 33.3130 -1.99161 5.81193 33.8518 -1.77401 6.13534 34.3993 -1.56068 6.24756 34.9557 -1.42888 6.36182 35.5211 -1.31019 6.44993 36.0956 -1.26070 6.48306 36.6794 -1.27061 6.51636 37.2727 -1.32712 6.54968 37.8755 -1.43392 6.58315 38.4882 -1.61752 6.61680 39.1107 -1.85359 6.76708 39.7432 -2.06699 6.93913 40.3861 -2.29738 7.11555 41.0393 -2.59566 7.34485 41.7031 -2.86185 7.64536 42.3776 -3.13525 7.95816 43.0630 -3.46763 8.28449 43.7595 -3.79179 8.80056 44.4673 -4.04438 9.34878 45.1865 -4.25659 9.93114 45.9174 -4.43704 10.5573 46.6600 -4.56956 11.2294 47.4147 -4.64949 11.9442 48.1816 -4.65522 12.7045 48.9609 -4.52965 13.5132 49.7528 -4.34402 14.1494 50.5576 -4.19653 14.8000 51.3753 -4.03750 15.4805 52.2062 -3.84489 16.1923 53.0506 -3.59161 16.9368 53.9087 -3.22109 17.7156 54.7806 -2.81138 18.3309 55.6667 -2.42303 18.9672 56.5670 -2.00624 19.6255 57.4820 -1.52233 20.3068 58.4117 -0.879052 20.9032 59.3564 -0.325593 21.3700 60.3165 0.196990 21.8473 61.2921 0.718284 22.3352 62.2834 1.25234 22.8340 63.2908 1.80921 23.3439 64.3145 2.39899 23.8653 65.3547 3.03383 24.3982 66.4118 3.73253 24.9431 67.4859 4.53599 25.5002 68.5775 5.58237 25.9171 69.6867 6.47825 26.0704 70.8138 7.28794 26.2245 71.9591 8.06114 26.3795 73.1230 8.82059 26.5355 74.3057 9.57830 26.6924 75.5076 10.3441 26.8501 76.7289 11.1279 27.0089 77.9699 11.9438 27.1686 79.2310 12.8232 27.3292 80.5125 13.8009 27.3829 81.8147 14.7083 27.3444 83.1380 15.5997 27.3059 84.4827 16.5087 27.2675 85.8491 17.4657 27.2291 87.2377 18.5275 27.1908 88.6487 19.8967 27.0619 90.0825 21.0884 26.2733 91.5395 21.9944 25.5076 93.0201 22.6838 24.7826 94.5246 23.3378 24.1931 96.0535 24.0121 23.6176 97.6071 24.7595 23.0557 99.1858 25.6429 22.1924 100.790 26.1814 21.1428 102.420 26.4173 20.1430 104.077 26.5325 19.4083 105.760 26.7127 18.7638 107.471 26.9059 18.1408 109.209 27.1002 17.5384 110.975 27.3057 16.9561 112.770 27.5824 16.3930 114.594 27.8933 15.6178 116.448 27.9881 14.7636 118.331 27.9509 13.9562 120.245 27.8092 13.1928 122.190 27.5257 12.4713 124.166 27.1079 12.0324 126.175 26.8467 11.7436 128.215 26.6900 11.4618 130.289 26.5711 11.1867 132.397 26.4807 10.9182 134.538 26.4151 10.6562 136.714 26.3753 10.4005 138.925 26.3711 10.1509 141.172 26.4587 9.90726 143.456 26.6053 9.46653 145.776 26.5873 8.93611 148.134 26.4798 8.43540 150.530 26.3180 7.96273 152.964 26.1150 7.51656 155.439 25.8761 7.09539 157.953 25.5938 6.70403 160.507 25.3046 6.37063 163.103 25.0110 6.05380 165.742 24.7073 5.75274 168.422 24.3887 5.46663 171.146 24.0517 5.19477 173.915 23.6892 4.93642 176.727 23.2560 4.69093 179.586 22.8275 4.58996 182.491 22.4577 4.50514 185.442 22.1118 4.42190 188.442 21.7855 4.33665 191.489 21.4508 4.23282 194.587 21.0987 4.13148 197.734 20.7266 4.03256 200.932 20.3288 3.94910 204.182 19.9121 3.87586 207.485 19.4357 3.83258 210.840 18.9677 3.84129 214.251 18.4789 3.88100 217.716 18.0052 3.95929 221.237 17.5250 4.03917 224.816 16.9986 4.15828 228.452 16.4894 4.33461 232.147 15.9546 4.51842 235.902 15.4208 4.81145 239.717 14.9168 5.13299 243.595 14.4371 5.48218 247.535 13.9687 5.85511 251.538 13.4978 6.25343 255.607 13.0316 6.70406 259.741 12.5866 7.19681 263.942 12.1604 7.72577 268.211 11.7503 8.29361 272.549 11.3548 8.90874 276.957 10.9943 9.58276 281.437 10.6797 10.3078 285.989 10.4559 11.0877 290.615 10.2855 11.8188 295.315 10.1199 12.5736 300.092 9.99330 13.3766 304.945 9.98481 14.2309 309.878 10.0378 14.9726 314.890 10.0615 15.7051 319.983 10.0997 16.4735 325.158 10.1972 17.2794 330.418 10.4086 18.0490 335.762 10.5784 18.7253 341.192 10.7303 19.4270 346.711 10.8932 20.1550 352.319 11.0837 20.9103 358.017 11.3585 21.6939 363.808 11.6586 22.3856 369.692 11.9331 23.0797 375.672 12.2118 23.7953 381.748 12.5081 24.5331 387.922 12.8319 25.2937 394.197 13.1919 26.0780 400.573 13.5993 26.8865 407.052 14.1289 27.7121 413.635 14.6723 28.4175 420.326 15.1989 29.1408 427.124 15.7502 29.8825 434.032 16.3413 30.6431 441.052 16.9892 31.4231 448.186 17.7201 32.2229 455.435 18.6394 32.9905 462.802 19.5263 33.5574 470.287 20.3925 34.1340 477.894 21.2885 34.7205 485.623 22.2494 35.3171 493.478 23.4623 35.8233 501.459 24.5879 36.0698 509.570 25.6047 36.3181 517.812 26.6263 36.5681 526.187 27.8029 36.8198 534.698 28.9439 36.7701 543.346 29.9487 36.6969 552.134 30.9003 36.6238 561.065 31.8344 36.5509 570.139 32.7962 36.4781 579.361 33.8521 36.2570 588.732 34.7681 35.8649 598.254 35.5303 35.4769 607.930 36.2207 35.0932 617.763 36.8617 34.7002 627.755 37.4200 34.2844 637.908 37.8729 33.8737 648.226 38.1981 33.5221 658.711 38.5267 33.2940 669.365 38.8480 33.0786 680.191 39.1292 32.8968 691.193 39.3636 32.7478 702.372 39.4881 32.6614 713.733 39.5770 32.8294 725.277 39.8730 33.1766 737.008 40.3270 33.5274 748.928 40.9084 33.8819 761.042 41.6486 34.2312 773.351 42.6107 34.4875 785.859 43.7001 34.4328 798.570 44.5834 34.1208 811.486 45.3299 33.8119 824.611 46.0085 33.5057 837.949 46.6466 33.2022 851.502 47.2551 32.8852 865.274 47.8317 32.5504 879.269 48.3569 32.2006 893.491 48.8358 31.8547 907.943 49.2663 31.5123 922.628 49.6009 31.1735 937.551 49.9270 31.0086 952.715 50.2952 30.8906 968.124 50.7455 30.8134 983.783 51.2693 30.7363 999.695 51.8785 30.6289 1015.86 52.6224 30.4894 1032.29 53.3038 30.0388 1048.99 53.8761 29.5846 1065.96 54.3682 29.1290 1083.20 54.8130 28.6797 1100.72 55.2218 28.2371 1118.52 55.6010 27.8010 1136.61 55.9547 27.3710 1155. 56.2860 26.9475 1173.68 56.5974 26.5303 1192.66 56.8904 26.1191 1211.95 57.1670 25.7138 1231.55 57.4281 25.3143 1251.47 57.6742 24.9202 1271.72 57.9065 24.5319 1292.29 58.1258 24.1495 1313.19 58.3330 23.7726 1334.43 58.5289 23.4011 1356.01 58.7137 23.0347 1377.94 58.8879 22.6736 1400.23 59.0524 22.3178 1422.88 59.2084 21.9672 1445.89 59.3573 21.6213 1469.28 59.5020 21.2770 1493.04 59.6434 20.9325 1517.19 59.7692 20.5721 1541.73 59.8751 20.2146 1566.67 59.9635 19.8626 1592.01 60.0377 19.5159 1617.76 60.0984 19.1751 1643.92 60.1471 18.8402 1670.51 60.1840 18.5102 1697.53 60.2093 18.1855 1724.99 60.2303 17.8660 1752.89 60.2379 17.5376 1781.24 60.2257 17.2103 1810.05 60.1944 16.8856 1839.32 60.1435 16.5660 1869.07 60.0744 16.2521 1899.30 59.9869 15.9440 1930.02 59.8809 15.6417 1961.24 59.7556 15.3446 1992.96 59.6066 15.0522 2025.20 59.4467 14.7741 2057.95 59.2648 14.4832 2091.24 59.0486 14.1946 2125.06 58.8002 13.9102 2159.43 58.5156 13.6284 2194.36 58.1909 13.3511 2229.85 57.8201 13.0765 2265.92 57.3956 12.8056 2302.57 56.9078 12.5382 2339.81 56.3440 12.2743 2377.66 55.6866 12.0140 2416.11 54.9108 11.7570 2455.19 53.9795 11.5034 2494.90 52.8351 11.2535 2535.26 51.3782 11.0069 2576.26 49.4135 10.7638 2617.93 46.4589 10.5242 2660.27 40.4245 10.2882 2682.90 11.5045 10.1658 2683.10 11.5085 26.8291 2703.30 39.2086 26.5271 2747.03 43.5900 25.8925 2791.46 39.4607 25.2737 2797.90 24.7540 25.1860 2798.10 24.7677 36.5361 2836.61 48.2036 35.7868 2882.49 52.6811 34.9267 2929.11 55.5306 34.0870 2976.48 57.6344 33.2690 3024.63 59.2715 32.4710 3073.55 60.5651 31.6942 3123.26 61.5688 30.9367 3173.78 62.2817 30.1984 3225.11 62.6053 29.4775 3277.27 61.9786 28.7754 3301.80 54.6179 28.4548 3302. 54.6305 33.0509 3330.28 63.0588 32.6336 3384.15 65.3936 31.8630 3438.88 66.8185 31.1118 3494.50 67.9090 30.3785 3551.02 68.7983 29.6648 3608.46 69.5384 28.9684 3666.82 70.1482 28.2890 3726.13 70.6219 27.6263 3786.40 70.8995 26.9810 3847.64 70.2648 26.3516 3854. 68.2326 26.2876 3854.20 68.2397 27.8834 3909.87 71.8501 27.2931 3973.11 72.6400 26.6474 4037.38 73.1707 26.0168 4102.68 74.1366 25.4011 4149.30 72.2509 24.9761 4149.50 72.2586 26.0075 4169.03 73.6831 25.8385 4236.46 74.5992 25.2697 4304.98 75.2045 24.7094 4374.62 75.7079 24.1576 4445.37 76.1492 23.6172 4517.27 76.5459 23.0865 4590.33 76.9068 22.5654 4664.58 77.2366 22.0529 4740.03 77.5381 21.5497 4816.69 77.8151 21.0566 4894.60 78.0704 20.5730 4973.77 78.3056 20.0985 5054.21 78.5221 19.6335 5135.96 78.7215 19.1776 5219.03 78.9051 18.7307 5303.44 79.0737 18.2927 5389.22 79.2283 17.8637 5476.39 79.3700 17.4435 5564.97 79.4994 17.0320 5654.98 79.6172 16.6290 5746.44 79.7242 16.2346 5839.39 79.8208 15.8486 5933.83 79.9079 15.4709 6029.81 79.9859 15.1013 6127.33 80.0551 14.7396 6226.44 80.1160 14.3858 6327.15 80.1693 14.0401 6429.48 80.2153 13.7017 6533.48 80.2540 13.3709 6639.15 80.2861 13.0476 6746.54 80.3117 12.7316 6855.65 80.3314 12.4229 6966.54 80.3454 12.1211 7079.22 80.3537 11.8259 7193.72 80.3567 11.5380 7310.07 80.3548 11.2564 7428.31 80.3478 10.9814 7548.45 80.3360 10.7130 7670.54 80.3201 10.4509 7794.61 80.2997 10.1948 7920.68 80.2750 9.94471 8048.79 80.2462 9.70051 8178.98 80.2133 9.46218 8311.26 80.1766 9.22946 8445.69 80.1360 9.00226 8582.29 80.0916 8.78071 8721.11 80.0435 8.56415 8862.16 79.9916 8.35312 9005.50 79.9361 8.14686 9151.16 79.8767 7.94577 9299.17 79.8139 7.74959 9449.58 79.7475 7.55800 9602.42 79.6775 7.37103 9757.73 79.6040 7.18894 9915.55 79.5339 7.01103 10075.9 79.4592 6.82141 10238.9 79.3650 6.63738 10404.5 79.2631 6.45881 10572.8 79.1523 6.28558 10743.8 79.0327 6.11759 10917.6 78.9037 5.95472 11094.2 78.7646 5.79685 11273.6 78.6143 5.64388 11455.9 78.4514 5.49569 11641.2 78.2740 5.35217 11829.5 78.0796 5.21320 12020.8 77.8646 5.07869 12215.3 77.6243 4.94851 12412.8 77.3516 4.82258 12613.6 77.0362 4.70077 12817.6 76.6614 4.58300 13025.0 76.1980 4.46915 13235.6 75.5884 4.35912 13449.7 74.6896 4.25282 13667.2 72.9266 4.15014 13813.7 58.4901 4.08331 13813.9 58.4906 10.3379 13888.3 71.7171 10.2428 14112.9 74.5226 9.96377 14341.2 75.6213 9.69240 14573.1 76.2694 9.42841 14808.9 76.6856 9.17163 15048.4 76.9440 8.92183 15291.8 77.0699 8.67885 15539.1 77.0567 8.44250 15790.4 76.8501 8.21257 16045.8 76.2243 7.98892 16244.2 68.9899 7.82179 16244.4 68.9907 10.9274 16305.4 75.1850 10.8688 16569.1 76.8432 10.6218 16837.1 77.1094 10.3803 16939.2 74.4097 10.2908 16939.4 74.4102 11.6210 17109.4 77.9036 11.4616 17386.1 78.7621 11.2101 17667.4 79.3429 10.9617 17953.1 79.8037 10.7164 18243.5 80.1906 10.4745 18538.6 80.5249 10.2360 18838.4 80.8191 10.0009 19143.1 81.0811 9.76948 19452.7 81.3161 9.54166 19767.4 81.5284 9.31752 20087.1 81.7209 9.09713 20412.0 81.8961 8.88050 20742.1 82.0559 8.66767 21077.6 82.2019 8.45865 21418.5 82.3354 8.25346 21765.0 82.4576 8.05211 22117.0 82.5694 7.85460 22474.7 82.6718 7.66092 22838.2 82.7655 7.47105 23207.6 82.8511 7.28499 23583.0 82.9293 7.10271 23964.4 83.0006 6.92419 24352.0 83.0654 6.74939 24745.9 83.1243 6.57830 25146.2 83.1776 6.41087 25552.9 83.2258 6.24708 25966.2 83.2691 6.08687 26386.1 83.3078 5.93021 26812.9 83.3423 5.77705 27246.6 83.3728 5.62735 27687.3 83.3997 5.48107 28135.1 83.4230 5.33814 28590.2 83.4430 5.19853 29052.6 83.4600 5.06218 29522.5 83.4742 4.92904 30000.0 83.4856 4.79906 periodictable-1.5.0/periodictable/xsf/pr.nff000066400000000000000000000316071310514471200210520ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.26325 10.1617 -9999. 1.25455 10.3261 -9999. 1.24591 10.4931 -9999. 1.23732 10.6628 -9999. 1.22879 10.8353 -9999. 1.22033 11.0106 -9999. 1.21192 11.1886 -9999. 1.20357 11.3696 -9999. 1.19528 11.5535 -9999. 1.18704 11.7404 -9999. 1.17886 11.9303 -9999. 1.17022 12.1232 -9999. 1.16019 12.3193 -9999. 1.15025 12.5186 -9999. 1.14040 12.7210 -9999. 1.13063 12.9268 -9999. 1.12094 13.1359 -9999. 1.10453 13.3483 -9999. 1.08708 13.5642 -9999. 1.06991 13.7836 -9999. 1.05301 14.0066 -9999. 1.01549 14.2331 -9999. 0.995923 14.4633 -9999. 0.976736 14.6973 -9999. 0.957920 14.9350 -9999. 0.934994 15.1765 -9999. 0.910276 15.4220 -9999. 0.886214 15.6714 -9999. 0.862786 15.9249 -9999. 0.839978 16.1825 -9999. 0.817772 16.4442 -9999. 0.797256 16.7102 -9999. 0.778139 16.9805 -9999. 0.759481 17.2551 -9999. 0.741270 17.5342 -9999. 0.723495 17.8178 -9999. 0.706146 18.1060 -9999. 0.689214 18.3989 -9999. 0.672688 18.6964 -9999. 0.659987 18.9988 -9999. 0.648801 19.3061 -9999. 0.638260 19.6184 -9999. 0.650404 19.9357 -9999. 0.679953 20.2582 -9999. 0.797032 20.5858 -9999. 1.13127 20.9188 -9999. 1.44463 21.2571 -9999. 1.68469 21.6009 -9999. 1.79339 21.9503 -9999. 1.78379 22.3053 -9999. 1.78873 22.6661 -9999. 1.85314 23.0327 -9999. 2.02518 23.4053 -9999. 2.32098 23.7838 -9999. 2.81683 24.1685 -9999. 4.27386 24.5594 -9999. 12.2025 24.9566 -9999. 14.1414 25.3603 -9999. 15.0203 25.7705 -9999. 15.3932 26.1873 -9999. 15.7493 26.6109 -9999. 15.9969 27.0413 -9999. 16.0100 27.4786 -9999. 15.9703 27.9231 -9999. 15.9306 28.3747 -9999. 15.8911 28.8337 -9999. 15.8517 29.3000 9.51277 15.3555 29.7739 10.3093 14.8658 30.2555 10.9704 14.3917 30.7449 11.5511 13.9328 31.2421 12.0779 13.4885 31.7475 12.5508 13.0114 32.2609 12.9459 12.5426 32.7827 13.2853 12.0908 33.3130 13.5794 11.6552 33.8518 13.8347 11.2353 34.3993 14.0561 10.8306 34.9557 14.2474 10.4404 35.5211 14.4118 10.0643 36.0956 14.5519 9.70173 36.6794 14.6700 9.35222 37.2727 14.7679 9.01531 37.8755 14.8471 8.69053 38.4882 14.9089 8.37745 39.1107 14.9543 8.07567 39.7432 14.9832 7.78473 40.3861 14.9936 7.50429 41.0393 14.9888 7.24826 41.7031 14.9824 7.00541 42.3776 14.9695 6.77070 43.0630 14.9489 6.54385 43.7595 14.9199 6.32461 44.4673 14.8824 6.11270 45.1865 14.8357 5.90790 45.9174 14.7792 5.70996 46.6600 14.7091 5.51866 47.4147 14.6155 5.34218 48.1816 14.5285 5.19977 48.9609 14.4491 5.06116 49.7528 14.3693 4.92623 50.5576 14.2867 4.79491 51.3753 14.1995 4.66709 52.2062 14.1061 4.54267 53.0506 14.0027 4.42158 53.9087 13.8793 4.30371 54.7806 13.7492 4.23031 55.6667 13.6381 4.16580 56.5670 13.5340 4.10227 57.4820 13.4323 4.03971 58.4117 13.3311 3.97811 59.3564 13.2293 3.91744 60.3165 13.1274 3.85770 61.2921 13.0239 3.79195 62.2834 12.9105 3.72467 63.2908 12.7880 3.65860 64.3145 12.6550 3.59369 65.3547 12.5050 3.52994 66.4118 12.3473 3.49273 67.4859 12.1947 3.45927 68.5775 12.0398 3.42614 69.6867 11.8792 3.39332 70.8138 11.7099 3.36082 71.9591 11.5263 3.32862 73.1230 11.3266 3.31436 74.3057 11.1320 3.31088 75.5076 10.9348 3.30740 76.7289 10.7312 3.30392 77.9699 10.5189 3.30045 79.2310 10.2965 3.29698 80.5125 10.0629 3.29351 81.8147 9.81941 3.29005 83.1380 9.56546 3.27223 84.4827 9.27794 3.24426 85.8491 8.95921 3.21654 87.2377 8.60781 3.18905 88.6487 8.21876 3.16179 90.0825 7.77969 3.14031 91.5395 7.30552 3.13585 93.0201 6.78959 3.13139 94.5246 6.21876 3.12694 96.0535 5.58112 3.12250 97.6071 4.86185 3.11807 99.1858 4.04143 3.11364 100.790 3.09272 3.10921 102.420 1.97565 3.10480 104.077 0.621654 3.10039 105.760 -1.12214 3.10472 107.471 -3.66291 3.21631 109.209 -7.18093 7.64026 110.975 -6.23020 7.41665 112.770 -9.00006 7.09828 114.594 -12.6272 8.41926 116.448 -16.9216 10.0512 118.331 -23.5851 12.1216 120.245 -39.2241 21.9328 122.190 -51.7708 44.1119 124.166 -19.7356 77.7003 126.175 8.11330 77.7355 128.215 23.7668 67.1861 130.289 30.1202 56.6110 132.397 33.3569 50.3933 134.538 35.4313 44.8583 136.714 36.7197 40.7266 138.925 37.8197 37.1906 141.172 38.6968 33.9618 143.456 39.2228 31.0132 145.776 39.5635 28.5342 148.134 39.8373 26.2695 150.530 40.0722 24.1845 152.964 40.4028 22.2456 155.439 40.4547 19.8981 157.953 40.1564 17.7984 160.507 39.5523 15.9420 163.103 38.9137 14.4725 165.742 38.2985 13.1384 168.422 37.6418 11.9310 171.146 36.9960 10.9058 173.915 36.3736 9.96875 176.727 35.8086 9.11221 179.586 35.2097 8.14682 182.491 34.3256 7.36251 185.442 33.5005 6.81011 188.442 32.7879 6.43012 191.489 32.1674 6.08629 194.587 31.6025 5.72861 197.734 31.0204 5.37495 200.932 30.3668 5.04311 204.182 29.6587 4.88899 207.485 29.0851 4.85298 210.840 28.5802 4.81723 214.251 28.0751 4.78175 217.716 27.5909 4.84427 221.237 27.1879 4.94149 224.816 26.8333 5.04071 228.452 26.5173 5.15228 232.147 26.2347 5.26633 235.902 25.9799 5.38289 239.717 25.7482 5.50204 243.595 25.5369 5.62382 247.535 25.3436 5.74830 251.538 25.1664 5.87554 255.607 25.0036 6.00559 259.741 24.8536 6.13852 263.942 24.7146 6.27439 268.211 24.5811 6.41774 272.549 24.4632 6.57150 276.957 24.3599 6.72895 281.437 24.2674 6.89017 285.989 24.1832 7.05524 290.615 24.0969 7.22463 295.315 24.0291 7.43554 300.092 23.9895 7.65262 304.945 23.9770 7.87602 309.878 23.9919 8.10594 314.890 24.0547 8.34259 319.983 24.1511 8.53385 325.158 24.2394 8.70421 330.418 24.3346 8.87796 335.762 24.4505 9.05520 341.192 24.6205 9.23597 346.711 24.7899 9.31083 352.319 24.9317 9.38263 358.017 25.0564 9.45497 363.808 25.1773 9.52788 369.692 25.2981 9.60133 375.672 25.4225 9.67537 381.748 25.5680 9.74044 387.922 25.7027 9.78223 394.197 25.8262 9.82419 400.573 25.9484 9.86634 407.052 26.0719 9.90866 413.635 26.1994 9.95117 420.326 26.3361 9.99386 427.124 26.5026 10.0367 434.032 26.6592 10.0091 441.052 26.7916 9.98048 448.186 26.9064 9.95198 455.435 27.0116 9.92355 462.802 27.1092 9.89521 470.287 27.2004 9.86695 477.894 27.2860 9.83877 485.623 27.3667 9.81067 493.478 27.4433 9.78264 501.459 27.5159 9.75447 509.570 27.5852 9.72639 517.812 27.6517 9.69838 526.187 27.7161 9.67045 534.698 27.7797 9.64262 543.346 27.8442 9.61485 552.134 27.9122 9.58717 561.065 28.0026 9.55957 570.139 28.1207 9.48629 579.361 28.1888 9.35343 588.732 28.2168 9.22244 598.254 28.2184 9.09328 607.930 28.1973 8.96593 617.763 28.1544 8.84036 627.755 28.0865 8.71655 637.908 27.9998 8.60905 648.226 27.9011 8.50652 658.711 27.7892 8.40522 669.365 27.6606 8.30512 680.191 27.5142 8.20622 691.193 27.3492 8.10849 702.372 27.1659 8.01193 713.733 26.9730 7.91652 725.277 26.7546 7.78071 737.008 26.4807 7.63111 748.928 26.1473 7.48439 761.042 25.7588 7.34049 773.351 25.3091 7.19935 785.859 24.7893 7.06093 798.570 24.1867 6.92517 811.486 23.4837 6.79202 824.611 22.6556 6.66143 837.949 21.6648 6.53335 851.502 20.4572 6.41502 865.274 18.9522 6.30445 879.269 16.9924 6.19579 893.491 14.2483 6.08900 907.943 9.84705 5.98405 922.628 -0.721609 5.88091 928.700 -37.3246 5.83926 928.900 -37.3125 33.9113 937.551 2.83807 33.7762 952.715 12.1674 33.5436 968.124 16.9393 33.3126 983.783 20.2583 33.0832 999.695 22.8595 32.8554 1015.86 25.0416 32.6291 1032.29 26.9661 32.4044 1048.99 28.7601 32.1812 1065.96 30.5668 31.7713 1083.20 32.0995 31.0986 1100.72 33.3236 30.4402 1118.52 34.3850 29.7956 1136.61 35.3086 29.1647 1155. 36.1117 28.5472 1173.68 36.8039 27.9427 1192.66 37.3873 27.3511 1211.95 37.8531 26.7721 1231.55 38.1461 26.2053 1251.47 38.2810 25.8316 1271.72 38.3271 25.6620 1292.29 38.5379 25.7403 1313.19 38.8755 25.8189 1334.43 39.2785 25.8977 1356.01 39.7286 25.9765 1377.94 40.2186 26.0556 1400.23 40.7467 26.1350 1422.88 41.3163 26.2148 1445.89 41.9399 26.2946 1469.28 42.6417 26.3156 1493.04 43.2456 26.2462 1517.19 44.0383 26.4812 1541.73 45.1981 26.4663 1566.67 46.1732 25.9204 1592.01 46.9180 25.3856 1617.76 47.5561 24.8619 1643.92 48.1225 24.3488 1670.51 48.6352 23.8466 1697.53 49.1048 23.3547 1724.99 49.5469 22.8728 1752.89 49.9568 22.3852 1781.24 50.3315 21.9028 1810.05 50.6753 21.4268 1839.32 50.9907 20.9609 1869.07 51.2825 20.5051 1899.30 51.5533 20.0595 1930.02 51.8053 19.6236 1961.24 52.0402 19.1971 1992.96 52.2566 18.7796 2025.20 52.4693 18.3800 2057.95 52.6707 17.9729 2091.24 52.8528 17.5726 2125.06 53.0210 17.1804 2159.43 53.1769 16.7958 2194.36 53.3210 16.4183 2229.85 53.4536 16.0483 2265.92 53.5756 15.6859 2302.57 53.6882 15.3308 2339.81 53.7916 14.9827 2377.66 53.8855 14.6412 2416.11 53.9713 14.3077 2455.19 54.0490 13.9802 2494.90 54.1192 13.6603 2535.26 54.1821 13.3466 2576.26 54.2382 13.0399 2617.93 54.2877 12.7392 2660.27 54.3310 12.4456 2703.30 54.3684 12.1576 2747.03 54.3998 11.8758 2791.46 54.4255 11.6003 2836.61 54.4460 11.3311 2882.49 54.4617 11.0677 2929.11 54.4724 10.8098 2976.48 54.4782 10.5576 3024.63 54.4795 10.3112 3073.55 54.4764 10.0701 3123.26 54.4689 9.83430 3173.78 54.4573 9.60393 3225.11 54.4415 9.37871 3277.27 54.4218 9.15858 3330.28 54.3981 8.94336 3384.15 54.3706 8.73296 3438.88 54.3391 8.52741 3494.50 54.3039 8.32653 3551.02 54.2649 8.13021 3608.46 54.2220 7.93831 3666.82 54.1753 7.75086 3726.13 54.1246 7.56763 3786.40 54.0699 7.38873 3847.64 54.0113 7.21381 3909.87 53.9482 7.04290 3973.11 53.8808 6.87600 4037.38 53.8088 6.71291 4102.68 53.7321 6.55372 4169.03 53.6502 6.39807 4236.46 53.5629 6.24610 4304.98 53.4698 6.09758 4374.62 53.3703 5.95244 4445.37 53.2639 5.81071 4517.27 53.1499 5.67233 4590.33 53.0276 5.53715 4664.58 52.8959 5.40507 4740.03 52.7536 5.27606 4816.69 52.5994 5.15015 4894.60 52.4315 5.02710 4973.77 52.2474 4.90683 5054.21 52.0443 4.78939 5135.96 51.8185 4.67474 5219.03 51.5649 4.56270 5303.44 51.2765 4.45330 5389.22 50.9431 4.34640 5476.39 50.5498 4.24207 5564.97 50.0721 4.14014 5654.98 49.4662 4.04057 5746.44 48.6413 3.94324 5839.39 47.3479 3.84822 5933.83 44.1222 3.75541 5964.20 31.0525 3.72637 5964.40 31.0543 10.9378 6029.81 45.9299 10.7127 6127.33 47.8575 10.3900 6226.44 48.5951 10.0768 6327.15 48.6512 9.77311 6429.48 46.5127 9.47860 6440.30 41.0686 9.44825 6440.50 41.0699 13.1333 6533.48 49.4856 12.8076 6639.15 50.6339 12.4524 6746.54 51.1353 12.1071 6834.70 48.3462 11.8346 6834.90 48.3472 13.3832 6855.65 51.0931 13.3270 6966.54 52.5597 13.0330 7079.22 53.3485 12.7425 7193.72 53.9617 12.4557 7310.07 54.4756 12.1731 7428.31 54.9208 11.8942 7548.45 55.3132 11.6195 7670.54 55.6634 11.3489 7794.61 55.9786 11.0826 7920.68 56.2640 10.8207 8048.79 56.5233 10.5630 8178.98 56.7599 10.3097 8311.26 56.9761 10.0610 8445.69 57.1744 9.81692 8582.29 57.3564 9.57696 8721.11 57.5233 9.34149 8862.16 57.6767 9.11078 9005.50 57.8179 8.88448 9151.16 57.9475 8.66245 9299.17 58.0664 8.44494 9449.58 58.1756 8.23199 9602.42 58.2759 8.02349 9757.73 58.3677 7.81913 9915.55 58.4516 7.61956 10075.9 58.5287 7.42395 10238.9 58.5987 7.23260 10404.5 58.6624 7.04544 10572.8 58.7202 6.86244 10743.8 58.7724 6.68356 10917.6 58.8194 6.50872 11094.2 58.8616 6.33787 11273.6 58.8992 6.17097 11455.9 58.9325 6.00795 11641.2 58.9619 5.84876 11829.5 58.9874 5.69332 12020.8 59.0095 5.54159 12215.3 59.0282 5.39349 12412.8 59.0439 5.24897 12613.6 59.0566 5.10797 12817.6 59.0666 4.97041 13025.0 59.0740 4.83624 13235.6 59.0791 4.70539 13449.7 59.0818 4.57780 13667.2 59.0825 4.45341 13888.3 59.0812 4.33214 14112.9 59.0780 4.21395 14341.2 59.0731 4.09876 14573.1 59.0666 3.98651 14808.9 59.0586 3.87714 15048.4 59.0491 3.77060 15291.8 59.0383 3.66681 15539.1 59.0262 3.56572 15790.4 59.0130 3.46727 16045.8 58.9987 3.37140 16305.4 58.9834 3.27805 16569.1 58.9671 3.18717 16837.1 58.9500 3.09870 17109.4 58.9320 3.01258 17386.1 58.9133 2.92875 17667.4 58.8938 2.84717 17953.1 58.8737 2.76778 18243.5 58.8529 2.69053 18538.6 58.8315 2.61536 18838.4 58.8096 2.54223 19143.1 58.7872 2.47109 19452.7 58.7643 2.40188 19767.4 58.7409 2.33456 20087.1 58.7171 2.26909 20412.0 58.6929 2.20541 20742.1 58.6683 2.14348 21077.6 58.6433 2.08326 21418.5 58.6179 2.02471 21765.0 58.5922 1.96777 22117.0 58.5662 1.91241 22474.7 58.5398 1.85860 22838.2 58.5131 1.80628 23207.6 58.4860 1.75542 23583.0 58.4586 1.70599 23964.4 58.4308 1.65794 24352.0 58.4027 1.61124 24745.9 58.3742 1.56585 25146.2 58.3453 1.52174 25552.9 58.3160 1.47887 25966.2 58.2862 1.43722 26386.1 58.2559 1.39674 26812.9 58.2250 1.35741 27246.6 58.1936 1.31919 27687.3 58.1616 1.28206 28135.1 58.1288 1.24599 28590.2 58.0954 1.21094 29052.6 58.0612 1.17689 29522.5 58.0292 1.14382 30000.0 57.9793 1.11169 periodictable-1.5.0/periodictable/xsf/pt.nff000066400000000000000000000320601310514471200210460ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.24140 10.1617 -9999. 2.28104 10.3261 -9999. 2.32138 10.4931 -9999. 2.36244 10.6628 -9999. 2.40955 10.8353 -9999. 2.45863 11.0106 -9999. 2.50871 11.1886 -9999. 2.55981 11.3696 -9999. 2.61195 11.5535 -9999. 2.66515 11.7404 -9999. 2.73690 11.9303 -9999. 2.81125 12.1232 -9999. 2.88761 12.3193 -9999. 2.96604 12.5186 -9999. 3.04661 12.7210 -9999. 3.12936 12.9268 -9999. 3.21436 13.1359 -9999. 3.30167 13.3483 -9999. 3.40249 13.5642 -9999. 3.50943 13.7836 -9999. 3.61972 14.0066 -9999. 3.73349 14.2331 -9999. 3.85083 14.4633 -9999. 3.97132 14.6973 -9999. 4.09410 14.9350 -9999. 4.22068 15.1765 -9999. 4.35118 15.4220 -9999. 4.48570 15.6714 -9999. 4.62439 15.9249 -9999. 4.76737 16.1825 -9999. 4.92382 16.4442 -9999. 5.11493 16.7102 -9999. 5.31346 16.9805 -9999. 5.51971 17.2551 -9999. 5.73395 17.5342 -9999. 5.95651 17.8178 -9999. 6.18771 18.1060 -9999. 6.42869 18.3989 -9999. 6.67959 18.6964 -9999. 6.94029 18.9988 -9999. 7.21116 19.3061 -9999. 7.49261 19.6184 -9999. 7.78504 19.9357 -9999. 8.10865 20.2582 -9999. 8.44803 20.5858 -9999. 8.80160 20.9188 -9999. 9.16997 21.2571 -9999. 9.55375 21.6009 -9999. 9.82617 21.9503 -9999. 10.0018 22.3053 -9999. 10.1805 22.6661 -9999. 10.3254 23.0327 -9999. 10.2686 23.4053 -9999. 10.2122 23.7838 -9999. 10.1561 24.1685 -9999. 10.0908 24.5594 -9999. 10.0179 24.9566 -9999. 9.94547 25.3603 -9999. 9.87360 25.7705 -9999. 9.80225 26.1873 -9999. 9.75550 26.6109 -9999. 9.77906 27.0413 -9999. 9.80267 27.4786 -9999. 9.82634 27.9231 -9999. 9.85007 28.3747 -9999. 9.87386 28.8337 -9999. 9.90002 29.3000 4.75018 10.0030 29.7739 4.91917 10.1070 30.2555 5.12383 10.2122 30.7449 5.36757 10.3184 31.2421 5.67195 10.4257 31.7475 6.10734 10.4885 32.2609 6.50682 10.2993 32.7827 6.82274 10.1135 33.3130 7.14517 9.85999 33.8518 7.33606 9.54738 34.3993 7.44601 9.24468 34.9557 7.48468 8.95158 35.5211 7.46476 8.73033 36.0956 7.45388 8.53382 36.6794 7.43034 8.34171 37.2727 7.38290 8.15394 37.8755 7.30634 7.97582 38.4882 7.20433 7.80507 39.1107 7.06494 7.63798 39.7432 6.85001 7.47446 40.3861 6.54186 7.45605 41.0393 6.33144 7.51117 41.7031 6.15713 7.56671 42.3776 5.98580 7.62266 43.0630 5.79969 7.67901 43.7595 5.56187 7.77408 44.4673 5.35913 7.94085 45.1865 5.17514 8.11118 45.9174 4.98604 8.28516 46.6600 4.74494 8.46288 47.4147 4.41022 8.79591 48.1816 4.21243 9.24247 48.9609 4.09750 9.71171 49.7528 4.04225 10.2048 50.5576 4.05666 10.7091 51.3753 4.11036 11.2192 52.2062 4.21627 11.7535 53.0506 4.40240 12.3134 53.9087 4.72657 12.8908 54.7806 5.09679 13.2937 55.6667 5.46446 13.7093 56.5670 5.92082 14.1378 57.4820 6.52755 14.3866 58.4117 7.01573 14.5169 59.3564 7.49860 14.6483 60.3165 7.96723 14.5679 61.2921 8.22797 14.4274 62.2834 8.29224 14.4108 63.2908 8.40443 14.5101 64.3145 8.47961 14.6100 65.3547 8.39545 14.7107 66.4118 8.30658 15.2458 67.4859 8.39631 15.8407 68.5775 8.58111 16.6268 69.6867 9.09594 17.5532 70.8138 10.0659 18.5311 71.9591 11.2504 18.8555 73.1230 12.4248 19.1557 74.3057 13.8941 19.1313 75.5076 15.1220 18.7341 76.7289 16.0616 18.1156 77.9699 16.8175 17.5132 79.2310 17.4571 16.9264 80.5125 18.0563 16.3521 81.8147 18.5549 15.6601 83.1380 18.9250 14.9974 84.4827 19.1709 14.3878 85.8491 19.4255 13.8863 87.2377 19.7460 13.4023 88.6487 20.1246 12.7254 90.0825 20.2642 11.9476 91.5395 20.2451 11.2173 93.0201 20.0327 10.6215 94.5246 19.8880 10.1774 96.0535 19.7710 9.75193 97.6071 19.6371 9.34422 99.1858 19.4634 8.95357 100.790 19.2828 8.64946 102.420 19.1247 8.36195 104.077 18.9691 8.08400 105.760 18.8081 7.81529 107.471 18.6342 7.56036 109.209 18.4578 7.32109 110.975 18.2735 7.08939 112.770 18.0757 6.86502 114.594 17.8623 6.65472 116.448 17.6370 6.45444 118.331 17.3889 6.26053 120.245 17.1226 6.09217 122.190 16.8304 5.92833 124.166 16.4548 5.77458 126.175 16.0976 5.78754 128.215 15.7977 5.80054 130.289 15.5124 5.81356 132.397 15.2068 5.83960 134.538 14.9243 5.90864 136.714 14.6606 5.97849 138.925 14.3974 6.04917 141.172 14.1173 6.12068 143.456 13.8031 6.23732 145.776 13.5254 6.40088 148.134 13.2633 6.56873 150.530 12.9932 6.74099 152.964 12.7167 6.95984 155.439 12.4699 7.20614 157.953 12.2388 7.46117 160.507 12.0125 7.72521 163.103 11.7683 8.01646 165.742 11.5592 8.36053 168.422 11.3806 8.71938 171.146 11.2286 9.09362 173.915 11.1116 9.48043 176.727 11.0097 9.85501 179.586 10.9203 10.2444 182.491 10.8491 10.6492 185.442 10.8049 11.0699 188.442 10.8191 11.5073 191.489 10.8582 11.8722 194.587 10.8698 12.2278 197.734 10.8731 12.5940 200.932 10.8742 12.9712 204.182 10.8686 13.3597 207.485 10.8587 13.7959 210.840 10.8854 14.2654 214.251 10.9492 14.7510 217.716 11.0495 15.2531 221.237 11.2246 15.7509 224.816 11.4022 16.2117 228.452 11.5882 16.6860 232.147 11.8082 17.1742 235.902 12.0863 17.6767 239.717 12.4937 18.1211 243.595 12.8355 18.4349 247.535 13.1425 18.7542 251.538 13.4452 19.0789 255.607 13.7679 19.4094 259.741 14.1204 19.6839 263.942 14.4351 19.9230 268.211 14.7189 20.1650 272.549 14.9906 20.4099 276.957 15.2515 20.6577 281.437 15.4963 20.9164 285.989 15.7495 21.1951 290.615 16.0096 21.4776 295.315 16.2743 21.7638 300.092 16.5434 22.0538 304.945 16.8140 22.3507 309.878 17.0949 22.6567 314.890 17.3866 22.9664 319.983 17.6879 23.2798 325.158 17.9985 23.5970 330.418 18.3201 23.9196 335.762 18.6547 24.2466 341.192 19.0029 24.5777 346.711 19.3661 24.9135 352.319 19.7469 25.2539 358.017 20.1472 25.5986 363.808 20.5705 25.9480 369.692 21.0211 26.3024 375.672 21.5068 26.6619 381.748 22.0427 27.0267 387.922 22.6642 27.3705 394.197 23.3752 27.6596 400.573 24.1070 27.7573 407.052 24.7286 27.7781 413.635 25.2907 27.7993 420.326 25.8200 27.8201 427.124 26.3268 27.8410 434.032 26.8182 27.8624 441.052 27.2991 27.8840 448.186 27.7883 27.9008 455.435 28.2640 27.8929 462.802 28.7210 27.8663 470.287 29.1500 27.8300 477.894 29.5538 27.7952 485.623 29.9358 27.7593 493.478 30.2920 27.7233 501.459 30.6169 27.6882 509.570 30.8943 27.6530 517.812 31.0540 27.6565 526.187 31.1498 27.7985 534.698 31.2847 28.2058 543.346 31.6762 28.7535 552.134 32.3536 29.3103 561.065 33.2344 29.5372 570.139 34.0865 29.5857 579.361 34.8060 29.5097 588.732 35.4652 29.4124 598.254 36.0729 29.3017 607.930 36.6519 29.1908 617.763 37.2176 29.0813 627.755 37.7944 28.9693 637.908 38.3790 28.8129 648.226 38.9469 28.5927 658.711 39.4391 28.3318 669.365 39.8651 28.0733 680.191 40.2342 27.8554 691.193 40.5811 27.6713 702.372 40.9019 27.5165 713.733 41.2118 27.4391 725.277 41.5850 27.4150 737.008 42.0065 27.3909 748.928 42.4696 27.3668 761.042 42.9901 27.3389 773.351 43.5984 27.2699 785.859 44.2542 27.0584 798.570 44.8036 26.7316 811.486 45.2814 26.4088 824.611 45.7200 26.0895 837.949 46.1321 25.7739 851.502 46.5234 25.4571 865.274 46.8962 25.1385 879.269 47.2475 24.8189 893.491 47.5817 24.5032 907.943 47.9035 24.1913 922.628 48.2204 23.8831 937.551 48.5246 23.5590 952.715 48.8124 23.2341 968.124 49.0820 22.9091 983.783 49.3386 22.5882 999.695 49.5866 22.2688 1015.86 49.8314 21.9509 1032.29 50.0596 21.6119 1048.99 50.2681 21.2739 1065.96 50.4555 20.9370 1083.20 50.6261 20.6052 1100.72 50.7823 20.2783 1118.52 50.9249 19.9561 1136.61 51.0546 19.6386 1155. 51.1722 19.3259 1173.68 51.2785 19.0180 1192.66 51.3738 18.7143 1211.95 51.4588 18.4152 1231.55 51.5349 18.1203 1251.47 51.6021 17.8255 1271.72 51.6590 17.5301 1292.29 51.6991 17.2330 1313.19 51.7230 16.9402 1334.43 51.7324 16.6523 1356.01 51.7279 16.3691 1377.94 51.7096 16.0903 1400.23 51.6773 15.8158 1422.88 51.6305 15.5454 1445.89 51.5690 15.2793 1469.28 51.4933 15.0167 1493.04 51.4028 14.7568 1517.19 51.2925 14.4942 1541.73 51.1597 14.2353 1566.67 51.0039 13.9809 1592.01 50.8243 13.7306 1617.76 50.6192 13.4844 1643.92 50.3861 13.2421 1670.51 50.1221 13.0041 1697.53 49.8239 12.7702 1724.99 49.4914 12.5404 1752.89 49.1134 12.3058 1781.24 48.6789 12.0724 1810.05 48.1781 11.8407 1839.32 47.5988 11.6137 1869.07 46.9256 11.3910 1899.30 46.1355 11.1724 1930.02 45.1937 10.9576 1961.24 44.0470 10.7469 1992.96 42.6065 10.5407 2025.20 40.7193 10.3435 2057.95 38.0172 10.1385 2091.24 33.3254 9.93584 2121.50 0.537214 9.75786 2121.70 0.535749 27.4284 2125.06 20.3955 27.3696 2159.43 32.1554 26.7804 2194.36 29.5656 26.2046 2201.80 13.1232 26.0848 2202. 13.1439 38.5454 2229.85 37.6075 37.8534 2265.92 42.8686 36.9881 2302.57 46.1724 36.1431 2339.81 48.6155 35.3172 2377.66 50.5369 34.5116 2416.11 52.0890 33.7242 2455.19 53.3494 32.9558 2494.90 54.3527 32.2050 2535.26 55.0928 31.4720 2576.26 55.4892 30.7570 2617.93 55.1214 30.0583 2645.30 47.4320 29.6139 2645.50 47.4376 34.2684 2660.27 55.1840 33.9885 2703.30 58.0215 33.1949 2747.03 59.5605 32.4207 2791.46 60.7071 31.6658 2836.61 61.6255 30.9297 2882.49 62.3688 30.2110 2929.11 62.9433 29.5107 2976.48 63.2825 28.8275 3024.63 62.1169 28.1599 3026.40 60.5309 28.1358 3026.60 60.5336 29.8585 3073.55 64.4574 29.2107 3123.26 65.3424 28.5503 3173.78 65.9810 27.9062 3225.11 66.4411 27.2770 3277.27 66.5489 26.6641 3295.90 64.8614 26.4510 3296.10 64.8636 27.5800 3330.28 67.3053 27.1880 3384.15 68.1329 26.5894 3438.88 68.7545 26.0011 3494.50 69.2856 25.4237 3551.02 69.7561 24.8552 3608.46 70.1805 24.2985 3666.82 70.5679 23.7519 3726.13 70.9235 23.2156 3786.40 71.2497 22.6878 3847.64 71.5499 22.1718 3909.87 71.8275 21.6655 3973.11 72.0845 21.1695 4037.38 72.3218 20.6818 4102.68 72.5401 20.2043 4169.03 72.7424 19.7372 4236.46 72.9290 19.2783 4304.98 73.1006 18.8298 4374.62 73.2589 18.3901 4445.37 73.4040 17.9594 4517.27 73.5370 17.5375 4590.33 73.6585 17.1247 4664.58 73.7693 16.7204 4740.03 73.8698 16.3247 4816.69 73.9605 15.9376 4894.60 74.0423 15.5587 4973.77 74.1154 15.1879 5054.21 74.1800 14.8252 5135.96 74.2369 14.4704 5219.03 74.2863 14.1236 5303.44 74.3288 13.7843 5389.22 74.3644 13.4525 5476.39 74.3937 13.1282 5564.97 74.4168 12.8110 5654.98 74.4341 12.5011 5746.44 74.4456 12.1981 5839.39 74.4519 11.9022 5933.83 74.4531 11.6129 6029.81 74.4493 11.3302 6127.33 74.4407 11.0542 6226.44 74.4275 10.7843 6327.15 74.4100 10.5209 6429.48 74.3881 10.2634 6533.48 74.3620 10.0121 6639.15 74.3319 9.76641 6746.54 74.2976 9.52668 6855.65 74.2595 9.29264 6966.54 74.2175 9.06404 7079.22 74.1718 8.84084 7193.72 74.1221 8.62279 7310.07 74.0686 8.41010 7428.31 74.0113 8.20221 7548.45 73.9499 7.99961 7670.54 73.8846 7.80150 7794.61 73.8152 7.60841 7920.68 73.7415 7.41965 8048.79 73.6633 7.23560 8178.98 73.5806 7.05599 8311.26 73.4929 6.88054 8445.69 73.3998 6.70940 8582.29 73.3010 6.54238 8721.11 73.1963 6.37954 8862.16 73.0849 6.22024 9005.50 72.9658 6.06517 9151.16 72.8388 5.91366 9299.17 72.7023 5.76585 9449.58 72.5554 5.62157 9602.42 72.3965 5.48071 9757.73 72.2235 5.34339 9915.55 72.0389 5.20926 10075.9 71.8332 5.06622 10238.9 71.5903 4.92680 10404.5 71.3112 4.79093 10572.8 70.9841 4.65851 10743.8 70.5910 4.52948 10917.6 70.1000 4.40374 11094.2 69.4473 4.28123 11273.6 68.4707 4.16186 11455.9 66.4777 4.04556 11563.6 52.2359 3.97926 11563.8 52.2369 10.4400 11641.2 65.9142 10.3166 11829.5 68.4505 10.0256 12020.8 69.4959 9.74292 12215.3 70.0966 9.46818 12412.8 70.4504 9.20119 12613.6 70.6151 8.94172 12817.6 70.5821 8.68958 13025.0 70.2352 8.44455 13235.6 68.5077 8.20643 13272.5 62.4930 8.16585 13272.7 62.4933 11.3782 13449.7 70.2552 11.1468 13667.2 71.0704 10.8729 13879.8 68.8067 10.6158 13880.0 68.8083 11.9295 13888.3 70.4412 11.9199 14112.9 72.2655 11.6637 14341.2 72.9742 11.4102 14573.1 73.5068 11.1595 14808.9 73.9451 10.9118 15048.4 74.3205 10.6672 15291.8 74.6489 10.4259 15539.1 74.9405 10.1880 15790.4 75.2017 9.95343 16045.8 75.4374 9.72244 16305.4 75.6511 9.49503 16569.1 75.8456 9.27128 16837.1 76.0230 9.05122 17109.4 76.1853 8.83491 17386.1 76.3338 8.62236 17667.4 76.4699 8.41361 17953.1 76.5946 8.20866 18243.5 76.7090 8.00753 18538.6 76.8139 7.81022 18838.4 76.9099 7.61672 19143.1 76.9978 7.42703 19452.7 77.0781 7.24113 19767.4 77.1514 7.05901 20087.1 77.2182 6.88064 20412.0 77.2790 6.70599 20742.1 77.3340 6.53504 21077.6 77.3837 6.36774 21418.5 77.4285 6.20408 21765.0 77.4686 6.04401 22117.0 77.5043 5.88748 22474.7 77.5360 5.73447 22838.2 77.5639 5.58490 23207.6 77.5881 5.43876 23583.0 77.6090 5.29597 23964.4 77.6268 5.15651 24352.0 77.6416 5.02031 24745.9 77.6536 4.88733 25146.2 77.6630 4.75751 25552.9 77.6699 4.63080 25966.2 77.6746 4.50716 26386.1 77.6771 4.38651 26812.9 77.6776 4.26881 27246.6 77.6762 4.15401 27687.3 77.6731 4.04206 28135.1 77.6684 3.93288 28590.2 77.6622 3.82645 29052.6 77.6552 3.72269 29522.5 77.6565 3.62156 30000.0 77.6045 3.52300 periodictable-1.5.0/periodictable/xsf/ra.nff000066400000000000000000000322111310514471200210230ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.416155E-01 10.1617 -9999. 0.447891E-01 10.3261 -9999. 0.482047E-01 10.4931 -9999. 0.518808E-01 10.6628 -9999. 0.558373E-01 10.8353 -9999. 0.600954E-01 11.0106 -9999. 0.646784E-01 11.1886 -9999. 0.696108E-01 11.3696 -9999. 0.749193E-01 11.5535 -9999. 0.810239E-01 11.7404 -9999. 0.895658E-01 11.9303 -9999. 0.983588E-01 12.1232 -9999. 0.106042 12.3193 -9999. 0.114325 12.5186 -9999. 0.123256 12.7210 -9999. 0.134144 12.9268 -9999. 0.146005 13.1359 -9999. 0.159223 13.3483 -9999. 0.177830 13.5642 -9999. 0.198612 13.7836 -9999. 0.218147 14.0066 -9999. 0.238232 14.2331 -9999. 0.261404 14.4633 -9999. 0.310039 14.6973 -9999. 0.346301 14.9350 -9999. 0.394322 15.1765 -9999. 0.450738 15.4220 -9999. 0.507685 15.6714 -9999. 0.601651 15.9249 -9999. 0.774102 16.1825 -9999. 1.02488 16.4442 -9999. 1.51883 16.7102 -9999. 2.21984 16.9805 -9999. 3.07294 17.2551 -9999. 3.83627 17.5342 -9999. 4.65683 17.8178 -9999. 5.53903 18.1060 -9999. 6.33654 18.3989 -9999. 7.24889 18.6964 -9999. 7.79441 18.9988 -9999. 8.37895 19.3061 -9999. 9.00733 19.6184 -9999. 9.34882 19.9357 -9999. 9.66155 20.2582 -9999. 9.94611 20.5858 -9999. 10.2140 20.9188 -9999. 10.4890 21.2571 -9999. 10.6666 21.6009 -9999. 10.7906 21.9503 -9999. 10.9161 22.3053 -9999. 10.9629 22.6661 -9999. 10.9902 23.0327 -9999. 11.0176 23.4053 -9999. 11.0451 23.7838 -9999. 11.0788 24.1685 -9999. 11.1201 24.5594 -9999. 11.1615 24.9566 -9999. 11.2030 25.3603 -9999. 11.2447 25.7705 -9999. 11.2654 26.1873 -9999. 11.1628 26.6109 -9999. 11.0612 27.0413 -9999. 10.9606 27.4786 -9999. 10.8608 27.9231 -9999. 10.6947 28.3747 -9999. 10.3380 28.8337 -9999. 9.99321 29.3000 10.0231 9.65993 29.7739 10.3869 9.31387 30.2555 10.6731 8.80151 30.7449 10.8378 8.31736 31.2421 10.9276 7.85982 31.7475 10.9564 7.42746 32.2609 10.9156 7.03794 32.7827 10.8750 6.72826 33.3130 10.8401 6.43221 33.8518 10.7975 6.14918 34.3993 10.7449 5.87861 34.9557 10.6821 5.61994 35.5211 10.6094 5.37266 36.0956 10.5275 5.13626 36.6794 10.4378 4.91025 37.2727 10.3440 4.69356 37.8755 10.2388 4.47125 38.4882 10.1175 4.25945 39.1107 9.98372 4.05770 39.7432 9.83946 3.86549 40.3861 9.68548 3.68239 41.0393 9.52230 3.50797 41.7031 9.35041 3.34181 42.3776 9.17094 3.18351 43.0630 8.98657 3.03210 43.7595 8.79012 2.87624 44.4673 8.57817 2.72839 45.1865 8.35357 2.58814 45.9174 8.11693 2.45510 46.6600 7.86833 2.32890 47.4147 7.60777 2.20918 48.1816 7.33637 2.09562 48.9609 7.05586 1.98010 49.7528 6.75056 1.86495 50.5576 6.42306 1.75650 51.3753 6.07239 1.65436 52.2062 5.69115 1.55978 53.0506 5.29561 1.49693 53.9087 4.89295 1.43661 54.7806 4.48402 1.36656 55.6667 4.01550 1.26162 56.5670 3.47459 1.20005 57.4820 2.92314 1.16970 58.4117 2.33601 1.14011 59.3564 1.70094 1.12369 60.3165 1.00897 1.12144 61.2921 0.254754 1.12785 62.2834 -0.582389 1.17308 63.2908 -1.49577 1.23717 64.3145 -2.51051 1.34964 65.3547 -3.65452 1.52064 66.4118 -4.93668 1.75547 67.4859 -6.34632 2.14859 68.5775 -7.89092 2.62972 69.6867 -9.63515 3.21861 70.8138 -11.7133 3.93935 71.9591 -14.5297 4.85418 73.1230 -17.7766 7.24885 74.3057 -20.9928 10.8250 75.5076 -23.6066 16.1657 76.7289 -23.4843 24.1976 77.9699 -20.0133 28.9189 79.2310 -16.5771 32.5597 80.5125 -13.5652 34.3912 81.8147 -11.1454 36.3257 83.1380 -8.67461 38.3690 84.4827 -5.52921 40.0268 85.8491 -2.79682 41.0978 87.2377 -0.162060 42.1976 88.6487 2.91758 42.9495 90.0825 5.57233 43.1639 91.5395 8.06484 43.3795 93.0201 10.6009 43.5961 94.5246 13.5527 43.5507 96.0535 16.0787 42.7158 97.6071 18.2453 41.8968 99.1858 20.2158 41.0936 100.790 22.1117 40.3057 102.420 24.1283 39.5330 104.077 26.1022 38.1953 105.760 27.6229 36.7367 107.471 28.8848 35.3337 109.209 29.9720 33.9843 110.975 30.9262 32.6865 112.770 31.7765 31.4381 114.594 32.5480 30.2375 116.448 33.2715 29.0828 118.331 34.0274 27.9721 120.245 34.6812 26.6142 122.190 35.1513 25.3119 124.166 35.4919 24.0733 126.175 35.7489 22.8954 128.215 35.9395 21.7750 130.289 36.0776 20.7095 132.397 36.1776 19.6962 134.538 36.2690 18.7324 136.714 36.3179 17.7215 138.925 36.2870 16.7527 141.172 36.1973 15.8370 143.456 36.0688 14.9713 145.776 35.9094 14.1530 148.134 35.7246 13.3793 150.530 35.5195 12.6480 152.964 35.2980 11.9566 155.439 35.0644 11.3030 157.953 34.8235 10.6852 160.507 34.5833 10.1011 163.103 34.3723 9.54898 165.742 34.1356 8.91629 168.422 33.8375 8.31716 171.146 33.4970 7.75831 173.915 33.1315 7.23700 176.727 32.7449 6.75072 179.586 32.3366 6.29711 182.491 31.8869 5.87399 185.442 31.4117 5.55237 188.442 30.9927 5.29072 191.489 30.6014 5.04142 194.587 30.2239 4.80385 197.734 29.8543 4.57749 200.932 29.4892 4.36178 204.182 29.1262 4.15625 207.485 28.7663 3.95829 210.840 28.3997 3.76496 214.251 28.0244 3.58108 217.716 27.6387 3.40618 221.237 27.2334 3.23983 224.816 26.7960 3.10925 228.452 26.3817 3.02074 232.147 25.9740 2.93474 235.902 25.5567 2.85120 239.717 25.0991 2.77943 243.595 24.6586 2.78581 247.535 24.2377 2.79221 251.538 23.8098 2.80553 255.607 23.3916 2.83898 259.741 22.9769 2.87283 263.942 22.5456 2.90890 268.211 22.1124 2.97595 272.549 21.6778 3.04455 276.957 21.2322 3.11473 281.437 20.7612 3.18653 285.989 20.2453 3.29183 290.615 19.7284 3.43372 295.315 19.1783 3.58172 300.092 18.6095 3.80575 304.945 18.0515 4.06095 309.878 17.4869 4.33803 314.890 16.9013 4.63597 319.983 16.2499 4.96135 325.158 15.6030 5.43912 330.418 14.9969 5.96290 335.762 14.4018 6.49923 341.192 13.7838 7.08147 346.711 13.1411 7.77906 352.319 12.5476 8.58257 358.017 12.0247 9.46906 363.808 11.6020 10.3980 369.692 11.1848 11.3303 375.672 10.7944 12.3461 381.748 10.4584 13.4531 387.922 10.2266 14.6593 394.197 10.1049 15.8895 400.573 10.1194 17.1995 407.052 10.2404 18.4517 413.635 10.4488 19.7691 420.326 11.0632 21.0697 427.124 11.6124 22.0221 434.032 12.0595 23.0176 441.052 12.5900 24.0580 448.186 13.2449 24.9877 455.435 13.8724 25.8376 462.802 14.4901 26.7163 470.287 15.1720 27.6250 477.894 16.2130 28.4596 485.623 17.1215 28.9117 493.478 17.8451 29.3711 501.459 18.5299 29.8377 509.570 19.1979 30.3115 517.812 19.8600 30.7870 526.187 20.5593 31.2700 534.698 21.2792 31.6738 543.346 21.9355 32.0236 552.134 22.5468 32.3773 561.065 23.0884 32.7349 570.139 23.5985 33.1946 579.361 24.1779 33.7250 588.732 24.8134 34.2638 598.254 25.5185 34.8112 607.930 26.2651 35.3151 617.763 27.0307 35.8136 627.755 27.8331 36.3192 637.908 28.7748 36.7994 648.226 29.6993 37.1517 658.711 30.5880 37.5074 669.365 31.4948 37.8700 680.191 32.4583 38.2553 691.193 33.4979 38.6446 702.372 34.8668 39.0378 713.733 36.2559 38.9004 725.277 37.3795 38.6317 737.008 38.3693 38.3637 748.928 39.2816 38.0976 761.042 40.1441 37.8324 773.351 40.9783 37.5578 785.859 41.7807 37.2463 798.570 42.5152 36.9052 811.486 43.1949 36.5670 824.611 43.8316 36.2320 837.949 44.4339 35.9004 851.502 45.0013 35.5572 865.274 45.5254 35.2014 879.269 45.9834 34.8349 893.491 46.3682 34.4723 907.943 46.6538 34.1136 922.628 46.6919 33.7588 937.551 46.7277 33.9054 952.715 46.9005 34.1821 968.124 47.3131 34.5759 983.783 47.9325 34.9740 999.695 48.7780 35.3026 1015.86 49.9482 35.5540 1032.29 50.9565 35.0996 1048.99 51.7078 34.7124 1065.96 52.3732 34.4027 1083.20 53.0112 34.0952 1100.72 53.6216 33.7902 1118.52 54.2104 33.4874 1136.61 54.7824 33.1867 1155. 55.3425 32.8883 1173.68 55.8951 32.5921 1192.66 56.4454 32.2981 1211.95 57.0020 32.0062 1231.55 57.5883 31.7162 1251.47 58.2024 31.3633 1271.72 58.8217 30.9430 1292.29 59.3575 30.4415 1313.19 59.8269 29.9474 1334.43 60.2549 29.4610 1356.01 60.6504 28.9817 1377.94 61.0183 28.5094 1400.23 61.3626 28.0444 1422.88 61.6859 27.5864 1445.89 61.9903 27.1348 1469.28 62.2784 26.6891 1493.04 62.5522 26.2487 1517.19 62.8080 25.8066 1541.73 63.0449 25.3706 1566.67 63.2650 24.9417 1592.01 63.4701 24.5191 1617.76 63.6613 24.1032 1643.92 63.8395 23.6936 1670.51 64.0053 23.2902 1697.53 64.1594 22.8933 1724.99 64.3104 22.5029 1752.89 64.4491 22.1040 1781.24 64.5696 21.7068 1810.05 64.6727 21.3127 1839.32 64.7585 20.9250 1869.07 64.8298 20.5440 1899.30 64.8870 20.1696 1930.02 64.9307 19.8017 1961.24 64.9614 19.4400 1992.96 64.9752 19.0837 2025.20 64.9885 18.7442 2057.95 64.9902 18.3904 2091.24 64.9704 18.0409 2125.06 64.9330 17.6952 2159.43 64.8778 17.3543 2194.36 64.8048 17.0176 2229.85 64.7122 16.6848 2265.92 64.5989 16.3565 2302.57 64.4642 16.0332 2339.81 64.3066 15.7140 2377.66 64.1236 15.3986 2416.11 63.9123 15.0873 2455.19 63.6705 14.7807 2494.90 63.3941 14.4777 2535.26 63.0783 14.1794 2576.26 62.7184 13.8857 2617.93 62.3070 13.5960 2660.27 61.8350 13.3107 2703.30 61.2902 13.0294 2747.03 60.6561 12.7523 2791.46 59.9093 12.4794 2836.61 59.0157 12.2108 2882.49 57.9218 11.9461 2929.11 56.5362 11.6854 2976.48 54.6827 11.4288 3024.63 51.9383 11.1763 3073.55 46.6276 10.9277 3104.80 16.1960 10.7738 3105. 16.1974 27.2762 3123.26 43.3843 27.0160 3173.78 49.0242 26.3167 3225.11 48.2405 25.6368 3248.30 29.9784 25.3389 3248.50 29.9890 36.5230 3277.27 51.3536 36.0381 3330.28 56.7290 35.1722 3384.15 59.7922 34.3284 3438.88 61.9810 33.5050 3494.50 63.6549 32.7040 3551.02 64.9580 31.9228 3608.46 65.9457 31.1615 3666.82 66.6031 30.4195 3726.13 66.7500 29.6946 3786.40 64.0895 28.9895 3791.70 58.3484 28.9288 3791.90 58.3579 33.5490 3847.64 68.4614 32.8159 3909.87 70.3455 32.0283 3973.11 71.6560 31.2592 4037.38 72.6958 30.5114 4102.68 73.5590 29.7810 4169.03 74.2847 29.0689 4236.46 74.8927 28.3754 4304.98 75.3823 27.6967 4374.62 75.7272 27.0372 4445.37 76.0083 26.3919 4489.40 73.4397 26.0032 4489.60 73.4472 27.5684 4517.27 76.0202 27.3223 4590.33 77.0475 26.6901 4664.58 77.6398 26.0751 4740.03 78.0128 25.4745 4816.69 77.5927 24.8874 4821.90 76.2492 24.8483 4822.10 76.2506 25.9373 4894.60 78.9790 25.3852 4973.77 79.6603 24.8047 5054.21 80.1946 24.2344 5135.96 80.6516 23.6752 5219.03 81.0556 23.1268 5303.44 81.4183 22.5894 5389.22 81.7465 22.0623 5476.39 82.0451 21.5460 5564.97 82.3178 21.0404 5654.98 82.5674 20.5453 5746.44 82.7959 20.0601 5839.39 83.0051 19.5851 5933.83 83.1966 19.1202 6029.81 83.3720 18.6652 6127.33 83.5320 18.2198 6226.44 83.6781 17.7842 6327.15 83.8110 17.3580 6429.48 83.9317 16.9412 6533.48 84.0409 16.5334 6639.15 84.1393 16.1346 6746.54 84.2275 15.7449 6855.65 84.3063 15.3639 6966.54 84.3759 14.9913 7079.22 84.4371 14.6275 7193.72 84.4904 14.2716 7310.07 84.5359 13.9240 7428.31 84.5744 13.5847 7548.45 84.6064 13.2529 7670.54 84.6318 12.9289 7794.61 84.6511 12.6123 7920.68 84.6645 12.3031 8048.79 84.6723 12.0015 8178.98 84.6754 11.7068 8311.26 84.6732 11.4188 8445.69 84.6663 11.1382 8582.29 84.6552 10.8637 8721.11 84.6394 10.5959 8862.16 84.6195 10.3347 9005.50 84.5961 10.0798 9151.16 84.5691 9.83055 9299.17 84.5384 9.58769 9449.58 84.5047 9.35053 9602.42 84.4684 9.11929 9757.73 84.4301 8.89365 9915.55 84.3979 8.67329 10075.9 84.3631 8.43869 10238.9 84.3081 8.21020 10404.5 84.2470 7.98771 10572.8 84.1792 7.77110 10743.8 84.1049 7.56029 10917.6 84.0244 7.35517 11094.2 83.9377 7.15562 11273.6 83.8448 6.96154 11455.9 83.7455 6.77283 11641.2 83.6395 6.58937 11829.5 83.5264 6.41106 12020.8 83.4056 6.23779 12215.3 83.2766 6.06945 12412.8 83.1383 5.90594 12613.6 82.9896 5.74715 12817.6 82.8292 5.59299 13025.0 82.6549 5.44332 13235.6 82.4644 5.29808 13449.7 82.2542 5.15714 13667.2 82.0196 5.02040 13888.3 81.7537 4.88777 14112.9 81.4464 4.75915 14341.2 81.0811 4.63445 14573.1 80.6292 4.51355 14808.9 80.0330 4.39638 15048.4 79.1480 4.28284 15291.8 77.3730 4.17283 15444.3 63.4445 4.10618 15444.5 63.4453 10.1333 15539.1 76.5895 10.0254 15790.4 79.1100 9.74735 16045.8 80.1454 9.47701 16305.4 80.7672 9.21417 16569.1 81.1762 8.95863 16837.1 81.4442 8.71017 17109.4 81.6003 8.46861 17386.1 81.6513 8.23376 17667.4 81.5826 8.00542 17953.1 81.3385 7.78342 18243.5 80.7011 7.56758 18484.2 73.2421 7.39570 18484.4 73.2422 10.4324 18538.6 79.3439 10.3877 18838.4 81.1169 10.1461 19143.1 81.2455 9.91006 19236.6 78.2514 9.83947 19236.8 78.2519 11.3016 19452.7 82.2057 11.1140 19767.4 83.0544 10.8497 20087.1 83.6255 10.5903 20412.0 84.0732 10.3358 20742.1 84.4447 10.0862 21077.6 84.7626 9.84149 21418.5 85.0396 9.60163 21765.0 85.2840 9.36658 22117.0 85.5015 9.13633 22474.7 85.6963 8.91083 22838.2 85.8716 8.69003 23207.6 86.0299 8.47390 23583.0 86.1732 8.26238 23964.4 86.3031 8.05543 24352.0 86.4211 7.85298 24745.9 86.5283 7.65499 25146.2 86.6256 7.46139 25552.9 86.7141 7.27213 25966.2 86.7943 7.08714 26386.1 86.8671 6.90635 26812.9 86.9329 6.72972 27246.6 86.9925 6.55715 27687.3 87.0461 6.38860 28135.1 87.0943 6.22398 28590.2 87.1375 6.06325 29052.6 87.1760 5.90632 29522.5 87.2101 5.75313 30000.0 87.2402 5.60361 periodictable-1.5.0/periodictable/xsf/rb.nff000066400000000000000000000317321310514471200210330ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.696833E-01 10.1617 -9999. 0.710428E-01 10.3261 -9999. 0.725292E-01 10.4931 -9999. 0.744146E-01 10.6628 -9999. 0.763490E-01 10.8353 -9999. 0.783337E-01 11.0106 -9999. 0.803700E-01 11.1886 -9999. 0.829975E-01 11.3696 -9999. 0.859930E-01 11.5535 -9999. 0.890967E-01 11.7404 -9999. 0.923123E-01 11.9303 -9999. 0.956440E-01 12.1232 -9999. 0.992070E-01 12.3193 -9999. 0.103755 12.5186 -9999. 0.108511 12.7210 -9999. 0.113485 12.9268 -9999. 0.118687 13.1359 -9999. 0.125355 13.3483 -9999. 0.132968 13.5642 -9999. 0.141044 13.7836 -9999. 0.150192 14.0066 -9999. 0.160776 14.2331 -9999. 0.172105 14.4633 -9999. 0.184233 14.6973 -9999. 0.199124 14.9350 -9999. 0.218760 15.1765 -9999. 0.414294 15.4220 -9999. 0.889737 15.6714 -9999. 1.91082 15.9249 -9999. 4.10371 16.1825 -9999. 8.81322 16.4442 -9999. 9.74157 16.7102 -9999. 10.2630 16.9805 -9999. 10.8124 17.2551 -9999. 11.3911 17.5342 -9999. 12.0009 17.8178 -9999. 12.6432 18.1060 -9999. 13.2106 18.3989 -9999. 13.6342 18.6964 -9999. 14.0713 18.9988 -9999. 14.5225 19.3061 -9999. 14.9881 19.6184 -9999. 15.4687 19.9357 -9999. 15.9304 20.2582 -9999. 16.3239 20.5858 -9999. 16.7272 20.9188 -9999. 17.1404 21.2571 -9999. 17.5637 21.6009 -9999. 17.9976 21.9503 -9999. 18.4422 22.3053 -9999. 18.8977 22.6661 -9999. 19.3645 23.0327 -9999. 19.7441 23.4053 -9999. 19.9536 23.7838 -9999. 20.1653 24.1685 -9999. 20.3793 24.5594 -9999. 20.5955 24.9566 -9999. 20.8140 25.3603 -9999. 21.0349 25.7705 -9999. 21.2581 26.1873 -9999. 20.9385 26.6109 -9999. 20.6113 27.0413 -9999. 20.2892 27.4786 -9999. 19.9721 27.9231 -9999. 19.6179 28.3747 -9999. 18.8853 28.8337 -9999. 18.1801 29.3000 13.0655 17.5013 29.7739 13.6343 16.8478 30.2555 14.1644 16.2187 30.7449 14.6787 15.6131 31.2421 15.2658 15.0301 31.7475 16.0401 14.2168 32.2609 16.4451 13.1815 32.7827 16.6505 12.2216 33.3130 16.7498 11.3316 33.8518 16.7722 10.5064 34.3993 16.7367 9.74125 34.9557 16.6564 9.03186 35.5211 16.5409 8.37413 36.0956 16.3974 7.76430 36.6794 16.2315 7.19888 37.2727 16.0477 6.67464 37.8755 15.8489 6.18858 38.4882 15.6362 5.73789 39.1107 15.4056 5.32174 39.7432 15.1759 4.96640 40.3861 14.9581 4.63479 41.0393 14.7460 4.32532 41.7031 14.5368 4.03651 42.3776 14.3302 3.76699 43.0630 14.1263 3.51546 43.7595 13.9249 3.28074 44.4673 13.7264 3.06168 45.1865 13.5308 2.85725 45.9174 13.3382 2.66646 46.6600 13.1488 2.48842 47.4147 12.9628 2.32227 48.1816 12.7805 2.16721 48.9609 12.6031 2.02250 49.7528 12.4304 1.88159 50.5576 12.2554 1.74799 51.3753 12.0804 1.62386 52.2062 11.9066 1.50856 53.0506 11.7342 1.40144 53.9087 11.5629 1.30193 54.7806 11.3924 1.20948 55.6667 11.2210 1.12360 56.5670 11.0428 1.04381 57.4820 10.8677 0.992020 58.4117 10.7075 0.946484 59.3564 10.5550 0.903038 60.3165 10.4070 0.861585 61.2921 10.2619 0.822035 62.2834 10.1182 0.784302 63.2908 9.97388 0.748301 64.3145 9.82197 0.713951 65.3547 9.67225 0.702303 66.4118 9.53431 0.693770 67.4859 9.40176 0.685340 68.5775 9.27079 0.677013 69.6867 9.14135 0.673057 70.8138 9.01567 0.670594 71.9591 8.89149 0.668139 73.1230 8.76606 0.665693 74.3057 8.64030 0.667955 75.5076 8.51619 0.671485 76.7289 8.39057 0.676306 77.9699 8.26585 0.683734 79.2310 8.13956 0.691245 80.5125 8.01101 0.703644 81.8147 7.88388 0.718507 83.1380 7.75719 0.733684 84.4827 7.62983 0.749181 85.8491 7.49986 0.762427 87.2377 7.36527 0.775589 88.6487 7.22519 0.788978 90.0825 7.07858 0.802598 91.5395 6.92010 0.817667 93.0201 6.75599 0.840922 94.5246 6.58566 0.864837 96.0535 6.40438 0.889432 97.6071 6.19894 0.914728 99.1858 5.98093 0.965974 100.790 5.75257 1.02160 102.420 5.48986 1.08341 104.077 5.19676 1.19999 105.760 4.88690 1.35034 107.471 4.51152 1.61097 109.209 4.21037 2.10889 110.975 4.36298 2.61845 112.770 4.65202 2.77437 114.594 4.75819 2.54704 116.448 4.39079 2.25945 118.331 3.94565 2.46738 120.245 3.62949 2.72927 122.190 3.36364 2.98313 124.166 3.10166 3.26059 126.175 2.84250 3.58013 128.215 2.60752 3.94302 130.289 2.40451 4.34268 132.397 2.26196 4.78285 134.538 2.14884 5.17940 136.714 2.04269 5.59880 138.925 1.98300 6.05217 141.172 1.95945 6.47463 143.456 1.93517 6.89553 145.776 1.95321 7.34379 148.134 1.97937 7.73205 150.530 1.99933 8.13780 152.964 2.02702 8.56484 155.439 2.09596 9.01429 157.953 2.18310 9.41778 160.507 2.26421 9.82508 163.103 2.34471 10.2500 165.742 2.44090 10.6933 168.422 2.56045 11.1557 171.146 2.72589 11.6382 173.915 2.92074 12.0874 176.727 3.12733 12.5423 179.586 3.38713 13.0143 182.491 3.67567 13.4378 185.442 3.96717 13.8580 188.442 4.31301 14.2914 191.489 4.68970 14.6314 194.587 5.04039 14.9385 197.734 5.36986 15.2520 200.932 5.70947 15.5657 204.182 6.04802 15.8651 207.485 6.38746 16.1703 210.840 6.73667 16.4813 214.251 7.10220 16.7983 217.716 7.49079 17.1214 221.237 7.91300 17.4507 224.816 8.38822 17.7864 228.452 9.00708 18.1285 232.147 9.63664 18.1769 235.902 10.1463 18.1785 239.717 10.5526 18.1802 243.595 10.8904 18.2109 247.535 11.2292 18.3272 251.538 11.5939 18.4443 255.607 11.9673 18.5621 259.741 12.3476 18.6807 263.942 12.7356 18.8000 268.211 13.1336 18.9200 272.549 13.5457 19.0409 276.957 13.9826 19.1625 281.437 14.4580 19.2504 285.989 14.9247 19.2836 290.615 15.3598 19.3168 295.315 15.7953 19.3501 300.092 16.2355 19.3835 304.945 16.6871 19.4169 309.878 17.1613 19.4504 314.890 17.6935 19.4839 319.983 18.2749 19.3816 325.158 18.7838 19.1986 330.418 19.2141 19.0172 335.762 19.6151 18.8376 341.192 19.9905 18.6596 346.711 20.3441 18.4834 352.319 20.6766 18.3088 358.017 20.9803 18.1358 363.808 21.2635 18.0096 369.692 21.5671 17.8997 375.672 21.8864 17.7908 381.748 22.2173 17.6823 387.922 22.5675 17.5660 394.197 22.9378 17.4319 400.573 23.3133 17.2334 407.052 23.6436 17.0118 413.635 23.9421 16.7935 420.326 24.2245 16.5778 427.124 24.4937 16.3648 434.032 24.7524 16.1544 441.052 25.0043 15.9467 448.186 25.2513 15.7395 455.435 25.4931 15.5245 462.802 25.7240 15.3058 470.287 25.9407 15.0864 477.894 26.1470 14.8695 485.623 26.3446 14.6563 493.478 26.5357 14.4462 501.459 26.7214 14.2389 509.570 26.9028 14.0344 517.812 27.0825 13.8312 526.187 27.2601 13.6255 534.698 27.4337 13.4129 543.346 27.5954 13.1986 552.134 27.7532 12.9874 561.065 27.9064 12.7670 570.139 28.0388 12.5456 579.361 28.1613 12.3350 588.732 28.2799 12.1293 598.254 28.3943 11.9280 607.930 28.5052 11.7304 617.763 28.6138 11.5360 627.755 28.7228 11.3441 637.908 28.8315 11.1464 648.226 28.9355 10.9388 658.711 29.0213 10.7266 669.365 29.0831 10.5184 680.191 29.1278 10.3368 691.193 29.1887 10.1753 702.372 29.2612 10.0199 713.733 29.3471 9.84877 725.277 29.4192 9.66818 737.008 29.4819 9.49079 748.928 29.5398 9.31666 761.042 29.5945 9.14561 773.351 29.6473 8.97615 785.859 29.6989 8.80413 798.570 29.7419 8.63078 811.486 29.7782 8.46096 824.611 29.8098 8.29442 837.949 29.8375 8.13111 851.502 29.8618 7.96977 865.274 29.8826 7.81015 879.269 29.8983 7.65243 893.491 29.9096 7.49794 907.943 29.9175 7.34652 922.628 29.9228 7.19811 937.551 29.9249 7.04944 952.715 29.9220 6.90302 968.124 29.9142 6.75894 983.783 29.9019 6.61784 999.695 29.8852 6.48002 1015.86 29.8647 6.34543 1032.29 29.8414 6.21593 1048.99 29.8173 6.08696 1065.96 29.7881 5.95837 1083.20 29.7539 5.83239 1100.72 29.7154 5.70906 1118.52 29.6725 5.58831 1136.61 29.6254 5.47018 1155. 29.5738 5.35450 1173.68 29.5177 5.24123 1192.66 29.4570 5.13040 1211.95 29.3915 5.02195 1231.55 29.3217 4.91584 1251.47 29.2469 4.81004 1271.72 29.1664 4.70463 1292.29 29.0768 4.59924 1313.19 28.9781 4.49628 1334.43 28.8706 4.39564 1356.01 28.7535 4.29725 1377.94 28.6262 4.20103 1400.23 28.4875 4.10688 1422.88 28.3361 4.01473 1445.89 28.1710 3.92486 1469.28 27.9912 3.83577 1493.04 27.7927 3.74682 1517.19 27.5710 3.65225 1541.73 27.3160 3.55898 1566.67 27.0247 3.46804 1592.01 26.6900 3.37944 1617.76 26.3007 3.29312 1643.92 25.8405 3.20902 1670.51 25.2835 3.12708 1697.53 24.5866 3.04723 1724.99 23.6678 2.96942 1752.89 22.3359 2.88900 1781.24 19.9255 2.80978 1804.30 4.47116 2.74784 1804.50 4.47535 11.5981 1810.05 15.7986 11.5078 1839.32 20.1284 11.0470 1863.80 14.3771 10.6813 1864. 14.3918 14.8890 1869.07 19.8218 14.8370 1899.30 23.4852 14.5339 1930.02 25.1074 14.2370 1961.24 26.2065 13.9462 1992.96 26.9961 13.6613 2025.20 27.5089 13.3855 2057.95 27.2104 13.1122 2065. 25.3302 13.0547 2065.20 25.3402 14.7486 2091.24 28.6552 14.5089 2125.06 29.6640 14.2077 2159.43 30.4102 13.9092 2194.36 31.0317 13.6132 2229.85 31.5718 13.3199 2265.92 32.0512 13.0301 2302.57 32.4820 12.7435 2339.81 32.8724 12.4606 2377.66 33.2287 12.1813 2416.11 33.5552 11.9056 2455.19 33.8550 11.6340 2494.90 34.1313 11.3665 2535.26 34.3867 11.1030 2576.26 34.6226 10.8435 2617.93 34.8413 10.5885 2660.27 35.0438 10.3374 2703.30 35.2314 10.0908 2747.03 35.4053 9.84833 2791.46 35.5667 9.61038 2836.61 35.7162 9.37689 2882.49 35.8548 9.14757 2929.11 35.9832 8.92274 2976.48 36.1022 8.70231 3024.63 36.2121 8.48616 3073.55 36.3139 8.27444 3123.26 36.4074 8.06675 3173.78 36.4943 7.86361 3225.11 36.5738 7.66477 3277.27 36.6470 7.46990 3330.28 36.7138 7.27916 3384.15 36.7752 7.09288 3438.88 36.8312 6.91044 3494.50 36.8820 6.73207 3551.02 36.9280 6.55772 3608.46 36.9696 6.38730 3666.82 37.0069 6.22078 3726.13 37.0402 6.05806 3786.40 37.0697 5.89908 3847.64 37.0957 5.74385 3909.87 37.1184 5.59227 3973.11 37.1379 5.44433 4037.38 37.1545 5.29984 4102.68 37.1683 5.15888 4169.03 37.1795 5.02129 4236.46 37.1882 4.88707 4304.98 37.1945 4.75612 4374.62 37.1988 4.62845 4445.37 37.2009 4.50384 4517.27 37.2011 4.38241 4590.33 37.1995 4.26401 4664.58 37.1962 4.14860 4740.03 37.1914 4.03608 4816.69 37.1850 3.92644 4894.60 37.1772 3.81954 4973.77 37.1682 3.71546 5054.21 37.1579 3.61397 5135.96 37.1464 3.51519 5219.03 37.1338 3.41889 5303.44 37.1203 3.32518 5389.22 37.1058 3.23389 5476.39 37.0905 3.14492 5564.97 37.0743 3.05839 5654.98 37.0573 2.97409 5746.44 37.0396 2.89202 5839.39 37.0213 2.81217 5933.83 37.0024 2.73438 6029.81 36.9828 2.65871 6127.33 36.9627 2.58503 6226.44 36.9421 2.51341 6327.15 36.9211 2.44369 6429.48 36.8995 2.37584 6533.48 36.8777 2.30986 6639.15 36.8553 2.24561 6746.54 36.8327 2.18316 6855.65 36.8096 2.12231 6966.54 36.7862 2.06320 7079.22 36.7626 2.00574 7193.72 36.7387 1.94981 7310.07 36.7144 1.89537 7428.31 36.6898 1.84250 7548.45 36.6649 1.79110 7670.54 36.6398 1.74111 7794.61 36.6145 1.69249 7920.68 36.5888 1.64523 8048.79 36.5629 1.59926 8178.98 36.5367 1.55456 8311.26 36.5102 1.51113 8445.69 36.4834 1.46891 8582.29 36.4563 1.42785 8721.11 36.4288 1.38795 8862.16 36.4009 1.34918 9005.50 36.3727 1.31147 9151.16 36.3440 1.27485 9299.17 36.3149 1.23924 9449.58 36.2852 1.20463 9602.42 36.2550 1.17100 9757.73 36.2242 1.13833 9915.55 36.1927 1.10655 10075.9 36.1604 1.07569 10238.9 36.1273 1.04570 10404.5 36.0933 1.01656 10572.8 36.0583 0.988242 10743.8 36.0221 0.960729 10917.6 35.9846 0.933996 11094.2 35.9455 0.908023 11273.6 35.9049 0.882786 11455.9 35.8622 0.858268 11641.2 35.8174 0.834447 11829.5 35.7701 0.811303 12020.8 35.7198 0.788819 12215.3 35.6660 0.766974 12412.8 35.6082 0.745753 12613.6 35.5455 0.725136 12817.6 35.4770 0.705108 13025.0 35.4013 0.685651 13235.6 35.3167 0.666749 13449.7 35.2206 0.648388 13667.2 35.1097 0.630550 13888.3 34.9786 0.613223 14112.9 34.8187 0.596390 14341.2 34.6151 0.580039 14573.1 34.3376 0.564155 14808.9 33.9105 0.548725 15048.4 33.0208 0.533737 15199.6 25.7196 0.524605 15199.8 25.7199 3.68556 15291.8 32.6205 3.65214 15539.1 33.9981 3.56470 15790.4 34.6009 3.47872 16045.8 34.9964 3.39422 16305.4 35.2915 3.31121 16569.1 35.5265 3.22968 16837.1 35.7210 3.14966 17109.4 35.8862 3.07115 17386.1 36.0289 2.99414 17667.4 36.1539 2.91862 17953.1 36.2644 2.84461 18243.5 36.3629 2.77209 18538.6 36.4512 2.70105 18838.4 36.5308 2.63149 19143.1 36.6027 2.56340 19452.7 36.6679 2.49675 19767.4 36.7272 2.43155 20087.1 36.7813 2.36777 20412.0 36.8305 2.30540 20742.1 36.8755 2.24442 21077.6 36.9165 2.18482 21418.5 36.9541 2.12658 21765.0 36.9884 2.06967 22117.0 37.0197 2.01409 22474.7 37.0483 1.95981 22838.2 37.0744 1.90681 23207.6 37.0982 1.85507 23583.0 37.1199 1.80457 23964.4 37.1396 1.75529 24352.0 37.1574 1.70721 24745.9 37.1736 1.66030 25146.2 37.1881 1.61456 25552.9 37.2012 1.56994 25966.2 37.2130 1.52644 26386.1 37.2235 1.48403 26812.9 37.2327 1.44270 27246.6 37.2409 1.40241 27687.3 37.2481 1.36314 28135.1 37.2543 1.32489 28590.2 37.2597 1.28762 29052.6 37.2645 1.25131 29522.5 37.2718 1.21595 30000.0 37.2605 1.18152 periodictable-1.5.0/periodictable/xsf/re.nff000066400000000000000000000320561310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.82090 10.1617 -9999. 1.91145 10.3261 -9999. 2.00650 10.4931 -9999. 2.10629 10.6628 -9999. 2.21103 10.8353 -9999. 2.28753 11.0106 -9999. 2.36020 11.1886 -9999. 2.43518 11.3696 -9999. 2.51255 11.5535 -9999. 2.59237 11.7404 -9999. 2.67598 11.9303 -9999. 2.76272 12.1232 -9999. 2.85227 12.3193 -9999. 2.94472 12.5186 -9999. 3.04017 12.7210 -9999. 3.14012 12.9268 -9999. 3.24361 13.1359 -9999. 3.35052 13.3483 -9999. 3.46095 13.5642 -9999. 3.57622 13.7836 -9999. 3.70512 14.0066 -9999. 3.83867 14.2331 -9999. 3.97703 14.4633 -9999. 4.12039 14.6973 -9999. 4.25838 14.9350 -9999. 4.38565 15.1765 -9999. 4.51673 15.4220 -9999. 4.65171 15.6714 -9999. 4.79073 15.9249 -9999. 4.93463 16.1825 -9999. 5.08974 16.4442 -9999. 5.24972 16.7102 -9999. 5.41472 16.9805 -9999. 5.58491 17.2551 -9999. 5.76046 17.5342 -9999. 5.94151 17.8178 -9999. 6.12826 18.1060 -9999. 6.29907 18.3989 -9999. 6.46564 18.6964 -9999. 6.63662 18.9988 -9999. 6.81211 19.3061 -9999. 6.97707 19.6184 -9999. 7.07637 19.9357 -9999. 7.17708 20.2582 -9999. 7.27922 20.5858 -9999. 7.38281 20.9188 -9999. 7.48788 21.2571 -9999. 7.59445 21.6009 -9999. 7.63348 21.9503 -9999. 7.66776 22.3053 -9999. 7.70219 22.6661 -9999. 7.73678 23.0327 -9999. 7.77151 23.4053 -9999. 7.76601 23.7838 -9999. 7.70976 24.1685 -9999. 7.65392 24.5594 -9999. 7.59849 24.9566 -9999. 7.53039 25.3603 -9999. 7.28378 25.7705 -9999. 7.04524 26.1873 -9999. 6.81452 26.6109 -9999. 6.56817 27.0413 -9999. 6.30065 27.4786 -9999. 6.04402 27.9231 -9999. 5.79784 28.3747 -9999. 5.57090 28.8337 -9999. 5.35297 29.3000 7.45980 5.14357 29.7739 7.36294 4.94237 30.2555 7.24678 4.74037 30.7449 7.08314 4.53441 31.2421 6.85861 4.33739 31.7475 6.53946 4.24252 32.2609 6.29668 4.22705 32.7827 6.07314 4.21164 33.3130 5.84367 4.20238 33.8518 5.61474 4.20700 34.3993 5.37524 4.21161 34.9557 5.10146 4.21624 35.5211 4.80331 4.28453 36.0956 4.51157 4.36092 36.6794 4.19978 4.43867 37.2727 3.83503 4.51781 37.8755 3.36519 4.63632 38.4882 2.75414 4.79723 39.1107 2.13477 5.41405 39.7432 1.69354 6.11019 40.3861 1.38324 6.89584 41.0393 1.22726 7.78251 41.7031 1.34224 8.78319 42.3776 1.59985 9.45488 43.0630 1.85372 10.1729 43.7595 2.28214 10.9454 44.4673 3.01143 11.4042 45.1865 3.50293 11.6465 45.9174 3.89620 11.8940 46.6600 4.29832 12.1467 47.4147 4.74159 12.2778 48.1816 5.05566 12.3389 48.9609 5.22197 12.3364 49.7528 5.26170 12.5160 50.5576 5.31147 12.7507 51.3753 5.20956 13.0680 52.2062 5.31433 13.8097 53.0506 5.64480 14.5261 53.9087 6.25013 15.1355 54.7806 6.83899 15.6271 55.6667 7.50407 16.1347 56.5670 8.29623 16.4858 57.4820 9.41298 16.7915 58.4117 10.2776 16.7223 59.3564 11.0242 16.6439 60.3165 11.7455 16.5603 61.2921 12.4985 16.4772 62.2834 13.3278 16.2475 63.2908 14.0455 15.9197 64.3145 14.7858 15.5411 65.3547 15.4539 15.0453 66.4118 16.0988 14.3684 67.4859 16.4551 13.5908 68.5775 16.5875 12.8554 69.6867 16.6272 12.3754 70.8138 16.7019 11.9348 71.9591 16.7789 11.5100 73.1230 16.8356 11.1003 74.3057 16.8700 10.7051 75.5076 16.8811 10.3240 76.7289 16.8676 9.95654 77.9699 16.8241 9.60382 79.2310 16.7642 9.28503 80.5125 16.6924 8.97680 81.8147 16.6041 8.67882 83.1380 16.4953 8.39071 84.4827 16.3626 8.11219 85.8491 16.1946 7.84291 87.2377 15.9457 7.62633 88.6487 15.7402 7.48414 90.0825 15.5550 7.34460 91.5395 15.3607 7.20767 93.0201 15.1389 7.07328 94.5246 14.8493 6.99964 96.0535 14.6210 7.00289 97.6071 14.4195 7.00615 99.1858 14.2247 7.00940 100.790 14.0204 7.01266 102.420 13.7606 7.03196 104.077 13.5319 7.15594 105.760 13.3488 7.28210 107.471 13.1840 7.41049 109.209 13.0257 7.54114 110.975 12.8519 7.69441 112.770 12.7141 7.88463 114.594 12.6012 8.07956 116.448 12.5065 8.27930 118.331 12.4288 8.48398 120.245 12.3724 8.69373 122.190 12.3276 8.89018 124.166 12.2861 9.08942 126.175 12.2514 9.29313 128.215 12.2247 9.50141 130.289 12.2067 9.71434 132.397 12.1982 9.93206 134.538 12.2004 10.1547 136.714 12.2159 10.3822 138.925 12.2541 10.6054 141.172 12.2903 10.8169 143.456 12.3301 11.0325 145.776 12.3779 11.2525 148.134 12.4386 11.4769 150.530 12.5335 11.7058 152.964 12.6324 11.8759 155.439 12.7057 12.0404 157.953 12.7661 12.2072 160.507 12.8162 12.3763 163.103 12.8500 12.5478 165.742 12.8618 12.7545 168.422 12.8971 12.9888 171.146 12.9518 13.2273 173.915 13.0169 13.4703 176.727 13.0923 13.7177 179.586 13.1791 13.9696 182.491 13.2894 14.2222 185.442 13.3994 14.4535 188.442 13.5046 14.6886 191.489 13.6115 14.9274 194.587 13.7213 15.1702 197.734 13.8349 15.4169 200.932 13.9524 15.6676 204.182 14.0739 15.9224 207.485 14.1973 16.1813 210.840 14.3239 16.4521 214.251 14.4627 16.7324 217.716 14.6124 17.0174 221.237 14.7723 17.3074 224.816 14.9433 17.6022 228.452 15.1261 17.9021 232.147 15.3222 18.2071 235.902 15.5338 18.5173 239.717 15.7648 18.8328 243.595 16.0435 19.1445 247.535 16.3183 19.4092 251.538 16.5826 19.6775 255.607 16.8515 19.9496 259.741 17.1292 20.2255 263.942 17.4196 20.5051 268.211 17.7270 20.7886 272.549 18.0584 21.0761 276.957 18.4741 21.3438 281.437 18.8598 21.5149 285.989 19.2050 21.6874 290.615 19.5405 21.8613 295.315 19.8713 22.0366 300.092 20.2016 22.2133 304.945 20.5331 22.3878 309.878 20.8646 22.5621 314.890 21.1978 22.7378 319.983 21.5352 22.9148 325.158 21.8786 23.0932 330.418 22.2308 23.2730 335.762 22.5968 23.4542 341.192 22.9968 23.6302 346.711 23.3874 23.7522 352.319 23.7643 23.8750 358.017 24.1353 23.9983 363.808 24.5065 24.1223 369.692 24.8812 24.2469 375.672 25.2628 24.3722 381.748 25.6680 24.4981 387.922 26.0957 24.5830 394.197 26.4900 24.6296 400.573 26.8605 24.6763 407.052 27.2136 24.7231 413.635 27.5410 24.7700 420.326 27.8423 24.8657 427.124 28.1745 24.9964 434.032 28.5410 25.1279 441.052 28.9352 25.2600 448.186 29.3532 25.3572 455.435 29.7620 25.4347 462.802 30.1624 25.5126 470.287 30.5653 25.5906 477.894 30.9729 25.6689 485.623 31.3875 25.7475 493.478 31.8115 25.8262 501.459 32.2480 25.9052 509.570 32.7016 25.9845 517.812 33.1808 26.0640 526.187 33.7056 26.1437 534.698 34.3880 26.2237 543.346 34.9114 25.9053 552.134 35.3291 25.7609 561.065 35.7132 25.5951 570.139 35.9858 25.4415 579.361 36.2664 25.4409 588.732 36.5881 25.4819 598.254 36.9733 25.5498 607.930 37.4087 25.6176 617.763 37.8968 25.6857 627.755 38.4785 25.7451 637.908 39.1403 25.6942 648.226 39.8137 25.4805 658.711 40.3530 25.1622 669.365 40.7949 24.8477 680.191 41.1718 24.5812 691.193 41.5404 24.3515 702.372 41.9310 24.1329 713.733 42.3223 23.8872 725.277 42.6855 23.6240 737.008 43.0276 23.3636 748.928 43.3557 23.1059 761.042 43.6744 22.8507 773.351 43.9889 22.5938 785.859 44.2960 22.3246 798.570 44.5807 22.0462 811.486 44.8478 21.7710 824.611 45.1015 21.4993 837.949 45.3451 21.2309 851.502 45.5792 20.9625 865.274 45.8035 20.6942 879.269 46.0157 20.4264 893.491 46.2176 20.1617 907.943 46.4114 19.9003 922.628 46.6017 19.6421 937.551 46.7830 19.3751 952.715 46.9532 19.1085 968.124 47.1112 18.8430 983.783 47.2604 18.5809 999.695 47.4039 18.3197 1015.86 47.5462 18.0594 1032.29 47.6742 17.7795 1048.99 47.7849 17.5004 1065.96 47.8771 17.2218 1083.20 47.9538 16.9475 1100.72 48.0169 16.6773 1118.52 48.0672 16.4113 1136.61 48.1051 16.1493 1155. 48.1309 15.8912 1173.68 48.1447 15.6368 1192.66 48.1467 15.3864 1211.95 48.1376 15.1398 1231.55 48.1191 14.8966 1251.47 48.0902 14.6505 1271.72 48.0481 14.4009 1292.29 47.9828 14.1463 1313.19 47.8951 13.8959 1334.43 47.7866 13.6500 1356.01 47.6571 13.4082 1377.94 47.5057 13.1704 1400.23 47.3311 12.9364 1422.88 47.1310 12.7062 1445.89 46.9034 12.4800 1469.28 46.6460 12.2575 1493.04 46.3552 12.0384 1517.19 46.0262 11.8219 1541.73 45.6534 11.6088 1566.67 45.2301 11.3992 1592.01 44.7479 11.1931 1617.76 44.1959 10.9908 1643.92 43.5597 10.7923 1670.51 42.8192 10.5969 1697.53 41.9453 10.4048 1724.99 40.8978 10.2160 1752.89 39.6055 10.0254 1781.24 37.9487 9.83648 1810.05 35.6943 9.64957 1839.32 32.2559 9.46627 1869.07 24.8946 9.28645 1882.80 -4.11723 9.20558 1883. -4.11373 27.5469 1899.30 24.9187 27.1608 1930.02 27.7689 26.4565 1948.80 9.56707 26.0404 1949. 9.60336 38.6032 1961.24 29.6735 38.2684 1992.96 37.1125 37.4235 2025.20 41.0748 36.6057 2057.95 43.8955 35.7970 2091.24 46.0814 35.0057 2125.06 47.8452 34.2322 2159.43 49.2941 33.4759 2194.36 50.4846 32.7360 2229.85 51.4402 32.0125 2265.92 52.1516 31.3054 2302.57 52.5422 30.6139 2339.81 52.2342 29.9379 2367.20 44.7619 29.4570 2367.40 44.7808 34.3317 2377.66 51.7677 34.1010 2416.11 54.9882 33.2582 2455.19 56.6051 32.4363 2494.90 57.7790 31.6363 2535.26 58.6950 30.8552 2576.26 59.4071 30.0946 2617.93 59.9011 29.3531 2660.27 59.9434 28.6306 2681.50 57.4114 28.2793 2681.70 57.4246 30.1472 2703.30 60.5813 29.7953 2747.03 61.7713 29.1041 2791.46 62.5421 28.4292 2836.61 63.1215 27.7712 2882.49 63.5096 27.1290 2929.11 62.9627 26.5027 2931.60 61.8486 26.4700 2931.80 61.8568 27.6198 2976.48 64.5461 27.0504 3024.63 65.2865 26.4593 3073.55 65.8790 25.8763 3123.26 66.3935 25.3044 3173.78 66.8538 24.7425 3225.11 67.2722 24.1914 3277.27 67.6541 23.6489 3330.28 68.0051 23.1180 3384.15 68.3296 22.5964 3438.88 68.6285 22.0841 3494.50 68.9050 21.5827 3551.02 69.1612 21.0906 3608.46 69.3980 20.6082 3666.82 69.6173 20.1354 3726.13 69.8199 19.6716 3786.40 70.0072 19.2179 3847.64 70.1797 18.7726 3909.87 70.3391 18.3379 3973.11 70.4860 17.9106 4037.38 70.6205 17.4931 4102.68 70.7441 17.0842 4169.03 70.8571 16.6839 4236.46 70.9601 16.2921 4304.98 71.0537 15.9084 4374.62 71.1382 15.5331 4445.37 71.2143 15.1656 4517.27 71.2821 14.8061 4590.33 71.3423 14.4545 4664.58 71.3952 14.1105 4740.03 71.4411 13.7739 4816.69 71.4804 13.4449 4894.60 71.5135 13.1231 4973.77 71.5404 12.8082 5054.21 71.5615 12.5005 5135.96 71.5772 12.1997 5219.03 71.5876 11.9055 5303.44 71.5928 11.6179 5389.22 71.5931 11.3369 5476.39 71.5889 11.0623 5564.97 71.5800 10.7938 5654.98 71.5668 10.5317 5746.44 71.5494 10.2753 5839.39 71.5278 10.0249 5933.83 71.5022 9.78027 6029.81 71.4726 9.54130 6127.33 71.4392 9.30781 6226.44 71.4020 9.07985 6327.15 71.3611 8.85715 6429.48 71.3164 8.63970 6533.48 71.2680 8.42721 6639.15 71.2159 8.21985 6746.54 71.1601 8.01723 6855.65 71.1003 7.81951 6966.54 71.0368 7.62649 7079.22 70.9692 7.43771 7193.72 70.8973 7.25378 7310.07 70.8213 7.07410 7428.31 70.7407 6.89862 7548.45 70.6552 6.72730 7670.54 70.5646 6.56016 7794.61 70.4685 6.39686 7920.68 70.3662 6.23731 8048.79 70.2573 6.08181 8178.98 70.1411 5.93007 8311.26 70.0169 5.78176 8445.69 69.8834 5.63701 8582.29 69.7394 5.49584 8721.11 69.5833 5.35806 8862.16 69.4132 5.22357 9005.50 69.2262 5.09239 9151.16 69.0189 4.96399 9299.17 68.7863 4.83903 9449.58 68.5217 4.71695 9602.42 68.2149 4.59788 9757.73 67.8499 4.48159 9915.55 67.3984 4.36798 10075.9 66.8090 4.26243 10238.9 65.9610 4.15988 10404.5 64.3927 4.06024 10535.2 50.4485 3.98438 10535.4 50.4491 10.1214 10572.8 62.0723 10.0561 10743.8 65.4465 9.76527 10917.6 66.5624 9.48290 11094.2 67.1677 9.20870 11273.6 67.5007 8.94242 11455.9 67.6198 8.68385 11641.2 67.4915 8.43276 11829.5 66.8576 8.18892 11958.6 59.8386 8.02801 11958.8 59.8398 11.2380 12020.8 66.3192 11.1407 12215.3 67.8397 10.8442 12412.8 68.2098 10.5556 12526.6 65.3210 10.3949 12526.8 65.3216 11.8411 12613.6 68.6737 11.7233 12817.6 69.6977 11.4540 13025.0 70.3371 11.1890 13235.6 70.8356 10.9283 13449.7 71.2506 10.6719 13667.2 71.6073 10.4198 13888.3 71.9197 10.1722 14112.9 72.1967 9.92895 14341.2 72.4443 9.69017 14573.1 72.6673 9.45581 14808.9 72.8688 9.22590 15048.4 73.0516 9.00041 15291.8 73.2178 8.77935 15539.1 73.3692 8.56267 15790.4 73.5074 8.35037 16045.8 73.6335 8.14240 16305.4 73.7487 7.93875 16569.1 73.8539 7.73937 16837.1 73.9499 7.54422 17109.4 74.0374 7.35326 17386.1 74.1172 7.16645 17667.4 74.1899 6.98372 17953.1 74.2558 6.80505 18243.5 74.3156 6.63036 18538.6 74.3696 6.45962 18838.4 74.4183 6.29275 19143.1 74.4620 6.12971 19452.7 74.5011 5.97044 19767.4 74.5358 5.81487 20087.1 74.5665 5.66295 20412.0 74.5934 5.51461 20742.1 74.6168 5.36980 21077.6 74.6368 5.22844 21418.5 74.6538 5.09049 21765.0 74.6679 4.95587 22117.0 74.6793 4.82453 22474.7 74.6881 4.69641 22838.2 74.6946 4.57142 23207.6 74.6988 4.44953 23583.0 74.7010 4.33067 23964.4 74.7012 4.21477 24352.0 74.6996 4.10177 24745.9 74.6963 3.99161 25146.2 74.6915 3.88424 25552.9 74.6851 3.77959 25966.2 74.6773 3.67761 26386.1 74.6682 3.57823 26812.9 74.6580 3.48141 27246.6 74.6465 3.38707 27687.3 74.6341 3.29517 28135.1 74.6207 3.20565 28590.2 74.6065 3.11845 29052.6 74.5919 3.03353 29522.5 74.5843 2.95083 30000.0 74.5337 2.87030 periodictable-1.5.0/periodictable/xsf/read.me000066400000000000000000000056151310514471200211740ustar00rootroot00000000000000 Low-Energy X-ray Interaction Coefficients: Photoabsorption, Scattering, and Reflection E = 30-30,000 eV, Z = 1-92 B. L. Henke, E. M. Gullikson, and J. C. Davis Center for X-Ray Optics, 2-400 Lawrence Berkeley Laboratory Berkeley, California 94720 These files were used to generate the tables published in reference [1]. The files contain three columns of data: Energy(eV), f_1, f_2, where f_1 and f_2 are the atomic (forward) scattering factors. There are 500+ points on a uniform logarithmic mesh with points added 0.1 eV above and below "sharp" absorption edges. (Note: below 29 eV f_1 is set equal to -9999.) The tabulated values of f_1 contain a relativistic, energy independent, correction given by, Z* = Z - (Z/82.5)^(2.37). The atomic photoabsorption cross section, mu_a, may be readily obtained from the values of f_2 using the relation, mu_a = 2*r_0*lambda*f_2 where r_0 is the classical electron radius, and lambda is the wavelength. The index of refraction for a material with N atoms per unit volume is calculated by, n = 1 - N*r_0*(lambda)^2*(f_1+if_2)/(2*pi). These (semi-empirical) atomic scattering factors are based upon photoabsorption measurements of elements in their elemental state. The basic assumption is that condensed matter may be modeled as a collection of non-interacting atoms. This assumption is in general a good one for energies sufficiently far from absorption thresholds. In the threshold regions, the specific chemical state is important and direct experimental measurements must be made. These tables are based on a compilation of the available experimental measurements and theoretical calculations. For many elements there is little or no published data and in such cases it was necessary to rely on theoretical calculations and interpolations across Z. In order to improve the accuracy in the future considerably more experimental measurements are needed. Please send any comments to EMGullikson@lbl.gov. Note that the following elements have been updated since the publication of Ref. [1] in July 1993. Check http://henke.lbl.gov/optical_constants/update.html for more recent updates. ======== ========== ================= Element Updated Energy Range (eV) ======== ========== ================= Mg Jan 2011 10-1300 Zr Apr 2010 20-1000 La Jun 2007 14-440 Gd Jun 2007 12-450 Sc Apr 2006 50-1300 Ti Aug 2004 20-150 Ru Aug 2004 40-1300 W Aug 2004 35-250 Mo Aug 2004 25-60 Be Aug 2004 40-250 Mo Nov 1997 10-930 Fe Oct 1995 600-800 Si Jun 1995 30-500 Au Jul 1994 2000-6500 Mg,Al,Si Jan 1994 30-200 Li Nov 1994 2000-30000 ======== ========== ================= [1] B. L. Henke, E. M. Gullikson, and J. C. Davis, Atomic Data and Nuclear Data Tables Vol. 54 No. 2 (July 1993). periodictable-1.5.0/periodictable/xsf/rh.nff000066400000000000000000000315611310514471200210410ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.17537 10.1617 -9999. 1.24044 10.3261 -9999. 1.30912 10.4931 -9999. 1.38160 10.6628 -9999. 1.45810 10.8353 -9999. 1.53883 11.0106 -9999. 1.62403 11.1886 -9999. 1.71394 11.3696 -9999. 1.80884 11.5535 -9999. 1.90899 11.7404 -9999. 2.00042 11.9303 -9999. 2.09375 12.1232 -9999. 2.19144 12.3193 -9999. 2.29369 12.5186 -9999. 2.40070 12.7210 -9999. 2.51271 12.9268 -9999. 2.62995 13.1359 -9999. 2.75265 13.3483 -9999. 2.88108 13.5642 -9999. 3.01551 13.7836 -9999. 3.15235 14.0066 -9999. 3.28289 14.2331 -9999. 3.41884 14.4633 -9999. 3.56042 14.6973 -9999. 3.70786 14.9350 -9999. 3.86141 15.1765 -9999. 4.02132 15.4220 -9999. 4.18785 15.6714 -9999. 4.36127 15.9249 -9999. 4.52458 16.1825 -9999. 4.66392 16.4442 -9999. 4.80756 16.7102 -9999. 4.95562 16.9805 -9999. 5.10824 17.2551 -9999. 5.26556 17.5342 -9999. 5.42772 17.8178 -9999. 5.59488 18.1060 -9999. 5.76719 18.3989 -9999. 5.94481 18.6964 -9999. 6.12789 18.9988 -9999. 6.31661 19.3061 -9999. 6.49918 19.6184 -9999. 6.66358 19.9357 -9999. 6.83213 20.2582 -9999. 7.00494 20.5858 -9999. 7.18213 20.9188 -9999. 7.36379 21.2571 -9999. 7.55005 21.6009 -9999. 7.74103 21.9503 -9999. 7.93683 22.3053 -9999. 8.09281 22.6661 -9999. 8.23857 23.0327 -9999. 8.38711 23.4053 -9999. 8.53836 23.7838 -9999. 8.69235 24.1685 -9999. 8.84910 24.5594 -9999. 9.00869 24.9566 -9999. 9.17115 25.3603 -9999. 9.28547 25.7705 -9999. 9.35804 26.1873 -9999. 9.43118 26.6109 -9999. 9.50487 27.0413 -9999. 9.52837 27.4786 -9999. 9.51188 27.9231 -9999. 9.49541 28.3747 -9999. 9.47898 28.8337 -9999. 9.46258 29.3000 4.70534 9.41310 29.7739 4.90676 9.35740 30.2555 5.09755 9.30204 30.7449 5.28621 9.24700 31.2421 5.48290 9.19228 31.7475 5.71977 9.13789 32.2609 5.94722 8.93847 32.7827 6.09107 8.73686 33.3130 6.18463 8.53981 33.8518 6.24108 8.34719 34.3993 6.25941 8.15893 34.9557 6.22758 7.99834 35.5211 6.19669 7.86634 36.0956 6.15184 7.73651 36.6794 6.08461 7.60883 37.2727 5.98379 7.48325 37.8755 5.84548 7.38742 38.4882 5.68807 7.30257 39.1107 5.47854 7.21869 39.7432 5.20762 7.23081 40.3861 4.96732 7.28432 41.0393 4.68621 7.33823 41.7031 4.33155 7.51913 42.3776 4.04527 7.77047 43.0630 3.73775 8.03370 43.7595 3.46975 8.49636 44.4673 3.30893 8.98568 45.1865 3.23882 9.50317 45.9174 3.22355 9.96912 46.6600 3.22567 10.4563 47.4147 3.25853 10.9673 48.1816 3.33232 11.5033 48.9609 3.45444 12.0655 49.7528 3.64368 12.6551 50.5576 3.93160 13.2250 51.3753 4.23391 13.7757 52.2062 4.58169 14.3492 53.0506 5.02262 14.9467 53.9087 5.65139 15.5181 54.7806 6.26532 15.8599 55.6667 6.83131 16.2092 56.5670 7.41151 16.5663 57.4820 8.03415 16.9311 58.4117 8.75145 17.3041 59.3564 9.59027 17.5205 60.3165 10.3563 17.6548 61.2921 11.1122 17.7902 62.2834 11.9314 17.9266 63.2908 12.9363 18.0641 64.3145 13.9383 17.7449 65.3547 14.7331 17.3938 66.4118 15.4356 17.0496 67.4859 16.0881 16.7123 68.5775 16.7147 16.3816 69.6867 17.3417 16.0575 70.8138 18.0070 15.6833 71.9591 18.6141 15.2606 73.1230 19.2168 14.8493 74.3057 19.8821 14.4490 75.5076 20.8097 13.8376 76.7289 21.3726 12.8289 77.9699 21.6948 11.8937 79.2310 21.8777 11.0267 80.5125 21.9707 10.2228 81.8147 21.9994 9.47763 83.1380 21.9867 8.78672 84.4827 21.9557 8.11257 85.8491 21.8537 7.46249 87.2377 21.7029 6.86448 88.6487 21.5223 6.31442 90.0825 21.3191 5.80840 91.5395 21.0980 5.34296 93.0201 20.8618 4.91481 94.5246 20.6069 4.52097 96.0535 20.3512 4.18740 97.6071 20.1050 3.87926 99.1858 19.8643 3.59380 100.790 19.6264 3.32935 102.420 19.3919 3.08435 104.077 19.1643 2.85738 105.760 18.9469 2.62759 107.471 18.7094 2.40272 109.209 18.4583 2.19710 110.975 18.1987 2.00908 112.770 17.9230 1.83715 114.594 17.6442 1.71000 116.448 17.3783 1.59796 118.331 17.1048 1.49325 120.245 16.8137 1.43689 122.190 16.5569 1.41034 124.166 16.3114 1.38428 126.175 16.0806 1.39160 128.215 15.8707 1.39953 130.289 15.6696 1.40751 132.397 15.4605 1.42143 134.538 15.2679 1.46169 136.714 15.0927 1.50309 138.925 14.9268 1.54566 141.172 14.7674 1.58944 143.456 14.6112 1.63446 145.776 14.4476 1.68696 148.134 14.2973 1.75697 150.530 14.1595 1.82989 152.964 14.0298 1.90583 155.439 13.9078 1.98492 157.953 13.7945 2.06556 160.507 13.6854 2.14647 163.103 13.5814 2.23055 165.742 13.4830 2.31793 168.422 13.3912 2.40873 171.146 13.3072 2.50309 173.915 13.2340 2.60114 176.727 13.1881 2.70303 179.586 13.1431 2.76147 182.491 13.0837 2.81991 185.442 13.0190 2.87959 188.442 12.9519 2.94053 191.489 12.8835 3.00276 194.587 12.8147 3.06631 197.734 12.7467 3.13120 200.932 12.6841 3.19331 204.182 12.6161 3.24985 207.485 12.5434 3.30739 210.840 12.4684 3.36595 214.251 12.3917 3.42555 217.716 12.3140 3.48620 221.237 12.2367 3.54793 224.816 12.1661 3.61075 228.452 12.0911 3.65164 232.147 12.0053 3.69210 235.902 11.9121 3.73301 239.717 11.8207 3.77438 243.595 11.7185 3.78814 247.535 11.5944 3.79930 251.538 11.4492 3.81049 255.607 11.2864 3.82461 259.741 11.1086 3.84037 263.942 10.9182 3.85619 268.211 10.7022 3.85408 272.549 10.4528 3.85196 276.957 10.1665 3.84985 281.437 9.83651 3.84774 285.989 9.44174 3.86052 290.615 9.00533 3.89716 295.315 8.51429 3.94893 300.092 7.94682 4.00866 304.945 7.24429 4.11110 309.878 6.40671 4.27135 314.890 5.36277 4.63441 319.983 4.24320 5.34224 325.158 3.04666 6.31104 330.418 2.21694 8.05634 335.762 1.85085 9.54134 341.192 1.69962 11.1689 346.711 1.73459 12.7512 352.319 2.17710 14.4137 358.017 2.80549 15.8486 363.808 3.74771 17.0674 369.692 4.59280 17.9578 375.672 5.43720 18.7673 381.748 6.35355 19.4919 387.922 7.17439 19.9322 394.197 7.83964 20.3823 400.573 8.47001 20.8930 407.052 9.12111 21.4226 413.635 9.81859 21.9657 420.326 10.6382 22.4405 427.124 11.4240 22.8025 434.032 12.2421 23.1160 441.052 12.9902 23.3204 448.186 13.6668 23.5265 455.435 14.3250 23.7329 462.802 14.9671 23.9349 470.287 15.6012 24.1385 477.894 16.2286 24.3440 485.623 16.8630 24.5677 493.478 17.5299 24.8033 501.459 18.2364 25.0412 509.570 19.1154 25.2814 517.812 19.9685 25.2284 526.187 20.6976 25.1592 534.698 21.3753 25.0903 543.346 22.0410 25.0159 552.134 22.6711 24.9115 561.065 23.2599 24.7988 570.139 23.7926 24.6911 579.361 24.3221 24.6442 588.732 24.8650 24.6133 598.254 25.4331 24.5928 607.930 26.0274 24.5733 617.763 26.6579 24.5531 627.755 27.3664 24.5237 637.908 28.1409 24.3859 648.226 28.9159 24.0889 658.711 29.5498 23.6912 669.365 30.0802 23.2991 680.191 30.5409 22.9575 691.193 30.9912 22.6541 702.372 31.4645 22.3598 713.733 31.9351 22.0278 725.277 32.3631 21.6724 737.008 32.7591 21.3222 748.928 33.1330 20.9779 761.042 33.4909 20.6390 773.351 33.8377 20.3015 785.859 34.1717 19.9576 798.570 34.4820 19.6096 811.486 34.7728 19.2675 824.611 35.0485 18.9313 837.949 35.3126 18.6011 851.502 35.5660 18.2730 865.274 35.8083 17.9466 879.269 36.0367 17.6226 893.491 36.2535 17.3044 907.943 36.4614 16.9919 922.628 36.6651 16.6850 937.551 36.8595 16.3720 952.715 37.0427 16.0618 968.124 37.2136 15.7549 983.783 37.3754 15.4539 999.695 37.5307 15.1573 1015.86 37.6826 14.8649 1032.29 37.8247 14.5653 1048.99 37.9555 14.2689 1065.96 38.0737 13.9758 1083.20 38.1816 13.6886 1100.72 38.2809 13.4074 1118.52 38.3724 13.1320 1136.61 38.4569 12.8622 1155. 38.5347 12.5980 1173.68 38.6064 12.3392 1192.66 38.6722 12.0857 1211.95 38.7326 11.8374 1231.55 38.7876 11.5943 1251.47 38.8376 11.3564 1271.72 38.8829 11.1238 1292.29 38.9244 10.8965 1313.19 38.9621 10.6737 1334.43 38.9960 10.4556 1356.01 39.0265 10.2420 1377.94 39.0538 10.0325 1400.23 39.0779 9.82741 1422.88 39.0993 9.62653 1445.89 39.1187 9.42979 1469.28 39.1373 9.23574 1493.04 39.1557 9.04366 1517.19 39.1686 8.84678 1541.73 39.1742 8.65307 1566.67 39.1737 8.46373 1592.01 39.1687 8.27858 1617.76 39.1597 8.09740 1643.92 39.1468 7.92001 1670.51 39.1303 7.74668 1697.53 39.1105 7.57712 1724.99 39.0898 7.41119 1752.89 39.0654 7.24435 1781.24 39.0353 7.07977 1810.05 38.9998 6.91787 1839.32 38.9589 6.75946 1869.07 38.9131 6.60472 1899.30 38.8627 6.45372 1930.02 38.8079 6.30611 1961.24 38.7484 6.16183 1992.96 38.6833 6.02076 2025.20 38.6169 5.88555 2057.95 38.5457 5.74787 2091.24 38.4669 5.61290 2125.06 38.3815 5.48022 2159.43 38.2888 5.34989 2194.36 38.1884 5.22230 2229.85 38.0799 5.09695 2265.92 37.9622 4.97401 2302.57 37.8346 4.85347 2339.81 37.6958 4.73513 2377.66 37.5444 4.61907 2416.11 37.3788 4.50526 2455.19 37.1970 4.39365 2494.90 36.9962 4.28412 2535.26 36.7732 4.17669 2576.26 36.5237 4.07135 2617.93 36.2419 3.96804 2660.27 35.9202 3.86678 2703.30 35.5474 3.76736 2747.03 35.1074 3.66990 2791.46 34.5743 3.57434 2836.61 33.9039 3.48060 2882.49 33.0094 3.38869 2929.11 31.6760 3.29847 2976.48 28.9958 3.21011 3003.70 14.7330 3.16103 3003.90 14.7337 11.1098 3024.63 28.1608 10.9941 3073.55 30.7488 10.7290 3123.26 30.8088 10.4714 3146. 24.6198 10.3570 3146.20 24.6245 14.2279 3173.78 32.0599 14.0392 3225.11 34.0375 13.6990 3277.27 35.1250 13.3669 3330.28 35.7872 13.0426 3384.15 35.9073 12.7262 3411.80 32.7294 12.5687 3412. 32.7321 14.5451 3438.88 36.5794 14.3814 3494.50 37.8695 14.0524 3551.02 38.7086 13.7287 3608.46 39.3773 13.4097 3666.82 39.9425 13.0962 3726.13 40.4344 12.7884 3786.40 40.8701 12.4860 3847.64 41.2600 12.1887 3909.87 41.6115 11.8969 3973.11 41.9299 11.6099 4037.38 42.2195 11.3291 4102.68 42.4845 11.0535 4169.03 42.7267 10.7828 4236.46 42.9489 10.5180 4304.98 43.1532 10.2582 4374.62 43.3409 10.0037 4445.37 43.5136 9.75445 4517.27 43.6726 9.51041 4590.33 43.8190 9.27164 4664.58 43.9538 9.03778 4740.03 44.0778 8.80902 4816.69 44.1918 8.58531 4894.60 44.2966 8.36644 4973.77 44.3929 8.15253 5054.21 44.4811 7.94330 5135.96 44.5619 7.73887 5219.03 44.6357 7.53908 5303.44 44.7030 7.34400 5389.22 44.7644 7.15330 5476.39 44.8200 6.96707 5564.97 44.8703 6.78518 5654.98 44.9156 6.60763 5746.44 44.9563 6.43436 5839.39 44.9926 6.26516 5933.83 45.0248 6.10007 6029.81 45.0532 5.93892 6127.33 45.0779 5.78179 6226.44 45.0993 5.62841 6327.15 45.1175 5.47883 6429.48 45.1328 5.33298 6533.48 45.1452 5.19070 6639.15 45.1551 5.05201 6746.54 45.1625 4.91679 6855.65 45.1676 4.78490 6966.54 45.1705 4.65638 7079.22 45.1714 4.53119 7193.72 45.1704 4.40910 7310.07 45.1677 4.29011 7428.31 45.1632 4.17426 7548.45 45.1573 4.06138 7670.54 45.1499 3.95138 7794.61 45.1412 3.84422 7920.68 45.1311 3.73970 8048.79 45.1198 3.63812 8178.98 45.1075 3.53903 8311.26 45.0941 3.44265 8445.69 45.0797 3.34870 8582.29 45.0644 3.25735 8721.11 45.0484 3.16834 8862.16 45.0316 3.08161 9005.50 45.0140 2.99718 9151.16 44.9956 2.91501 9299.17 44.9766 2.83505 9449.58 44.9571 2.75725 9602.42 44.9370 2.68147 9757.73 44.9163 2.60772 9915.55 44.8952 2.53606 10075.9 44.8737 2.46622 10238.9 44.8517 2.39825 10404.5 44.8293 2.33211 10572.8 44.8065 2.26775 10743.8 44.7833 2.20513 10917.6 44.7598 2.14420 11094.2 44.7360 2.08492 11273.6 44.7118 2.02724 11455.9 44.6873 1.97112 11641.2 44.6625 1.91653 11829.5 44.6374 1.86342 12020.8 44.6120 1.81175 12215.3 44.5864 1.76149 12412.8 44.5604 1.71260 12613.6 44.5340 1.66504 12817.6 44.5074 1.61878 13025.0 44.4805 1.57378 13235.6 44.4531 1.53001 13449.7 44.4254 1.48744 13667.2 44.3974 1.44603 13888.3 44.3689 1.40575 14112.9 44.3399 1.36658 14341.2 44.3104 1.32848 14573.1 44.2804 1.29142 14808.9 44.2498 1.25539 15048.4 44.2186 1.22033 15291.8 44.1866 1.18624 15539.1 44.1539 1.15309 15790.4 44.1202 1.12085 16045.8 44.0856 1.08949 16305.4 44.0499 1.05899 16569.1 44.0129 1.02933 16837.1 43.9746 1.00048 17109.4 43.9347 0.972425 17386.1 43.8930 0.945141 17667.4 43.8492 0.918606 17953.1 43.8031 0.892800 18243.5 43.7543 0.867702 18538.6 43.7023 0.843293 18838.4 43.6466 0.819554 19143.1 43.5864 0.796466 19452.7 43.5210 0.774012 19767.4 43.4491 0.752173 20087.1 43.3692 0.730933 20412.0 43.2792 0.710275 20742.1 43.1763 0.690183 21077.6 43.0559 0.670641 21418.5 42.9113 0.651635 21765.0 42.7309 0.633147 22117.0 42.4931 0.615166 22474.7 42.1488 0.597677 22838.2 41.5423 0.580664 23207.6 38.2348 0.564117 23219.8 33.4904 0.563583 23220.0 33.4905 3.66324 23583.0 41.6618 3.57592 23964.4 42.4200 3.48779 24352.0 42.8696 3.40131 24745.9 43.1911 3.31648 25146.2 43.4411 3.23330 25552.9 43.6448 3.15178 25966.2 43.8158 3.07189 26386.1 43.9624 2.99363 26812.9 44.0899 2.91700 27246.6 44.2020 2.84197 27687.3 44.3015 2.76854 28135.1 44.3903 2.69669 28590.2 44.4701 2.62640 29052.6 44.5424 2.55767 29522.5 44.6144 2.49046 30000.0 44.6452 2.42477 periodictable-1.5.0/periodictable/xsf/rn.nff000066400000000000000000000321231310514471200210420ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.83964 10.1617 -9999. 3.21791 10.3261 -9999. 3.64656 10.4931 -9999. 4.05083 10.6628 -9999. 4.42880 10.8353 -9999. 4.83437 11.0106 -9999. 5.24445 11.1886 -9999. 5.68932 11.3696 -9999. 6.15277 11.5535 -9999. 6.62072 11.7404 -9999. 7.12424 11.9303 -9999. 7.66606 12.1232 -9999. 8.11012 12.3193 -9999. 8.55317 12.5186 -9999. 9.02044 12.7210 -9999. 9.51322 12.9268 -9999. 9.95229 13.1359 -9999. 10.2962 13.3483 -9999. 10.6520 13.5642 -9999. 11.0201 13.7836 -9999. 11.2657 14.0066 -9999. 11.5131 14.2331 -9999. 11.7660 14.4633 -9999. 12.0243 14.6973 -9999. 12.1707 14.9350 -9999. 12.3154 15.1765 -9999. 12.4618 15.4220 -9999. 12.5727 15.6714 -9999. 12.6219 15.9249 -9999. 12.6713 16.1825 -9999. 12.7208 16.4442 -9999. 12.6598 16.7102 -9999. 12.5958 16.9805 -9999. 12.5321 17.2551 -9999. 12.3059 17.5342 -9999. 12.0486 17.8178 -9999. 11.7966 18.1060 -9999. 11.6013 18.3989 -9999. 11.4664 18.6964 -9999. 11.3331 18.9988 -9999. 11.2014 19.3061 -9999. 11.0386 19.6184 -9999. 10.7611 19.9357 -9999. 10.4905 20.2582 -9999. 10.2267 20.5858 -9999. 9.96957 20.9188 -9999. 9.76665 21.2571 -9999. 9.56995 21.6009 -9999. 9.37722 21.9503 -9999. 9.18836 22.3053 -9999. 9.00331 22.6661 -9999. 8.82199 23.0327 -9999. 8.64433 23.4053 -9999. 8.45422 23.7838 -9999. 8.26705 24.1685 -9999. 8.08401 24.5594 -9999. 7.90503 24.9566 -9999. 7.62325 25.3603 -9999. 7.30120 25.7705 -9999. 6.99277 26.1873 -9999. 6.69736 26.6109 -9999. 6.45507 27.0413 -9999. 6.26164 27.4786 -9999. 6.07400 27.9231 -9999. 5.89200 28.3747 -9999. 5.71544 28.8337 -9999. 5.52859 29.3000 8.71518 5.26907 29.7739 8.68786 5.02173 30.2555 8.64741 4.77351 30.7449 8.57159 4.52153 31.2421 8.47077 4.28284 31.7475 8.35198 4.05676 32.2609 8.21766 3.84298 32.7827 8.07020 3.64090 33.3130 7.90989 3.44945 33.8518 7.73436 3.26807 34.3993 7.54790 3.11098 34.9557 7.36247 2.96418 35.5211 7.17397 2.82430 36.0956 6.98331 2.69102 36.6794 6.79713 2.56030 37.2727 6.59211 2.40456 37.8755 6.36070 2.25829 38.4882 6.11128 2.12091 39.1107 5.84709 1.99031 39.7432 5.55914 1.85893 40.3861 5.24123 1.73624 41.0393 4.88127 1.64247 41.7031 4.52196 1.57759 42.3776 4.13369 1.52976 43.0630 3.75063 1.52376 43.7595 3.36519 1.51778 44.4673 2.95721 1.51865 45.1865 2.53922 1.53884 45.9174 2.10206 1.55930 46.6600 1.62296 1.58981 47.4147 1.12102 1.65273 48.1816 0.582067 1.72522 48.9609 0.204921E-02 1.81628 49.7528 -0.665324 1.93386 50.5576 -1.36470 2.15938 51.3753 -2.09833 2.41121 52.2062 -2.92688 2.69241 53.0506 -3.95070 3.18367 53.9087 -4.88860 3.95012 54.7806 -5.70961 4.92716 55.6667 -6.17281 5.92273 56.5670 -6.77305 6.81127 57.4820 -7.46413 7.85980 58.4117 -8.05313 9.18750 59.3564 -8.40836 10.7395 60.3165 -8.18939 12.2923 61.2921 -8.04823 13.3509 62.2834 -7.99704 14.5006 63.2908 -7.92450 15.7494 64.3145 -7.72538 17.1057 65.3547 -7.21237 18.5788 66.4118 -6.59142 19.5560 67.4859 -6.12019 20.5418 68.5775 -5.67451 21.5773 69.6867 -5.20633 22.6650 70.8138 -4.68647 23.8076 71.9591 -4.08977 25.0077 73.1230 -3.38598 26.2683 74.3057 -2.53645 27.5925 75.5076 -1.44969 28.9834 76.7289 0.152436 30.4445 77.9699 1.93962 30.9909 79.2310 3.38144 31.3986 80.5125 4.71369 31.8098 81.8147 5.99553 32.1798 83.1380 7.25237 32.5541 84.4827 8.51783 32.9328 85.8491 9.82230 33.3160 87.2377 11.1968 33.7035 88.6487 12.7123 34.0956 90.0825 14.6236 34.3390 91.5395 16.3676 34.0743 93.0201 17.9622 33.8116 94.5246 19.6635 33.5510 96.0535 21.3491 32.8091 97.6071 22.8005 32.0143 99.1858 24.2188 31.1591 100.790 25.4116 30.1406 102.420 26.3911 29.2328 104.077 27.5281 28.4480 105.760 28.8444 27.1952 107.471 29.7067 25.7244 109.209 30.2528 24.3331 110.975 30.6285 23.0171 112.770 30.8546 21.7722 114.594 30.9005 20.6611 116.448 30.9643 19.7104 118.331 31.0109 18.8036 120.245 31.0207 17.9384 122.190 30.9729 17.1130 124.166 30.8688 16.4124 126.175 30.8127 15.7877 128.215 30.7879 15.1868 130.289 30.7742 14.6088 132.397 30.7745 14.0528 134.538 30.8057 13.5179 136.714 30.9845 12.9318 138.925 31.0212 12.1505 141.172 30.9204 11.4164 143.456 30.7583 10.7267 145.776 30.5515 10.0787 148.134 30.3088 9.46978 150.530 30.0342 8.89766 152.964 29.7196 8.36010 155.439 29.3910 7.90731 157.953 29.0750 7.48689 160.507 28.7644 7.08882 163.103 28.4512 6.71190 165.742 28.1341 6.35504 168.422 27.8125 6.01714 171.146 27.4875 5.69722 173.915 27.1543 5.38870 176.727 26.8086 5.09680 179.586 26.4485 4.82845 182.491 26.0886 4.58333 185.442 25.7228 4.35065 188.442 25.3360 4.13024 191.489 24.9484 3.95315 194.587 24.5649 3.78365 197.734 24.1692 3.62142 200.932 23.7505 3.49189 204.182 23.3420 3.38833 207.485 22.9278 3.28784 210.840 22.4818 3.22228 214.251 22.0648 3.20049 217.716 21.6581 3.17885 221.237 21.2314 3.16623 224.816 20.8148 3.18242 228.452 20.4031 3.19869 232.147 19.9770 3.21504 235.902 19.5170 3.25895 239.717 19.0670 3.33416 243.595 18.6177 3.41110 247.535 18.1401 3.49227 251.538 17.6519 3.61572 255.607 17.1509 3.74352 259.741 16.6081 3.87585 263.942 15.9842 4.07493 268.211 15.3962 4.37886 272.549 14.8251 4.70546 276.957 14.2453 5.05641 281.437 13.6234 5.43354 285.989 12.9825 5.93628 290.615 12.3619 6.50085 295.315 11.6689 7.11910 300.092 11.0352 8.03985 304.945 10.7351 9.11153 309.878 10.5694 9.89810 314.890 10.3316 10.6700 319.983 10.0979 11.5021 325.158 9.95347 12.3693 330.418 9.82344 13.2271 335.762 9.74872 14.1445 341.192 9.76120 15.0322 346.711 9.76794 15.9005 352.319 9.80347 16.8191 358.017 9.96594 17.7552 363.808 10.1391 18.6401 369.692 10.3366 19.5690 375.672 10.6608 20.5442 381.748 11.0676 21.3535 387.922 11.4434 22.1321 394.197 11.8087 22.9392 400.573 12.2192 23.7756 407.052 12.7857 24.6426 413.635 13.4076 25.3037 420.326 13.9530 25.9136 427.124 14.4821 26.5382 434.032 15.0356 27.1779 441.052 15.6994 27.7914 448.186 16.3045 28.2550 455.435 16.8588 28.7264 462.802 17.3930 29.2056 470.287 17.9198 29.6928 477.894 18.4397 30.1882 485.623 18.9601 30.7083 493.478 19.5074 31.2529 501.459 20.0845 31.8072 509.570 20.6946 32.3713 517.812 21.3453 32.9454 526.187 22.0980 33.5298 534.698 22.8835 33.9949 543.346 23.6434 34.4402 552.134 24.4148 34.8914 561.065 25.2205 35.3484 570.139 26.0891 35.8115 579.361 27.1306 36.1768 588.732 28.0992 36.3534 598.254 28.9735 36.5309 607.930 29.8383 36.7092 617.763 30.7108 36.8885 627.755 31.6068 37.0686 637.908 32.6575 37.2411 648.226 33.7422 37.1532 658.711 34.6475 36.9291 669.365 35.4324 36.7094 680.191 36.1392 36.5368 691.193 36.8340 36.3991 702.372 37.5614 36.2594 713.733 38.2796 36.0378 725.277 38.9047 35.7610 737.008 39.4486 35.4866 748.928 39.9120 35.2142 761.042 40.2557 34.9528 773.351 40.4064 34.7905 785.859 40.4669 34.9683 798.570 40.8070 35.4327 811.486 41.3720 35.9030 824.611 42.1227 36.3798 837.949 43.1486 36.8632 851.502 44.4170 37.0292 865.274 45.7746 36.8375 879.269 46.8380 36.3299 893.491 47.7038 35.8290 907.943 48.4569 35.3350 922.628 49.1144 34.8479 937.551 49.7152 34.4123 952.715 50.2811 33.9935 968.124 50.8263 33.5895 983.783 51.3499 33.1906 999.695 51.8533 32.7929 1015.86 52.3407 32.3962 1032.29 52.7738 31.9739 1048.99 53.1575 31.5981 1065.96 53.5512 31.2717 1083.20 53.9523 30.9483 1100.72 54.3515 30.6278 1118.52 54.7466 30.3103 1136.61 55.1373 29.9954 1155. 55.5243 29.6835 1173.68 55.9087 29.3745 1192.66 56.2926 29.0680 1211.95 56.6801 28.7642 1231.55 57.0837 28.4630 1251.47 57.5020 28.1279 1271.72 57.9221 27.7564 1292.29 58.2941 27.3406 1313.19 58.6273 26.9302 1334.43 58.9357 26.5257 1356.01 59.2247 26.1268 1377.94 59.4969 25.7329 1400.23 59.7546 25.3445 1422.88 60.0003 24.9618 1445.89 60.2364 24.5838 1469.28 60.4671 24.2071 1493.04 60.6945 23.8297 1517.19 60.9034 23.4310 1541.73 61.0886 23.0350 1566.67 61.2536 22.6453 1592.01 61.4029 22.2615 1617.76 61.5381 21.8836 1643.92 61.6600 21.5114 1670.51 61.7696 21.1451 1697.53 61.8676 20.7848 1724.99 61.9624 20.4300 1752.89 62.0446 20.0658 1781.24 62.1076 19.7028 1810.05 62.1524 19.3423 1839.32 62.1791 18.9878 1869.07 62.1901 18.6395 1899.30 62.1855 18.2971 1930.02 62.1655 17.9607 1961.24 62.1303 17.6301 1992.96 62.0763 17.3049 2025.20 62.0180 16.9943 2057.95 61.9445 16.6704 2091.24 61.8454 16.3499 2125.06 61.7244 16.0332 2159.43 61.5794 15.7197 2194.36 61.4099 15.4108 2229.85 61.2125 15.1045 2265.92 60.9850 14.8032 2302.57 60.7251 14.5052 2339.81 60.4274 14.2105 2377.66 60.0871 13.9203 2416.11 59.6984 13.6340 2455.19 59.2530 13.3511 2494.90 58.7400 13.0721 2535.26 58.1454 12.7969 2576.26 57.4497 12.5256 2617.93 56.6247 12.2581 2660.27 55.6285 11.9946 2703.30 54.3930 11.7345 2747.03 52.7969 11.4782 2791.46 50.5883 11.2258 2836.61 47.0662 10.9772 2882.49 37.3615 10.7322 2892.30 12.7018 10.6811 2892.50 12.7027 27.4800 2929.11 43.5982 26.9458 2976.48 46.0494 26.2794 3021.40 26.8888 25.6723 3021.60 26.9105 37.2030 3024.63 39.2073 37.1459 3073.55 51.4175 36.2406 3123.26 55.3706 35.3578 3173.78 57.9959 34.4985 3225.11 59.9471 33.6602 3277.27 61.4497 32.8441 3330.28 62.6008 32.0498 3384.15 63.4216 31.2751 3438.88 63.8418 30.5200 3494.50 63.6808 29.7836 3537.90 53.5558 29.2294 3538.10 53.5701 35.1080 3551.02 62.3809 34.8928 3608.46 66.4487 33.9612 3666.82 68.3655 33.0556 3726.13 69.7459 32.1739 3786.40 70.8369 31.3174 3847.64 71.7292 30.4854 3909.87 72.4640 29.6768 3973.11 73.0557 28.8899 4037.38 73.4946 28.1241 4102.68 74.6490 27.3793 4158.90 71.6893 26.7628 4159.10 71.6979 28.2788 4169.03 73.3843 28.1783 4236.46 74.6942 27.5123 4304.98 75.3390 26.8609 4374.62 75.7730 26.2245 4445.37 75.9174 25.6045 4481.90 74.0424 25.2940 4482.10 74.0437 26.4222 4517.27 76.3774 26.1301 4590.33 77.2118 25.5406 4664.58 77.7952 24.9627 4740.03 78.2832 24.3951 4816.69 78.7108 23.8381 4894.60 79.0940 23.2924 4973.77 79.4415 22.7568 5054.21 79.7580 22.2317 5135.96 80.0475 21.7170 5219.03 80.3132 21.2126 5303.44 80.5571 20.7180 5389.22 80.7810 20.2336 5476.39 80.9867 19.7593 5564.97 81.1757 19.2945 5654.98 81.3489 18.8395 5746.44 81.5076 18.3942 5839.39 81.6526 17.9580 5933.83 81.7848 17.5313 6029.81 81.9052 17.1138 6127.33 82.0142 16.7052 6226.44 82.1126 16.3056 6327.15 82.2011 15.9147 6429.48 82.2802 15.5325 6533.48 82.3505 15.1588 6639.15 82.4123 14.7932 6746.54 82.4661 14.4361 6855.65 82.5125 14.0869 6966.54 82.5518 13.7457 7079.22 82.5843 13.4122 7193.72 82.6103 13.0862 7310.07 82.6301 12.7678 7428.31 82.6442 12.4570 7548.45 82.6527 12.1531 7670.54 82.6559 11.8564 7794.61 82.6540 11.5667 7920.68 82.6474 11.2836 8048.79 82.6360 11.0073 8178.98 82.6202 10.7374 8311.26 82.6000 10.4739 8445.69 82.5757 10.2168 8582.29 82.5474 9.96574 8721.11 82.5152 9.72060 8862.16 82.4793 9.48135 9005.50 82.4397 9.24773 9151.16 82.3964 9.01989 9299.17 82.3498 8.79744 9449.58 82.2998 8.58041 9602.42 82.2470 8.36876 9757.73 82.1918 8.16199 9915.55 82.1369 7.96051 10075.9 82.0793 7.75074 10238.9 82.0088 7.54634 10404.5 81.9315 7.34721 10572.8 81.8475 7.15324 10743.8 81.7568 6.96434 10917.6 81.6595 6.78040 11094.2 81.5552 6.60133 11273.6 81.4435 6.42703 11455.9 81.3238 6.25739 11641.2 81.1953 6.09232 11829.5 81.0570 5.93172 12020.8 80.9078 5.77549 12215.3 80.7458 5.62353 12412.8 80.5690 5.47575 12613.6 80.3745 5.33206 12817.6 80.1583 5.19236 13025.0 79.9150 5.05655 13235.6 79.6366 4.92456 13449.7 79.3107 4.79628 13667.2 78.9168 4.67163 13888.3 78.4174 4.55052 14112.9 77.7312 4.43287 14341.2 76.6198 4.31859 14573.1 73.2783 4.20760 14619.3 61.6456 4.18607 14619.5 61.6463 10.1584 14808.9 76.0695 9.93452 15048.4 77.6219 9.66231 15291.8 78.4254 9.39757 15539.1 78.9296 9.14010 15790.4 79.2576 8.88967 16045.8 79.4561 8.64612 16305.4 79.5396 8.40923 16569.1 79.4977 8.17885 16837.1 79.2783 7.95478 17109.4 78.6814 7.73686 17337.0 71.4663 7.56187 17337.2 71.4670 10.6049 17386.1 77.3018 10.5605 17667.4 79.1262 10.3114 17953.1 79.3376 10.0681 18048.9 76.5977 9.98863 18049.1 76.5981 11.3352 18243.5 80.2027 11.1628 18538.6 81.0296 10.9095 18838.4 81.5899 10.6600 19143.1 82.0324 10.4144 19452.7 82.4020 10.1727 19767.4 82.7200 9.93500 20087.1 82.9984 9.70131 20412.0 83.2453 9.47165 20742.1 83.4661 9.24608 21077.6 83.6646 9.02457 21418.5 83.8440 8.80717 21765.0 84.0067 8.59385 22117.0 84.1545 8.38462 22474.7 84.2891 8.17946 22838.2 84.4117 7.97836 23207.6 84.5235 7.78130 23583.0 84.6255 7.58825 23964.4 84.7185 7.39919 24352.0 84.8033 7.21407 24745.9 84.8804 7.03288 25146.2 84.9505 6.85556 25552.9 85.0142 6.68208 25966.2 85.0718 6.51239 26386.1 85.1239 6.34644 26812.9 85.1707 6.18420 27246.6 85.2127 6.02560 27687.3 85.2502 5.87061 28135.1 85.2836 5.71915 28590.2 85.3129 5.57119 29052.6 85.3387 5.42667 29522.5 85.3609 5.28553 30000.0 85.3800 5.14772 periodictable-1.5.0/periodictable/xsf/ru.nff000066400000000000000000000366161310514471200210640ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.51919 10.1617 -9999. 1.51438 10.3261 -9999. 1.51486 10.4931 -9999. 1.54335 10.6628 -9999. 1.57238 10.8353 -9999. 1.60195 11.0105 -9999. 1.63207 11.1886 -9999. 1.66277 11.3696 -9999. 1.70320 11.5535 -9999. 1.79614 11.7404 -9999. 1.89247 11.9303 -9999. 1.98441 12.1232 -9999. 2.08083 12.3193 -9999. 2.18192 12.5186 -9999. 2.28793 12.7210 -9999. 2.39908 12.9268 -9999. 2.51500 13.1359 -9999. 2.63274 13.3483 -9999. 2.75599 13.5642 -9999. 2.88500 13.7836 -9999. 3.02006 14.0066 -9999. 3.16144 14.2331 -9999. 3.29139 14.4633 -9999. 3.42241 14.6972 -9999. 3.55864 14.9350 -9999. 3.70029 15.1765 -9999. 3.84758 15.4220 -9999. 4.00073 15.6714 -9999. 4.15722 15.9249 -9999. 4.31627 16.1825 -9999. 4.48140 16.4442 -9999. 4.65285 16.7102 -9999. 4.83086 16.9805 -9999. 5.01568 17.2551 -9999. 5.19592 17.5342 -9999. 5.35976 17.8178 -9999. 5.52876 18.1060 -9999. 5.70309 18.3988 -9999. 5.88292 18.6964 -9999. 6.06842 18.9988 -9999. 6.21828 19.3061 2.36290 6.34963 19.6184 2.49084 6.48374 19.9357 2.62131 6.62070 20.2581 2.75833 6.76054 20.5858 2.90708 6.90334 20.9187 3.08159 7.04915 21.2571 3.27035 7.16466 21.6009 3.45778 7.24279 21.9503 3.63272 7.32177 22.3053 3.79793 7.40161 22.6661 3.96566 7.48233 23.0327 4.13697 7.56392 23.4052 4.32583 7.64641 23.7838 4.52598 7.70866 24.1685 4.72418 7.75957 24.5594 4.91526 7.81082 24.9566 5.11788 7.86240 25.3602 5.33916 7.91433 25.7704 5.60852 7.96660 26.1872 5.89743 7.89954 26.6108 6.15535 7.79586 27.0412 6.34183 7.69354 27.4786 6.52375 7.59257 27.9230 6.69375 7.48282 28.3747 6.85038 7.33690 28.8336 6.97284 7.19383 29.3000 7.07484 7.05354 29.7739 7.16284 6.91599 30.2554 7.24490 6.78113 30.7448 7.31450 6.64215 31.2421 7.36925 6.46927 31.7474 7.38966 6.30089 32.2609 7.38578 6.13689 32.7827 7.36030 5.97716 33.3129 7.31390 5.82159 33.8517 7.24664 5.67020 34.3992 7.15790 5.52305 34.9556 7.04570 5.37973 35.5210 6.90896 5.24090 36.0955 6.74541 5.10755 36.6793 6.55929 4.97761 37.2726 6.33624 4.84148 37.8754 6.05924 4.70041 38.4880 5.71726 4.56700 39.1106 5.29880 4.44643 39.7431 4.77529 4.32904 40.0039 4.51009 4.28209 40.5878 3.74893 4.22575 40.9979 3.09986 4.30523 41.3041 2.51648 4.49992 41.5802 2.07541 4.78132 42.2527 1.03443 5.72479 42.8360 0.438102E-01 6.67715 43.1761 -0.109399 8.15369 43.7675 0.133196 9.55299 44.2033 0.522509 10.4363 44.6702 1.00796 11.1473 45.2616 1.61535 11.8910 45.7285 2.04140 12.2800 46.1020 2.27325 12.5972 46.7245 2.66297 13.2520 47.1292 3.01234 13.7550 47.6272 3.55272 14.2790 48.1564 4.19227 14.7104 48.9353 5.14469 15.1279 48.9968 5.21749 15.1610 49.4948 5.76233 15.3039 50.0551 6.35466 15.4646 50.5175 6.77962 15.4955 50.9325 7.10901 15.5677 51.7563 7.73272 15.7628 52.5934 8.40526 15.9726 53.4441 9.13482 16.1596 54.3085 9.90814 16.3146 55.1869 10.7066 16.3764 56.0795 11.5058 16.3781 56.9865 12.3596 16.2964 57.9082 13.1896 16.0509 58.8448 13.8834 15.7804 59.7966 14.5501 15.5144 60.7638 15.2000 15.2529 61.7466 15.8288 14.8624 62.7453 16.3893 14.4808 63.7601 16.9381 14.1247 64.7914 17.5455 13.6724 65.8394 18.0522 13.1695 66.9043 18.4956 12.6291 67.9864 18.8747 12.0929 69.0860 19.2359 11.5755 70.2034 19.5928 10.9582 71.3389 19.7895 10.3641 72.4927 19.9779 9.83749 73.6652 20.1806 9.23769 74.8567 20.3003 8.66331 76.0675 20.3711 8.08614 77.2978 20.3955 7.54503 78.5480 20.3849 7.00414 79.8185 20.3501 6.50205 81.1095 20.2957 6.00102 82.4214 20.2033 5.52507 83.7545 20.0859 5.05894 85.1091 19.9475 4.63197 86.4857 19.7710 4.16623 87.8845 19.5593 3.74588 89.3060 19.3009 3.37120 90.7504 19.0197 3.03461 92.2183 18.7281 2.75449 93.7098 18.4381 2.50261 95.2255 18.1510 2.29916 96.7657 17.8654 2.12066 98.3308 17.5808 1.96186 99.9212 17.3050 1.84575 101.537 17.0389 1.74552 103.180 16.7857 1.68020 104.849 16.5445 1.62616 106.544 16.3190 1.60282 108.268 16.1201 1.57981 110.019 15.9351 1.55958 111.798 15.7580 1.54230 113.606 15.5859 1.52521 115.444 15.4169 1.51411 117.311 15.2510 1.51162 119.209 15.0841 1.51075 121.137 14.9267 1.52941 123.096 14.7775 1.54831 125.087 14.6318 1.57598 127.110 14.4966 1.61162 129.166 14.3705 1.64805 131.255 14.2507 1.68597 133.378 14.1355 1.72502 135.535 14.0246 1.76498 137.728 13.9179 1.80831 139.955 13.8157 1.85286 142.219 13.7173 1.89785 144.519 13.6223 1.94390 146.857 13.5299 1.99032 149.232 13.4396 2.03743 151.646 13.3512 2.08566 154.098 13.2645 2.13556 156.591 13.1805 2.18696 159.124 13.0993 2.23959 161.697 13.0214 2.29108 164.313 12.9439 2.34246 166.970 12.8688 2.39500 169.671 12.7976 2.44694 172.415 12.7254 2.49184 175.204 12.6531 2.53756 178.038 12.5811 2.58412 180.917 12.5068 2.62164 183.843 12.4298 2.65944 186.817 12.3493 2.69777 189.838 12.2670 2.73280 192.909 12.1803 2.76406 196.029 12.0865 2.79568 199.200 11.9894 2.82763 202.422 11.8867 2.85543 205.696 11.7757 2.88350 209.023 11.6593 2.91185 212.403 11.5358 2.93785 215.839 11.4025 2.96321 219.330 11.2687 2.98879 222.877 11.1247 3.00412 226.482 10.9611 3.00949 230.145 10.7792 3.01488 233.868 10.5780 3.02025 237.650 10.3542 3.01552 241.494 10.0998 3.01080 245.400 9.81356 3.00609 249.369 9.49247 3.00771 253.403 9.12986 3.01087 257.501 8.71904 3.01404 261.666 8.25140 3.02803 265.898 7.68885 3.05031 270.199 7.02524 3.07276 274.569 6.26695 3.18222 279.010 5.05363 3.31193 280.127 4.67657 3.34504 282.367 3.83931 3.70931 284.663 3.17574 4.55103 285.868 2.97190 4.98352 288.049 2.76904 5.73799 290.287 2.68129 6.33963 291.722 2.63890 6.68778 293.730 2.57283 7.08751 295.739 2.49192 7.45976 297.919 2.37608 7.83054 300.100 2.25763 8.17208 302.109 2.11591 8.43491 304.017 1.89825 8.59801 305.858 1.46381 8.72817 307.030 1.04877 8.95085 308.703 0.582941 9.64287 310.640 0.312513 10.4103 313.621 0.153360E-01 11.3558 315.895 -0.379490 12.1082 317.966 -0.860916 13.0428 319.684 -1.09405 14.2048 321.502 -1.03542 15.5096 323.018 -0.745226 16.5866 324.584 -0.213251 17.7435 325.645 0.373235 18.4082 326.655 1.00627 18.9221 327.618 1.71792 19.2741 328.075 2.05591 19.3612 328.729 2.52905 19.3772 329.585 2.98806 19.2992 330.765 3.37681 19.1205 331.621 3.53215 19.1520 332.014 3.63947 19.2381 332.572 3.84285 19.2212 333.219 4.04774 19.2414 334.031 4.14435 19.0060 334.619 4.13706 19.2072 335.159 4.14720 19.1687 335.964 4.30532 19.4731 336.994 4.36993 19.4147 338.292 4.70381 20.0161 339.135 5.14160 20.2770 340.820 5.81363 19.8728 343.750 5.96299 19.8174 346.120 6.27693 20.0917 347.906 6.38150 20.1724 353.011 6.87593 20.5395 358.721 7.37113 21.7551 364.523 8.90402 22.4191 370.419 10.2289 22.7504 376.410 11.3747 22.6231 382.498 12.1589 22.5184 388.684 12.8099 22.4773 394.971 13.4008 22.5009 401.359 13.9916 22.5821 407.851 14.5865 22.6370 414.448 15.1614 22.6702 421.151 15.6872 22.6728 427.963 16.1458 22.6856 434.885 16.5737 22.7193 441.919 16.9481 22.6869 449.066 17.0735 22.6005 450.103 17.0299 22.5881 454.761 16.4396 22.5302 456.563 15.9125 22.7228 457.438 15.5793 23.0754 458.470 15.2264 23.4356 459.140 14.8620 23.8105 459.984 14.3134 24.6061 460.764 13.5940 25.7847 461.169 13.6805 27.2723 461.624 14.3010 28.7102 461.884 15.1950 29.7042 462.143 16.2855 30.1211 462.445 17.6141 30.2884 462.843 19.2924 30.0248 463.130 20.2369 29.3505 463.703 21.2806 27.6533 464.420 21.4706 26.1224 465.009 21.2445 25.2324 466.330 20.5503 24.0668 467.949 19.5913 23.8488 469.861 19.1203 24.0654 472.766 19.3925 25.1411 474.874 19.9580 24.9505 477.036 20.2419 24.8039 479.270 20.3658 24.6544 481.341 20.2135 24.5504 482.138 20.0283 24.6233 482.806 19.7489 24.8271 483.323 19.5698 25.2792 483.861 19.7073 26.0415 484.271 20.2124 26.5884 484.637 20.8260 26.7566 485.003 21.4332 26.7201 485.757 22.4436 26.1002 486.274 22.6594 25.3397 486.941 22.4477 24.6597 487.307 22.4348 24.5417 488.858 21.9339 24.3745 490.603 21.7517 24.3408 492.116 21.6933 24.4580 493.944 21.7267 24.6422 495.284 21.8706 24.8047 498.811 22.6499 25.2181 502.679 23.3413 24.6396 507.991 23.8484 24.3034 516.207 24.6347 24.1655 517.997 24.8998 24.1358 524.839 25.6189 23.3068 530.973 25.7330 22.5336 539.209 25.6128 22.2545 546.028 25.7636 22.2445 554.860 26.1025 22.0578 555.036 26.0860 22.0541 563.914 26.3948 21.9969 570.863 26.6856 21.9518 580.096 27.1200 21.8610 589.479 27.5882 21.7588 599.013 28.1658 21.6440 608.702 28.6311 21.1982 618.547 28.8097 20.7750 628.552 28.9909 20.7371 638.718 29.3573 20.6330 649.049 29.6254 20.4475 659.546 30.0185 20.6008 670.214 30.7512 20.4904 681.054 31.3689 20.1154 692.070 31.7196 19.7472 703.263 32.0565 19.3843 714.638 32.3440 19.0279 726.197 32.5802 18.6918 737.943 32.8048 18.4396 749.878 33.0277 18.1909 762.007 33.2753 17.9669 774.332 33.5458 17.7473 786.856 33.8201 17.5018 799.583 34.0868 17.2193 812.515 34.3266 16.9413 825.657 34.5498 16.6613 839.011 34.7568 16.3821 852.582 34.9481 16.1076 866.371 35.1238 15.8378 880.384 35.2798 15.5874 894.624 35.4432 15.3511 909.094 35.6058 15.1183 923.797 35.7648 14.8891 938.739 35.9224 14.6696 953.922 36.0817 14.4573 969.351 36.2486 14.2481 985.030 36.4498 14.0420 1000.96 36.6500 13.7924 1017.15 36.8189 13.5183 1033.60 36.9643 13.2498 1050.32 37.0969 12.9865 1067.31 37.2212 12.7215 1084.57 37.3309 12.4580 1102.11 37.4291 12.1999 1119.94 37.5180 11.9471 1138.05 37.5988 11.6996 1156.46 37.6724 11.4573 1175.17 37.7393 11.2199 1194.17 37.8000 10.9876 1213.49 37.8551 10.7602 1233.12 37.9053 10.5376 1253.06 37.9511 10.3197 1273.33 37.9936 10.1062 1280. 38.0071 10.0377 1294. 38.0321 9.88852 1314.93 38.0562 9.68467 1336.20 38.0830 9.48502 1357.81 38.1073 9.28951 1379.77 38.1284 9.09781 1402.09 38.1466 8.91018 1424.77 38.1629 8.72657 1447.81 38.1791 8.54657 1471.23 38.1959 8.36737 1495.02 38.2134 8.18884 1519.20 38.2248 7.99777 1543.78 38.2232 7.81051 1568.74 38.2142 7.62770 1594.12 38.1992 7.44914 1619.90 38.1787 7.27474 1646.10 38.1532 7.10439 1672.73 38.1229 6.93783 1699.78 38.0879 6.77527 1727.27 38.0487 6.61664 1755.21 38.0055 6.46022 1783.60 37.9569 6.30712 1812.45 37.9031 6.15732 1841.76 37.8440 6.01092 1871.55 37.7795 5.86800 1901.82 37.7095 5.72849 1932.58 37.6341 5.59260 1963.84 37.5531 5.45976 1995.61 37.4655 5.32974 2000. 37.4530 5.31216 2026. 37.3771 5.21187 2052. 37.2985 5.11315 2079. 37.2127 5.01414 2106. 37.1226 4.91804 2134. 37.0245 4.82181 2161. 36.9253 4.73203 2190. 36.8132 4.63873 2218. 36.6993 4.55164 2247. 36.5748 4.46440 2277. 36.4386 4.37721 2306. 36.2989 4.29570 2337. 36.1401 4.21143 2367. 35.9758 4.13268 2398. 35.7937 4.05398 2429. 35.5975 3.97798 2461. 35.3777 3.90211 2493. 35.1374 3.82884 2526. 34.8641 3.75581 2559. 34.5592 3.68532 2592. 34.2152 3.61717 2626. 33.8082 3.54938 2660. 33.3300 3.48390 2695. 32.7328 3.41879 2730. 31.9715 3.35592 2766. 30.8865 3.29347 2802. 29.0699 3.23316 2837.80 14.5340 3.17502 2838. 14.5358 10.9156 2839. 20.4074 10.9100 2876. 28.8893 10.7061 2914. 30.0681 10.5038 2952. 29.6453 10.3076 2966.80 24.0181 10.2328 2967. 24.0261 14.0216 2990. 30.9932 13.8674 3029. 32.7930 13.6125 3069. 33.8596 13.3596 3109. 34.5970 13.1140 3150. 35.1153 12.8700 3191. 35.3291 12.6336 3223.90 33.0448 12.4492 3224.10 33.0512 14.0287 3232. 35.1847 13.9822 3275. 36.5959 13.7332 3317. 37.3264 13.4966 3361. 37.9226 13.2534 3405. 38.4225 13.0155 3449. 38.8569 12.7836 3494. 39.2504 12.5517 3540. 39.6103 12.3207 3586. 39.9351 12.0950 3633. 40.2358 11.8695 3680. 40.5100 11.6509 3729. 40.7718 11.4281 3777. 41.0066 11.2150 3827. 41.2312 10.9995 3877. 41.4380 10.7893 3927. 41.6291 10.5851 3979. 41.8122 10.3774 4031. 41.9809 10.1761 4083. 42.1374 9.98077 4137. 42.2879 9.78257 4191. 42.4269 9.59024 4245. 42.5556 9.40323 4301. 42.6791 9.21477 4357. 42.7935 9.03168 4414. 42.9012 8.85074 4472. 43.0027 8.67187 4530. 43.0965 8.49817 4589. 43.1848 8.32667 4649. 43.2677 8.15726 4710. 43.3456 7.99029 4771. 43.4175 7.82814 4834. 43.4859 7.66573 4897. 43.5489 7.50828 4961. 43.6077 7.35307 5026. 43.6626 7.20036 5091. 43.7130 7.05221 5158. 43.7606 6.90405 5225. 43.8040 6.76068 5294. 43.8449 6.61751 5363. 43.8820 6.47872 5433. 43.9162 6.34234 5504. 43.9476 6.20841 5576. 43.9763 6.07681 5649. 44.0024 5.94754 5722. 44.0257 5.82250 5797. 44.0471 5.69789 5873. 44.0662 5.57581 5950. 44.0832 5.45612 6027. 44.0981 5.34012 6106. 44.1112 5.22503 6186. 44.1225 5.11207 6267. 44.1319 5.00153 6349. 44.1398 4.89327 6432. 44.1460 4.78730 6516. 44.1508 4.68345 6601. 44.1542 4.58187 6687. 44.1562 4.48239 6774. 44.1569 4.38515 6863. 44.1565 4.28897 6952. 44.1550 4.19580 7043. 44.1523 4.10372 7135. 44.1486 4.01371 7229. 44.1438 3.92490 7323. 44.1382 3.83909 7419. 44.1316 3.75416 7516. 44.1242 3.67146 7614. 44.1161 3.59058 7713. 44.1072 3.51147 7814. 44.0976 3.43377 7916. 44.0873 3.35766 8019. 44.0763 3.28347 8124. 44.0647 3.21055 8230. 44.0526 3.13917 8338. 44.0398 3.06922 8447. 44.0267 3.00079 8557. 44.0130 2.93402 8669. 43.9987 2.86851 8782. 43.9842 2.80465 8897. 43.9692 2.74180 9013. 43.9538 2.68056 9131. 43.9379 2.62047 9250. 43.9218 2.56197 9371. 43.9053 2.50455 9494. 43.8885 2.44803 9618. 43.8714 2.39314 9743. 43.8541 2.33957 9900.58 43.8323 2.27472 10060.7 43.8100 2.21162 10223.4 43.7873 2.15023 10388.8 43.7643 2.09049 10556.8 43.7410 2.03237 10727.6 43.7173 1.97583 10901.1 43.6933 1.92083 11077.4 43.6689 1.86732 11256.6 43.6443 1.81527 11438.6 43.6194 1.76465 11623.6 43.5941 1.71541 11811.7 43.5686 1.66751 12002.7 43.5427 1.62094 12196.8 43.5165 1.57563 12394.1 43.4900 1.53158 12594.6 43.4631 1.48874 12798.3 43.4358 1.44708 13005.3 43.4082 1.40656 13215.6 43.3801 1.36717 13429.4 43.3516 1.32886 13646.6 43.3226 1.29162 13867.3 43.2930 1.25541 14091.6 43.2629 1.22019 14319.5 43.2321 1.18596 14551.1 43.2007 1.15268 14786.5 43.1684 1.12032 15025.6 43.1353 1.08886 15268.7 43.1013 1.05827 15515.6 43.0661 1.02854 15766.6 43.0298 0.999633 16021.6 42.9921 0.971532 16280.7 42.9529 0.944215 16544.1 42.9119 0.917659 16811.6 42.8689 0.891843 17083.6 42.8236 0.866748 17359.9 42.7757 0.842354 17640.6 42.7247 0.818640 17926.0 42.6701 0.795588 18215.9 42.6111 0.773181 18510.5 42.5470 0.751399 18809.9 42.4767 0.730226 19114.2 42.3986 0.709644 19423.3 42.3107 0.689638 19737.5 42.2102 0.670191 20056.7 42.0930 0.651287 20381.1 41.9524 0.632911 20710.8 41.7776 0.615049 21045.7 41.5481 0.597686 21386.1 41.2183 0.580808 21732.0 40.6482 0.564402 22083.5 38.3598 0.548453 22117.1 32.7242 0.546968 22117.3 32.7244 3.59436 22440.7 40.6444 3.51506 22803.7 41.4237 3.42946 23172.5 41.8770 3.34537 23547.3 42.1991 3.26281 23928.2 42.4487 3.18177 24315.2 42.6518 3.10227 24708.5 42.8222 3.02430 25108.1 42.9681 2.94786 25514.2 43.0950 2.87294 25926.9 43.2066 2.79954 26346.2 43.3056 2.72765 26772.4 43.3941 2.65725 27205.4 43.4735 2.58835 27645.4 43.5451 2.52092 28092.6 43.6099 2.45496 28546.9 43.6688 2.39044 29008.7 43.7229 2.32736 29477.9 43.7818 2.26568 29954.6 43.7882 2.20541 30000.0 43.8005 2.19980 periodictable-1.5.0/periodictable/xsf/s.nff000066400000000000000000000320401310514471200206630ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 4.05213 10.1617 -9999. 4.23511 10.3261 -9999. 4.42637 10.4931 -9999. 4.62625 10.6628 -9999. 4.83517 10.8353 -9999. 5.05351 11.0106 -9999. 5.28172 11.1886 -9999. 5.52024 11.3696 -9999. 5.79892 11.5535 -9999. 6.15554 11.7404 -9999. 6.53409 11.9303 -9999. 6.93593 12.1232 -9999. 7.22812 12.3193 -9999. 7.48421 12.5186 -9999. 7.74937 12.7210 -9999. 8.02394 12.9268 -9999. 8.17420 13.1359 -9999. 8.32106 13.3483 -9999. 8.47056 13.5642 -9999. 8.62275 13.7836 -9999. 8.77767 14.0066 -9999. 8.93538 14.2331 -9999. 9.09591 14.4633 -9999. 9.21163 14.6973 -9999. 9.25783 14.9350 -9999. 9.30427 15.1765 -9999. 9.35094 15.4220 -9999. 9.39784 15.6714 -9999. 9.44462 15.9249 -9999. 9.49048 16.1825 -9999. 9.53657 16.4442 -9999. 9.58288 16.7102 -9999. 9.62942 16.9805 -9999. 9.50147 17.2551 -9999. 9.35391 17.5342 -9999. 9.20865 17.8178 -9999. 9.06563 18.1060 -9999. 8.92484 18.3989 -9999. 8.78624 18.6964 -9999. 8.64978 18.9988 -9999. 8.48051 19.3061 -9999. 8.31413 19.6184 -9999. 8.15102 19.9357 -9999. 7.99112 20.2582 -9999. 7.75370 20.5858 -9999. 7.52228 20.9188 -9999. 7.29778 21.2571 -9999. 7.07996 21.6009 -9999. 6.86866 21.9503 -9999. 6.66366 22.3053 -9999. 6.46478 22.6661 -9999. 6.27183 23.0327 -9999. 5.98866 23.4053 -9999. 5.71188 23.7838 -9999. 5.44790 24.1685 -9999. 5.19886 24.5594 -9999. 5.01355 24.9566 -9999. 4.83485 25.3603 -9999. 4.66253 25.7705 -9999. 4.40278 26.1873 -9999. 4.13630 26.6109 -9999. 3.88165 27.0413 -9999. 3.60480 27.4786 -9999. 3.34769 27.9231 -9999. 3.10893 28.3747 -9999. 2.85215 28.8337 -9999. 2.60780 29.3000 8.51351 2.38439 29.7739 8.44725 2.09574 30.2555 8.29906 1.83145 30.7449 8.13067 1.66396 31.2421 7.98940 1.51922 31.7475 7.85582 1.38707 32.2609 7.72619 1.26987 32.7827 7.60201 1.16348 33.3130 7.48047 1.06627 33.8518 7.36315 0.981115 34.3993 7.25066 0.902758 34.9557 7.14165 0.830572 35.5211 7.03504 0.763654 36.0956 6.92984 0.702128 36.6794 6.82470 0.647333 37.2727 6.72385 0.599198 37.8755 6.62556 0.554642 38.4882 6.52782 0.514725 39.1107 6.43270 0.478994 39.7432 6.33771 0.445743 40.3861 6.24212 0.418298 41.0393 6.14581 0.393527 41.7031 6.04020 0.380101 42.3776 5.94784 0.378917 43.0630 5.86050 0.377737 43.7595 5.76832 0.384183 44.4673 5.68774 0.401995 45.1865 5.61473 0.420633 45.9174 5.54671 0.440135 46.6600 5.48225 0.460541 47.4147 5.42013 0.481893 48.1816 5.35746 0.504235 48.9609 5.29561 0.538194 49.7528 5.24242 0.576927 50.5576 5.19491 0.622344 51.3753 5.17182 0.669662 52.2062 5.14872 0.696659 53.0506 5.12362 0.724745 53.9087 5.10178 0.752298 54.7806 5.07915 0.775832 55.6667 5.05564 0.800102 56.5670 5.03138 0.826360 57.4820 5.01164 0.858063 58.4117 5.00074 0.890982 59.3564 4.99665 0.910304 60.3165 4.98520 0.925492 61.2921 4.96711 0.943357 62.2834 4.95248 0.967418 63.2908 4.94227 0.992091 64.3145 4.93805 1.01502 65.3547 4.93294 1.03213 66.4118 4.92760 1.04954 67.4859 4.92457 1.06724 68.5775 4.92255 1.07944 69.6867 4.91853 1.09081 70.8138 4.91463 1.10230 71.9591 4.91341 1.11391 73.1230 4.91433 1.11708 74.3057 4.90801 1.11624 75.5076 4.89540 1.11682 76.7289 4.88296 1.12301 77.9699 4.87191 1.12923 79.2310 4.86320 1.13470 80.5125 4.85318 1.13629 81.8147 4.84143 1.13659 83.1380 4.82715 1.13612 84.4827 4.81086 1.13564 85.8491 4.79301 1.13515 87.2377 4.77379 1.13467 88.6487 4.75353 1.13375 90.0825 4.73147 1.13231 91.5395 4.70840 1.13018 93.0201 4.68254 1.12687 94.5246 4.65429 1.12357 96.0535 4.62388 1.12027 97.6071 4.59160 1.11697 99.1858 4.55828 1.11367 100.790 4.52523 1.10632 102.420 4.48460 1.09492 104.077 4.43814 1.08385 105.760 4.38622 1.07289 107.471 4.32764 1.06302 109.209 4.26493 1.05583 110.975 4.19746 1.05069 112.770 4.12808 1.04662 114.594 4.05442 1.04175 116.448 3.97530 1.03485 118.331 3.88873 1.02741 120.245 3.79426 1.01996 122.190 3.69141 1.01259 124.166 3.57932 1.00529 126.175 3.45687 0.998037 128.215 3.32271 0.990826 130.289 3.17524 0.983650 132.397 3.01263 0.976453 134.538 2.83201 0.968314 136.714 2.62925 0.959853 138.925 2.40036 0.951466 141.172 2.13977 0.943150 143.456 1.83971 0.934907 145.776 1.48907 0.926742 148.134 1.07131 0.919198 150.530 0.561128 0.912640 152.964 -0.843296E-01 0.907303 155.439 -0.950596 0.901995 157.953 -2.24181 0.896719 160.507 -4.70752 0.891477 162.400 -13.8158 0.887668 162.600 -13.8089 10.5007 163.103 -8.29501 10.4970 165.742 -3.08659 10.4779 168.422 -1.18127 10.4589 171.146 0.371599E-01 10.4399 173.915 0.947915 10.4209 176.727 1.68407 10.4020 179.586 2.30886 10.3831 182.491 2.86291 10.3618 185.442 3.35538 10.3284 188.442 3.80080 10.2927 191.489 4.21172 10.2520 194.587 4.58576 10.1994 197.734 4.92845 10.1435 200.932 5.23991 10.0848 204.182 5.52406 10.0264 207.485 5.78106 9.96826 210.840 5.99942 9.91052 214.251 6.20343 9.90441 217.716 6.40874 9.90935 221.237 6.62506 9.92307 224.816 6.84443 9.93675 228.452 7.06465 9.95050 232.147 7.28532 9.96431 235.902 7.50644 9.97806 239.717 7.72837 9.99183 243.595 7.95161 10.0056 247.535 8.17701 10.0195 251.538 8.40565 10.0334 255.607 8.63866 10.0472 259.741 8.87785 10.0611 263.942 9.12600 10.0750 268.211 9.38764 10.0889 272.549 9.67488 10.1029 276.957 10.0210 10.0678 281.437 10.3391 9.97128 285.989 10.6154 9.83735 290.615 10.8603 9.69980 295.315 11.0810 9.56415 300.092 11.2862 9.43052 304.945 11.4789 9.29874 309.878 11.6610 9.16871 314.890 11.8338 9.04043 319.983 11.9985 8.91401 325.158 12.1563 8.78950 330.418 12.3078 8.66660 335.762 12.4535 8.54541 341.192 12.5942 8.42596 346.711 12.7303 8.30812 352.319 12.8624 8.19192 358.017 12.9910 8.07738 363.808 13.1167 7.96445 369.692 13.2401 7.85308 375.672 13.3622 7.74329 381.748 13.4848 7.63506 387.922 13.6120 7.52476 394.197 13.7405 7.40820 400.573 13.8645 7.27689 407.052 13.9737 7.14150 413.635 14.0737 7.00886 420.326 14.1672 6.87860 427.124 14.2557 6.75076 434.032 14.3401 6.62527 441.052 14.4212 6.50207 448.186 14.5032 6.37999 455.435 14.5811 6.25453 462.802 14.6535 6.12761 470.287 14.7197 6.00121 477.894 14.7800 5.87733 485.623 14.8363 5.75601 493.478 14.8890 5.63719 501.459 14.9384 5.52078 509.570 14.9850 5.40686 517.812 15.0290 5.29540 526.187 15.0710 5.18647 534.698 15.1114 5.08007 543.346 15.1510 4.97602 552.134 15.1921 4.87423 561.065 15.2330 4.76649 570.139 15.2670 4.65762 579.361 15.2959 4.55280 588.732 15.3223 4.45093 598.254 15.3471 4.35170 607.930 15.3706 4.25473 617.763 15.3933 4.15991 627.755 15.4167 4.06689 637.908 15.4403 3.97208 648.226 15.4617 3.87388 658.711 15.4755 3.77450 669.365 15.4819 3.67766 680.191 15.4824 3.59184 691.193 15.4865 3.51441 702.372 15.4999 3.43951 713.733 15.5163 3.35698 725.277 15.5262 3.27020 737.008 15.5315 3.18561 748.928 15.5341 3.10323 761.042 15.5345 3.02302 773.351 15.5329 2.94500 785.859 15.5299 2.86954 798.570 15.5260 2.79646 811.486 15.5214 2.72524 824.611 15.5161 2.65581 837.949 15.5103 2.58813 851.502 15.5041 2.52161 865.274 15.4971 2.45613 879.269 15.4888 2.39175 893.491 15.4795 2.32905 907.943 15.4693 2.26801 922.628 15.4585 2.20860 937.551 15.4470 2.15060 952.715 15.4349 2.09410 968.124 15.4223 2.03908 983.783 15.4093 1.98547 999.695 15.3959 1.93318 1015.86 15.3823 1.88216 1032.29 15.3682 1.83173 1048.99 15.3534 1.78246 1065.96 15.3378 1.73434 1083.20 15.3216 1.68751 1100.72 15.3049 1.64194 1118.52 15.2877 1.59758 1136.61 15.2701 1.55445 1155. 15.2520 1.51246 1173.68 15.2335 1.47158 1192.66 15.2145 1.43186 1211.95 15.1952 1.39320 1231.55 15.1755 1.35557 1251.47 15.1553 1.31901 1271.72 15.1347 1.28354 1292.29 15.1138 1.24914 1313.19 15.0925 1.21564 1334.43 15.0709 1.18306 1356.01 15.0488 1.15136 1377.94 15.0263 1.12050 1400.23 15.0034 1.09046 1422.88 14.9798 1.06119 1445.89 14.9556 1.03274 1469.28 14.9308 1.00515 1493.04 14.9051 0.978445 1517.19 14.8790 0.953045 1541.73 14.8524 0.928391 1566.67 14.8254 0.904380 1592.01 14.7976 0.880984 1617.76 14.7690 0.858192 1643.92 14.7396 0.835993 1670.51 14.7091 0.814372 1697.53 14.6776 0.793309 1724.99 14.6452 0.772787 1752.89 14.6112 0.752090 1781.24 14.5753 0.731711 1810.05 14.5373 0.711709 1839.32 14.4969 0.692248 1869.07 14.4539 0.673319 1899.30 14.4080 0.654911 1930.02 14.3589 0.637010 1961.24 14.3061 0.619597 1992.96 14.2488 0.602653 2025.20 14.1870 0.586572 2057.95 14.1192 0.570029 2091.24 14.0437 0.553800 2125.06 13.9591 0.537916 2159.43 13.8633 0.522383 2194.36 13.7531 0.507156 2229.85 13.6240 0.492240 2265.92 13.4692 0.477643 2302.57 13.2776 0.463355 2339.81 13.0290 0.449353 2377.66 12.6820 0.435640 2416.11 12.1250 0.422216 2455.19 10.7868 0.409077 2471.90 4.79408 0.403647 2472.10 4.79536 4.10969 2494.90 11.2689 4.05625 2535.26 12.5388 3.96452 2576.26 13.1810 3.87387 2617.93 13.6189 3.78454 2660.27 13.9525 3.69661 2703.30 14.2218 3.60994 2747.03 14.4470 3.52449 2791.46 14.6397 3.44043 2836.61 14.8077 3.35790 2882.49 14.9558 3.27664 2929.11 15.0876 3.19691 2976.48 15.2060 3.11856 3024.63 15.3126 3.04154 3073.55 15.4092 2.96610 3123.26 15.4972 2.89204 3173.78 15.5775 2.81947 3225.11 15.6508 2.74818 3277.27 15.7180 2.67844 3330.28 15.7798 2.61019 3384.15 15.8366 2.54323 3438.88 15.8888 2.47766 3494.50 15.9368 2.41352 3551.02 15.9810 2.35074 3608.46 16.0217 2.28932 3666.82 16.0592 2.22927 3726.13 16.0937 2.17055 3786.40 16.1254 2.11314 3847.64 16.1546 2.05704 3909.87 16.1814 2.00221 3973.11 16.2060 1.94865 4037.38 16.2285 1.89634 4102.68 16.2492 1.84526 4169.03 16.2680 1.79538 4236.46 16.2851 1.74670 4304.98 16.3007 1.69919 4374.62 16.3148 1.65283 4445.37 16.3276 1.60760 4517.27 16.3391 1.56348 4590.33 16.3494 1.52046 4664.58 16.3586 1.47849 4740.03 16.3667 1.43757 4816.69 16.3739 1.39767 4894.60 16.3801 1.35880 4973.77 16.3855 1.32090 5054.21 16.3901 1.28397 5135.96 16.3939 1.24800 5219.03 16.3971 1.21295 5303.44 16.3995 1.17879 5389.22 16.4014 1.14554 5476.39 16.4027 1.11313 5564.97 16.4034 1.08161 5654.98 16.4037 1.05088 5746.44 16.4035 1.02099 5839.39 16.4028 0.991891 5933.83 16.4018 0.963576 6029.81 16.4004 0.935981 6127.33 16.3986 0.909174 6226.44 16.3965 0.883064 6327.15 16.3941 0.857636 6429.48 16.3914 0.832928 6533.48 16.3885 0.808893 6639.15 16.3854 0.785501 6746.54 16.3820 0.762743 6855.65 16.3784 0.740610 6966.54 16.3746 0.719113 7079.22 16.3707 0.698179 7193.72 16.3667 0.677835 7310.07 16.3625 0.658029 7428.31 16.3581 0.638795 7548.45 16.3537 0.620084 7670.54 16.3491 0.601904 7794.61 16.3445 0.584254 7920.68 16.3398 0.567084 8048.79 16.3351 0.550385 8178.98 16.3302 0.534162 8311.26 16.3254 0.518394 8445.69 16.3205 0.503077 8582.29 16.3155 0.488186 8721.11 16.3105 0.473719 8862.16 16.3055 0.459664 9005.50 16.3005 0.446005 9151.16 16.2955 0.432739 9299.17 16.2905 0.419853 9449.58 16.2855 0.407331 9602.42 16.2805 0.395174 9757.73 16.2755 0.383362 9915.55 16.2705 0.371890 10075.9 16.2656 0.360746 10238.9 16.2607 0.349924 10404.5 16.2558 0.339414 10572.8 16.2509 0.329206 10743.8 16.2461 0.319295 10917.6 16.2413 0.309670 11094.2 16.2366 0.300324 11273.6 16.2318 0.291249 11455.9 16.2272 0.282438 11641.2 16.2226 0.273883 11829.5 16.2180 0.265578 12020.8 16.2135 0.257514 12215.3 16.2090 0.249686 12412.8 16.2046 0.242086 12613.6 16.2002 0.234709 12817.6 16.1959 0.227547 13025.0 16.1917 0.220595 13235.6 16.1875 0.213847 13449.7 16.1833 0.207297 13667.2 16.1792 0.200939 13888.3 16.1752 0.194769 14112.9 16.1712 0.188779 14341.2 16.1673 0.182966 14573.1 16.1634 0.177324 14808.9 16.1596 0.171849 15048.4 16.1559 0.166535 15291.8 16.1522 0.161378 15539.1 16.1486 0.156373 15790.4 16.1450 0.151516 16045.8 16.1415 0.146803 16305.4 16.1381 0.142229 16569.1 16.1347 0.137791 16837.1 16.1314 0.133484 17109.4 16.1281 0.129305 17386.1 16.1249 0.125250 17667.4 16.1217 0.121315 17953.1 16.1186 0.117497 18243.5 16.1155 0.113792 18538.6 16.1125 0.110197 18838.4 16.1096 0.106709 19143.1 16.1067 0.103325 19452.7 16.1039 0.100042 19767.4 16.1011 0.968557E-01 20087.1 16.0983 0.937472E-01 20412.0 16.0956 0.907512E-01 20742.1 16.0930 0.878477E-01 21077.6 16.0904 0.850338E-01 21418.5 16.0878 0.823070E-01 21765.0 16.0853 0.796646E-01 22117.0 16.0829 0.771043E-01 22474.7 16.0805 0.746235E-01 22838.2 16.0781 0.722196E-01 23207.6 16.0758 0.698907E-01 23583.0 16.0735 0.676342E-01 23964.4 16.0713 0.654482E-01 24352.0 16.0692 0.633304E-01 24745.9 16.0670 0.612789E-01 25146.2 16.0649 0.592915E-01 25552.9 16.0629 0.573665E-01 25966.2 16.0609 0.555018E-01 26386.1 16.0589 0.536957E-01 26812.9 16.0570 0.519464E-01 27246.6 16.0552 0.502521E-01 27687.3 16.0533 0.486112E-01 28135.1 16.0515 0.470220E-01 28590.2 16.0498 0.454831E-01 29052.6 16.0481 0.439928E-01 29522.5 16.0464 0.425497E-01 30000.0 16.0447 0.411523E-01 periodictable-1.5.0/periodictable/xsf/sb.nff000066400000000000000000000317111310514471200210310ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 9.95091 10.1617 -9999. 10.0681 10.3261 -9999. 9.92927 10.4931 -9999. 9.42377 10.6628 -9999. 8.92685 10.8353 -9999. 8.35287 11.0106 -9999. 7.84004 11.1886 -9999. 7.46780 11.3696 -9999. 7.10503 11.5535 -9999. 6.73907 11.7404 -9999. 6.40578 11.9303 -9999. 6.13726 12.1232 -9999. 5.87998 12.3193 -9999. 5.66684 12.5186 -9999. 5.46446 12.7210 -9999. 5.25911 12.9268 -9999. 5.02274 13.1359 -9999. 4.80646 13.3483 -9999. 4.66469 13.5642 -9999. 4.51586 13.7836 -9999. 4.35766 14.0066 -9999. 4.20500 14.2331 -9999. 4.06056 14.4633 -9999. 3.93297 14.6973 -9999. 3.80939 14.9350 -9999. 3.62391 15.1765 -9999. 3.43609 15.4220 -9999. 3.23897 15.6714 -9999. 3.06763 15.9249 -9999. 2.91292 16.1825 -9999. 2.76180 16.4442 -9999. 2.61527 16.7102 -9999. 2.47518 16.9805 -9999. 2.33906 17.2551 -9999. 2.21043 17.5342 -9999. 2.09822 17.8178 -9999. 1.99221 18.1060 -9999. 1.88825 18.3989 -9999. 1.78917 18.6964 -9999. 1.69529 18.9988 -9999. 1.61194 19.3061 -9999. 1.53594 19.6184 -9999. 1.47000 19.9357 -9999. 1.39159 20.2582 -9999. 1.31536 20.5858 -9999. 1.24508 20.9188 -9999. 1.19852 21.2571 -9999. 1.15370 21.6009 -9999. 1.11056 21.9503 -9999. 1.06114 22.3053 -9999. 0.992411 22.6661 -9999. 0.932795 23.0327 -9999. 0.901114 23.4053 -9999. 0.870507 23.7838 -9999. 0.826812 24.1685 -9999. 0.771225 24.5594 -9999. 0.746881 24.9566 -9999. 0.722726 25.3603 -9999. 0.680521 25.7705 -9999. 0.651550 26.1873 -9999. 0.632894 26.6109 -9999. 0.614773 27.0413 -9999. 0.592995 27.4786 -9999. 0.570475 27.9231 -9999. 0.550972 28.3747 -9999. 0.536739 28.8337 -9999. 0.536378 29.3000 3.11232 0.536018 29.7739 2.91467 0.539936 30.2555 2.69318 0.550310 30.7449 2.44794 0.568891 31.2421 2.15345 0.609553 31.7475 1.81575 0.681588 32.2609 1.35756 0.810752 32.7827 0.735966 1.00978 33.3130 0.770183 2.16656 33.8518 1.27244 2.62215 34.3993 1.55994 2.68626 34.9557 1.81873 2.64591 35.5211 1.78895 2.42602 36.0956 1.71294 2.32507 36.6794 1.58647 2.22857 37.2727 1.39552 2.14272 37.8755 1.14676 2.07332 38.4882 0.816139 2.05692 39.1107 0.446830 2.07505 39.7432 0.408244E-01 2.22673 40.3861 -0.354905 2.42288 41.0393 -0.721592 2.69851 41.7031 -1.05425 2.99500 42.3776 -1.39748 3.31311 43.0630 -1.73562 3.72083 43.7595 -2.00062 4.15517 44.4673 -2.26444 4.60258 45.1865 -2.50699 5.11024 45.9174 -2.66702 5.73693 46.6600 -2.63556 6.16547 47.4147 -2.76076 6.63601 48.1816 -2.85350 7.14244 48.9609 -2.87141 7.68753 49.7528 -2.84324 8.12142 50.5576 -2.87755 8.54249 51.3753 -2.94937 8.98539 52.2062 -3.08385 9.49949 53.0506 -3.14115 10.1154 53.9087 -3.10333 10.7713 54.7806 -2.99901 11.3445 55.6667 -2.92468 11.9112 56.5670 -2.84380 12.5062 57.4820 -2.73144 13.1234 58.4117 -2.60980 13.7389 59.3564 -2.48184 14.3834 60.3165 -2.35449 15.0838 61.2921 -2.14611 15.8667 62.2834 -1.81911 16.6902 63.2908 -1.37197 17.4104 64.3145 -0.944269 18.1038 65.3547 -0.491782 18.8248 66.4118 0.452285E-01 19.5746 67.4859 0.779790 20.2752 68.5775 1.45834 20.7754 69.6867 2.08365 21.2879 70.8138 2.71545 21.8130 71.9591 3.37550 22.3511 73.1230 4.09686 22.8834 74.3057 4.83237 23.3753 75.5076 5.59229 23.8735 76.7289 6.39113 24.3803 77.9699 7.24912 24.8978 79.2310 8.19351 25.4264 80.5125 9.29709 25.9435 81.8147 10.4496 26.2710 83.1380 11.6471 26.6026 84.4827 13.0396 26.8722 85.8491 14.5129 26.9077 87.2377 15.8818 26.7069 88.6487 17.2457 26.5036 90.0825 18.9441 26.1428 91.5395 20.1893 25.0337 93.0201 20.5647 24.3959 94.5246 21.6919 24.1491 96.0535 22.7399 23.4454 97.6071 23.6561 22.7621 99.1858 24.5290 22.0987 100.790 25.4136 21.4524 102.420 26.3790 20.8238 104.077 27.6863 20.1695 105.760 28.7748 18.6095 107.471 29.5455 17.0947 109.209 29.9169 15.5205 110.975 30.0612 14.0914 112.770 30.0748 12.7939 114.594 30.0350 11.6157 116.448 29.9706 10.4575 118.331 29.9619 9.30487 120.245 29.6502 7.92116 122.190 29.1148 6.74314 124.166 28.4629 5.74124 126.175 27.7589 4.89736 128.215 27.0307 4.18751 130.289 26.2933 3.58683 132.397 25.5291 3.07449 134.538 24.7569 2.71807 136.714 23.9711 2.49281 138.925 23.3300 2.40463 141.172 22.7896 2.31957 143.456 22.2892 2.23751 145.776 21.8044 2.15837 148.134 21.3099 2.10893 150.530 20.8024 2.11239 152.964 20.3549 2.19888 155.439 19.9568 2.31069 157.953 19.6117 2.44492 160.507 19.3104 2.58697 163.103 19.0445 2.73727 165.742 18.8131 2.89630 168.422 18.6214 3.06457 171.146 18.4930 3.21825 173.915 18.3824 3.34443 176.727 18.2720 3.43047 179.586 18.1583 3.51727 182.491 18.0451 3.60679 185.442 17.9410 3.70138 188.442 17.8489 3.79901 191.489 17.7783 3.89594 194.587 17.7132 3.97422 197.734 17.6525 4.04740 200.932 17.5900 4.11634 204.182 17.5298 4.18643 207.485 17.4746 4.25772 210.840 17.4298 4.33022 214.251 17.3887 4.38731 217.716 17.3469 4.44154 221.237 17.3015 4.49357 224.816 17.2554 4.54615 228.452 17.2094 4.59937 232.147 17.1640 4.65326 235.902 17.1194 4.70774 239.717 17.0759 4.76285 243.595 17.0334 4.81859 247.535 16.9921 4.87502 251.538 16.9523 4.93209 255.607 16.9140 4.98981 259.741 16.8776 5.04825 263.942 16.8438 5.10738 268.211 16.8137 5.16719 272.549 16.7906 5.22768 276.957 16.7838 5.27517 281.437 16.7691 5.30568 285.989 16.7421 5.32524 290.615 16.7050 5.34329 295.315 16.6592 5.36140 300.092 16.6067 5.37960 304.945 16.5480 5.39784 309.878 16.4829 5.41610 314.890 16.4114 5.43449 319.983 16.3333 5.45293 325.158 16.2483 5.47142 330.418 16.1560 5.48995 335.762 16.0558 5.50855 341.192 15.9474 5.52726 346.711 15.8300 5.54599 352.319 15.7030 5.56477 358.017 15.5655 5.58363 363.808 15.4168 5.60260 369.692 15.2561 5.62162 375.672 15.0826 5.64068 381.748 14.8962 5.65983 387.922 14.6983 5.67652 394.197 14.4904 5.68764 400.573 14.2592 5.67224 407.052 13.9832 5.64638 413.635 13.6652 5.62063 420.326 13.3040 5.59499 427.124 12.8949 5.56947 434.032 12.4314 5.54417 441.052 11.9043 5.51890 448.186 11.3037 5.49311 455.435 10.6104 5.46440 462.802 9.80154 5.43372 470.287 8.84525 5.40207 477.894 7.69600 5.37055 485.623 6.28402 5.33922 493.478 4.49258 5.30810 501.459 2.10701 5.27718 509.570 -1.33553 5.24644 517.812 -7.17167 5.21587 526.187 -24.6468 5.18548 528.100 -58.0467 5.17863 528.300 -57.9911 40.4663 534.698 -10.2272 39.7857 543.346 0.993204E-02 38.8962 552.134 5.68486 38.0259 561.065 9.65438 37.1750 570.139 12.6811 36.3487 579.361 15.1372 35.5788 588.732 17.2058 34.8346 598.254 18.9860 34.1121 607.930 20.5435 33.4051 617.763 21.9195 32.7122 627.755 23.1583 32.0313 637.908 24.2681 31.3408 648.226 25.2546 30.6303 658.711 26.1016 29.9134 669.365 26.7845 29.2143 680.191 27.3469 28.6102 691.193 27.8631 28.0800 702.372 28.3423 27.5863 713.733 28.7764 27.1086 725.277 29.1553 26.6443 737.008 29.4679 26.1881 748.928 29.6966 25.7396 761.042 29.7412 25.3105 773.351 29.6111 25.0125 785.859 29.3095 25.1554 798.570 29.2974 25.6701 811.486 29.6297 26.1947 824.611 30.1441 26.7304 837.949 31.0027 27.2772 851.502 32.0514 27.5181 865.274 33.2219 27.4078 879.269 34.1736 26.9858 893.491 34.8706 26.5715 907.943 35.4734 26.1640 922.628 35.9247 25.7630 937.551 36.3469 25.5229 952.715 36.7995 25.3245 968.124 37.2921 25.1620 983.783 37.8463 25.0006 999.695 38.4406 24.8111 1015.86 39.1722 24.5919 1032.29 39.8409 24.1034 1048.99 40.3666 23.6181 1065.96 40.8285 23.1379 1083.20 41.2421 22.6673 1100.72 41.6191 22.2063 1118.52 41.9653 21.7546 1136.61 42.2852 21.3122 1155. 42.5820 20.8787 1173.68 42.8582 20.4541 1192.66 43.1157 20.0381 1211.95 43.3563 19.6306 1231.55 43.5811 19.2314 1251.47 43.7915 18.8408 1271.72 43.9888 18.4587 1292.29 44.1743 18.0848 1313.19 44.3492 17.7188 1334.43 44.5141 17.3600 1356.01 44.6693 17.0084 1377.94 44.8157 16.6640 1400.23 44.9542 16.3266 1422.88 45.0852 15.9959 1445.89 45.2103 15.6722 1469.28 45.3301 15.3534 1493.04 45.4472 15.0386 1517.19 45.5555 14.7210 1541.73 45.6518 14.4089 1566.67 45.7397 14.1035 1592.01 45.8203 13.8043 1617.76 45.8941 13.5115 1643.92 45.9621 13.2251 1670.51 46.0248 12.9447 1697.53 46.0829 12.6702 1724.99 46.1381 12.4016 1752.89 46.1889 12.1337 1781.24 46.2335 11.8698 1810.05 46.2712 11.6103 1839.32 46.3032 11.3568 1869.07 46.3304 11.1087 1899.30 46.3532 10.8659 1930.02 46.3716 10.6284 1961.24 46.3864 10.3962 1992.96 46.3960 10.1692 2025.20 46.4060 9.95145 2057.95 46.4146 9.73074 2091.24 46.4177 9.51375 2125.06 46.4161 9.30114 2159.43 46.4106 9.09249 2194.36 46.4018 8.88830 2229.85 46.3892 8.68723 2265.92 46.3730 8.49054 2302.57 46.3530 8.29714 2339.81 46.3297 8.10810 2377.66 46.3030 7.92205 2416.11 46.2724 7.73973 2455.19 46.2385 7.56087 2494.90 46.2005 7.38506 2535.26 46.1587 7.21297 2576.26 46.1131 7.04407 2617.93 46.0635 6.87843 2660.27 46.0098 6.71593 2703.30 45.9518 6.55647 2747.03 45.8892 6.40002 2791.46 45.8218 6.24657 2836.61 45.7495 6.09612 2882.49 45.6718 5.94841 2929.11 45.5882 5.80354 2976.48 45.4986 5.66146 3024.63 45.4021 5.52205 3073.55 45.2985 5.38534 3123.26 45.1867 5.25113 3173.78 45.0661 5.11949 3225.11 44.9355 4.99039 3277.27 44.7938 4.86368 3330.28 44.6395 4.73933 3384.15 44.4705 4.61737 3438.88 44.2846 4.49774 3494.50 44.0790 4.38040 3551.02 43.8496 4.26514 3608.46 43.5912 4.15211 3666.82 43.2971 4.04124 3726.13 42.9570 3.93245 3786.40 42.5562 3.82567 3847.64 42.0709 3.72091 3909.87 41.4596 3.61811 3973.11 40.6392 3.51726 4037.38 39.3939 3.41825 4102.68 36.7362 3.32140 4132.10 23.9024 3.27915 4132.30 23.9039 10.3431 4169.03 37.0855 10.2034 4236.46 39.1169 9.95490 4304.98 39.6096 9.71245 4374.62 37.5446 9.47607 4380.30 33.0068 9.45719 4380.50 33.0110 13.0236 4445.37 40.9183 12.7180 4517.27 42.1683 12.3926 4590.33 42.8546 12.0757 4664.58 43.0260 11.7667 4698.20 40.1599 11.6310 4698.40 40.1643 13.3768 4740.03 43.7255 13.2023 4816.69 44.8387 12.8907 4894.60 45.5823 12.5846 4973.77 46.1761 12.2838 5054.21 46.6772 11.9886 5135.96 47.1120 11.6989 5219.03 47.4956 11.4149 5303.44 47.8376 11.1361 5389.22 48.1446 10.8629 5476.39 48.4219 10.5952 5564.97 48.6734 10.3328 5654.98 48.9023 10.0759 5746.44 49.1111 9.82416 5839.39 49.3017 9.57780 5933.83 49.4761 9.33672 6029.81 49.6359 9.10089 6127.33 49.7823 8.87002 6226.44 49.9164 8.64429 6327.15 50.0394 8.42356 6429.48 50.1520 8.20770 6533.48 50.2551 7.99676 6639.15 50.3495 7.79056 6746.54 50.4356 7.58921 6855.65 50.5144 7.39245 6966.54 50.5860 7.20018 7079.22 50.6511 7.01252 7193.72 50.7102 6.82920 7310.07 50.7636 6.65031 7428.31 50.8118 6.47568 7548.45 50.8551 6.30508 7670.54 50.8936 6.13881 7794.61 50.9279 5.97654 7920.68 50.9583 5.81823 8048.79 50.9849 5.66370 8178.98 51.0079 5.51302 8311.26 51.0275 5.36603 8445.69 51.0442 5.22294 8582.29 51.0581 5.08311 8721.11 51.0690 4.94687 8862.16 51.0775 4.81417 9005.50 51.0836 4.68483 9151.16 51.0876 4.55874 9299.17 51.0894 4.43583 9449.58 51.0893 4.31615 9602.42 51.0875 4.19954 9757.73 51.0840 4.08576 9915.55 51.0788 3.97516 10075.9 51.0723 3.86730 10238.9 51.0643 3.76223 10404.5 51.0550 3.65991 10572.8 51.0445 3.56025 10743.8 51.0329 3.46320 10917.6 51.0202 3.36871 11094.2 51.0066 3.27669 11273.6 50.9920 3.18711 11455.9 50.9766 3.09989 11641.2 50.9604 3.01499 11829.5 50.9434 2.93234 12020.8 50.9258 2.85188 12215.3 50.9075 2.77357 12412.8 50.8886 2.69735 12613.6 50.8692 2.62317 12817.6 50.8492 2.55098 13025.0 50.8287 2.48072 13235.6 50.8078 2.41235 13449.7 50.7865 2.34582 13667.2 50.7647 2.28108 13888.3 50.7426 2.21810 14112.9 50.7201 2.15681 14341.2 50.6973 2.09718 14573.1 50.6741 2.03916 14808.9 50.6506 1.98272 15048.4 50.6268 1.92781 15291.8 50.6027 1.87439 15539.1 50.5783 1.82243 15790.4 50.5536 1.77188 16045.8 50.5287 1.72271 16305.4 50.5034 1.67487 16569.1 50.4778 1.62835 16837.1 50.4519 1.58309 17109.4 50.4257 1.53907 17386.1 50.3992 1.49625 17667.4 50.3723 1.45461 17953.1 50.3450 1.41410 18243.5 50.3173 1.37470 18538.6 50.2891 1.33639 18838.4 50.2605 1.29912 19143.1 50.2314 1.26287 19452.7 50.2017 1.22762 19767.4 50.1714 1.19334 20087.1 50.1404 1.15999 20412.0 50.1086 1.12756 20742.1 50.0760 1.09603 21077.6 50.0424 1.06535 21418.5 50.0078 1.03552 21765.0 49.9720 1.00651 22117.0 49.9348 0.978292 22474.7 49.8962 0.950852 22838.2 49.8558 0.924163 23207.6 49.8134 0.898208 23583.0 49.7688 0.872965 23964.4 49.7215 0.848415 24352.0 49.6712 0.824537 24745.9 49.6173 0.801315 25146.2 49.5592 0.778730 25552.9 49.4959 0.756764 25966.2 49.4263 0.735400 26386.1 49.3491 0.714620 26812.9 49.2621 0.694410 27246.6 49.1625 0.674753 27687.3 49.0460 0.655634 28135.1 48.9060 0.637037 28590.2 48.7313 0.618949 29052.6 48.5005 0.601355 29522.5 48.1654 0.584241 30000.0 47.5711 0.567594 periodictable-1.5.0/periodictable/xsf/sc.nff000066400000000000000000000366111310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.06978 10.1617 -9999. 1.07987 10.3261 -9999. 1.09005 10.4931 -9999. 1.10033 10.6628 -9999. 1.11071 10.8353 -9999. 1.12118 11.0105 -9999. 1.13176 11.1886 -9999. 1.14243 11.3696 -9999. 1.15321 11.5535 -9999. 1.16408 11.7404 -9999. 1.17506 11.9303 -9999. 1.18614 12.1232 -9999. 1.19368 12.3193 -9999. 1.19917 12.5186 -9999. 1.20469 12.7210 -9999. 1.21023 12.9268 -9999. 1.21580 13.1359 -9999. 1.22139 13.3483 -9999. 1.22701 13.5642 -9999. 1.23266 13.7836 -9999. 1.23585 14.0066 -9999. 1.23499 14.2331 -9999. 1.23413 14.4633 -9999. 1.23327 14.6972 -9999. 1.23242 14.9350 -9999. 1.23156 15.1765 -9999. 1.22451 15.4220 -9999. 1.21522 15.6714 -9999. 1.20599 15.9249 -9999. 1.19684 16.1825 -9999. 1.18776 16.4442 -9999. 1.17136 16.7102 -9999. 1.15466 16.9805 -9999. 1.13821 17.2551 -9999. 1.12091 17.5342 -9999. 1.09962 17.8178 -9999. 1.07874 18.1060 -9999. 1.05664 18.3988 -9999. 1.03225 18.6964 -9999. 1.00819 18.9988 -9999. 0.984235 19.3061 0.899370 0.960846 19.6184 0.848332 0.938012 19.9357 0.791683 0.915721 20.2581 0.729132 0.893960 20.5858 0.658398 0.872717 20.9187 0.581335 0.855925 21.2571 0.497486 0.839631 21.6009 0.406542 0.829103 21.9503 0.313088 0.822591 22.3053 0.215305 0.816130 22.6661 0.111336 0.809721 23.0327 0.322480E-03 0.803361 23.4052 -0.119556 0.794611 23.7838 -0.254806 0.783977 24.1685 -0.403297 0.784953 24.5594 -0.559048 0.786442 24.9566 -0.727394 0.787936 25.3602 -0.911631 0.789432 25.7704 -1.11374 0.790930 26.1872 -1.33979 0.789166 26.6108 -1.59834 0.783227 27.0412 -1.90619 0.770810 27.4786 -2.29321 0.758588 27.6000 -2.43285 0.755264 27.8000 -2.66891 0.760916 28.0000 -2.99549 0.793044 28.2000 -3.33442 0.952907 28.4000 -3.54366 1.29828 28.6000 -3.62526 1.47576 29.0000 -3.90353 1.66650 29.2000 -4.13579 1.81320 29.4000 -4.30231 2.07640 29.8755 -4.63452 2.57560 30.0000 -4.69850 2.72349 30.2000 -4.76186 2.93857 30.4000 -4.82447 3.12546 30.6000 -4.86485 3.28692 31.0000 -5.02039 3.53060 31.5014 -5.31631 3.78133 31.8000 -5.63481 3.93700 32.2000 -6.09642 4.29167 32.7208 -6.73990 4.99336 33.2500 -7.29491 5.92893 33.7878 -7.71261 7.06518 33.8000 -7.72004 7.09303 34.2000 -7.90318 8.07985 34.4000 -7.92401 8.41744 34.6000 -7.78715 9.12771 35.1596 -7.75421 10.0604 35.7283 -7.79575 11.3901 36.3062 -7.53562 12.9223 36.8934 -6.99959 14.5227 37.4000 -6.21836 15.9084 37.8000 -5.40492 16.8866 38.4114 -4.11965 17.9812 39.0327 -2.81304 19.0760 39.6640 -1.32321 20.1121 40.3055 0.481781 21.1043 40.9574 2.45824 21.6159 41.2000 3.26151 21.8072 41.6000 4.59601 22.0020 42.2728 6.84016 21.7168 42.8000 8.47597 21.4990 43.4000 10.3706 20.8350 44.1020 12.3413 19.6706 44.8153 13.9719 18.1629 45.5401 15.2333 16.5033 46.2767 16.0176 14.6015 46.4000 16.0353 14.3024 47.0000 16.2952 13.4760 47.4000 16.7303 12.6528 48.1667 17.1377 10.8557 48.9457 17.0441 9.30942 49.7374 16.9166 7.96641 49.8000 16.9648 7.86966 50.0000 16.7561 7.09731 50.4000 16.3154 6.61455 51.0000 15.8083 5.98113 51.2000 15.6698 5.76828 51.6000 15.3753 5.42948 52.2000 14.9724 4.93898 53.0000 14.4742 4.41989 53.4000 14.2588 4.16149 54.0000 13.9120 3.82949 54.8734 13.4620 3.43955 55.2000 13.3067 3.30561 55.4000 13.2274 3.19726 56.2000 12.7997 2.92970 56.6000 12.6382 2.78746 57.5155 12.2318 2.53626 58.4457 11.8629 2.31622 59.3910 11.5048 2.12758 60.3516 11.1461 1.97100 61.3278 10.8084 1.87275 62.3197 10.5089 1.79287 63.3277 10.2277 1.73338 64.3520 9.96625 1.69148 65.3928 9.71833 1.66375 66.4505 9.49115 1.66258 67.5253 9.28739 1.66784 68.6174 9.09879 1.68113 69.7272 8.92740 1.70434 70.8550 8.77350 1.72786 72.0011 8.62754 1.75171 73.1656 8.48436 1.78381 74.3490 8.35371 1.82944 75.5516 8.23764 1.87624 76.7735 8.13054 1.92863 78.0153 8.03541 1.98573 79.2771 7.95100 2.04452 80.5594 7.87591 2.10505 81.8624 7.80976 2.16737 83.1864 7.75324 2.23154 84.5319 7.70749 2.29625 85.8991 7.66842 2.35445 87.2885 7.63254 2.41413 88.7003 7.60206 2.47532 90.1349 7.57771 2.53805 91.5928 7.56003 2.60238 93.0742 7.54995 2.66834 94.5796 7.54913 2.73597 96.1094 7.56315 2.80529 97.6639 7.58654 2.85712 99.2435 7.61462 2.90991 100.849 7.65167 2.94600 102.480 7.68389 2.97151 104.137 7.70979 2.99590 105.822 7.73569 3.02049 107.533 7.77231 3.04528 109.273 7.81098 3.05057 111.040 7.83247 3.04580 112.836 7.84334 3.04587 114.661 7.85125 3.05196 116.516 7.85717 3.05806 118.400 7.84807 3.06416 120.315 7.83308 3.09312 122.261 7.83368 3.13948 124.239 7.84721 3.18654 126.248 7.87015 3.23375 128.290 7.90134 3.28036 130.365 7.94165 3.32764 132.474 7.99931 3.37560 134.616 8.07252 3.39512 136.793 8.13553 3.39598 139.006 8.18779 3.39616 141.254 8.23677 3.39040 143.539 8.27991 3.38466 145.861 8.32254 3.37892 148.220 8.36510 3.36764 150.617 8.40260 3.35200 153.053 8.43423 3.33643 155.529 8.46268 3.32093 158.044 8.48710 3.30551 160.601 8.50846 3.29235 163.198 8.52928 3.28157 165.838 8.54966 3.27084 168.520 8.56727 3.26013 171.246 8.58349 3.25310 174.015 8.60238 3.24953 176.830 8.62434 3.24595 179.690 8.64981 3.24238 182.596 8.68445 3.23881 185.550 8.72142 3.21131 188.551 8.74517 3.18027 191.601 8.76148 3.14954 194.700 8.77438 3.11910 197.849 8.78322 3.08462 201.049 8.78526 3.04964 204.300 8.78121 3.01504 207.605 8.77037 2.98085 210.963 8.75262 2.95292 214.375 8.73439 2.93083 217.842 8.71743 2.90891 221.366 8.69855 2.88715 224.946 8.67763 2.86556 228.584 8.65450 2.84413 232.282 8.62916 2.82285 236.039 8.60157 2.80174 239.856 8.57643 2.78078 243.736 8.54861 2.74979 247.678 8.50952 2.71614 251.684 8.46340 2.68291 255.755 8.41233 2.64995 259.891 8.35413 2.61321 264.095 8.28579 2.57698 268.366 8.20920 2.54126 272.707 8.12409 2.50603 277.118 8.02985 2.47089 281.600 7.92525 2.43554 286.155 7.80929 2.40070 290.783 7.68111 2.36636 295.486 7.53952 2.33251 300.265 7.38302 2.29914 305.122 7.20984 2.26625 310.057 7.01815 2.23383 315.072 6.80578 2.20146 320.168 6.56739 2.16494 325.347 6.29619 2.12901 330.609 5.98786 2.09368 335.956 5.63516 2.05895 341.390 5.22818 2.02478 346.912 4.75314 1.99118 352.523 4.19047 1.95814 358.224 3.51117 1.92565 364.018 2.67009 1.89370 369.906 1.59201 1.86228 375.889 0.139439 1.83138 381.969 -1.97461 1.80099 386.960 -4.65793 1.77677 391.610 -8.91462 1.78582 393.850 -12.4165 1.82566 395.100 -15.2881 1.88861 396.110 -18.5583 1.99488 396.490 -20.1676 2.06025 396.880 -22.1838 2.17286 397.120 -23.6779 2.28686 397.260 -24.7037 2.38826 397.380 -25.6556 2.53571 397.510 -26.8590 2.72434 397.640 -28.1599 3.13268 397.770 -29.5449 3.73662 398.020 -32.2067 5.39374 398.270 -34.3592 8.12081 398.400 -35.0866 9.49362 398.540 -35.9156 10.6483 398.600 -36.3299 11.1669 398.800 -38.9871 13.0147 398.910 -39.7072 15.6348 399.300 -40.6603 22.1038 399.430 -40.7569 24.6224 399.560 -39.9031 27.0539 399.680 -39.6138 29.0801 399.950 -41.4482 32.0182 400.070 -38.8600 38.6551 400.200 -35.6422 39.7823 400.460 -31.7259 41.1456 401.110 -21.9442 47.7781 401.240 -18.6597 48.6681 401.370 -15.5524 48.7739 401.500 -11.6945 47.9833 401.630 -8.93154 46.0636 401.760 -6.05730 43.5546 402.020 -1.49167 37.7465 402.150 -3.04821 30.4954 402.280 -6.61048 28.9314 402.410 -9.05651 27.9012 402.550 -11.7359 27.2202 402.670 -13.7147 27.1281 402.810 -16.2954 27.3122 402.930 -18.1669 27.8154 403.200 -23.4101 29.9854 403.330 -27.4945 31.3317 403.460 -28.9051 39.0163 403.590 -27.5744 41.6764 403.720 -26.9969 45.0395 404.110 -22.4281 54.6246 404.250 -19.4555 57.4984 404.510 -13.0656 60.3531 404.780 -7.24613 61.2929 405.300 1.79225 60.8044 405.700 8.50274 61.2892 405.840 11.5356 61.1066 406.100 16.9583 59.0111 406.370 21.8667 55.5900 406.500 23.9548 53.5709 406.770 26.1965 48.3045 407.310 29.4965 40.4434 407.430 31.3117 39.0750 407.570 31.5578 32.8216 407.970 25.4728 30.1740 408.380 22.8004 28.3614 408.920 21.7185 26.8602 410.000 20.1051 24.4422 414.100 17.4785 16.0585 415.210 15.8801 14.7193 416.050 14.8234 14.0610 417.450 13.3988 13.6012 420.140 11.6365 13.2076 422.860 10.5904 13.2353 425.920 9.87551 13.2874 427.570 9.63341 13.3891 434.486 9.33972 14.1229 436.530 9.59574 14.3450 439.640 10.1274 14.4299 445.170 10.7509 13.6169 452.370 10.6168 12.9235 452.480 10.6113 12.9132 456.650 10.3793 12.9156 464.036 10.2892 13.4462 467.850 10.6506 13.7253 475.020 11.3795 13.7088 482.410 11.8785 13.1984 489.070 11.7100 12.7024 493.940 11.4016 12.8030 501.929 11.4074 13.7728 506.040 11.9539 14.2936 510.210 12.6256 14.3820 518.462 13.6776 13.8796 526.848 14.0914 13.3948 528.700 14.1248 13.2911 534.400 14.1880 13.0296 539.040 14.2400 13.0287 547.759 14.5323 13.1435 556.618 15.1121 13.1547 565.621 15.6605 12.7886 567.410 15.7470 12.7178 575.320 15.9575 12.2792 584.625 16.0117 12.0521 594.081 16.2074 11.9889 603.690 16.5298 11.9157 613.454 16.8580 11.6680 623.376 17.1187 11.4255 633.459 17.3055 11.1500 643.705 17.4301 10.9459 654.116 17.6188 10.8289 664.696 17.8476 10.6482 675.447 18.0402 10.4378 686.372 18.2104 10.2315 697.473 18.3636 10.0293 708.754 18.5016 9.83457 720.218 18.6338 9.65646 731.867 18.7655 9.48157 743.704 18.8939 9.30986 755.733 19.0194 9.14125 767.956 19.1447 8.97373 780.377 19.2650 8.80227 792.999 19.3771 8.63407 805.825 19.4855 8.46910 818.859 19.5913 8.30728 832.103 19.6969 8.14854 845.562 19.8088 7.98593 859.238 19.9158 7.80921 873.135 20.0005 7.62636 887.258 20.0726 7.45709 901.608 20.1509 7.29864 916.191 20.2316 7.13202 931.010 20.2990 6.95408 946.068 20.3502 6.78057 961.370 20.3897 6.61884 976.919 20.4259 6.46829 992.720 20.4641 6.32521 1008.78 20.5022 6.18530 1024.60 20.5403 6.05255 1037.50 20.5703 5.94508 1054.28 20.6051 5.80707 1071.33 20.6359 5.67227 1088.66 20.6641 5.54059 1106.27 20.6901 5.41197 1124.16 20.7171 5.28634 1142.34 20.7420 5.15821 1160.82 20.7614 5.03221 1179.60 20.7777 4.90929 1198.68 20.7925 4.78936 1218.06 20.8050 4.67069 1237.76 20.8143 4.55433 1257.78 20.8212 4.44087 1278.13 20.8260 4.33023 1298.80 20.8289 4.22235 1319.81 20.8302 4.11716 1341.15 20.8300 4.01459 1362.85 20.8284 3.91457 1384.89 20.8255 3.81705 1407.29 20.8215 3.72196 1430.05 20.8163 3.62923 1453.18 20.8101 3.53882 1476.68 20.8030 3.45065 1500.57 20.7950 3.36469 1524.84 20.7862 3.28087 1549.50 20.7767 3.19913 1574.56 20.7664 3.11943 1600.03 20.7555 3.04172 1625.91 20.7441 2.96594 1652.21 20.7320 2.89205 1678.93 20.7195 2.81999 1706.09 20.7065 2.74974 1733.68 20.6932 2.68124 1761.72 20.6795 2.61444 1790.22 20.6656 2.54931 1819.17 20.6516 2.48580 1848.60 20.6380 2.42387 1878.50 20.6246 2.36160 1908.88 20.6097 2.29979 1939.75 20.5934 2.23961 1971.13 20.5763 2.18100 2003.01 20.5586 2.12392 2035.41 20.5403 2.06833 2068.33 20.5215 2.01420 2101.78 20.5022 1.96149 2135.78 20.4824 1.91016 2170.32 20.4623 1.86017 2205.42 20.4417 1.81148 2241.09 20.4207 1.76408 2277.34 20.3993 1.71791 2314.18 20.3776 1.67295 2351.61 20.3554 1.62917 2389.64 20.3329 1.58653 2428.29 20.3100 1.54501 2467.57 20.2867 1.50458 2507.48 20.2629 1.46520 2548.03 20.2388 1.42685 2589.25 20.2142 1.38951 2631.13 20.1891 1.35315 2673.68 20.1636 1.31773 2716.93 20.1375 1.28325 2760.87 20.1110 1.24966 2805.53 20.0841 1.21696 2850.90 20.0570 1.18467 2897.01 20.0289 1.15202 2943.87 19.9989 1.12028 2991.49 19.9678 1.08940 3039.87 19.9354 1.05938 3089.04 19.9016 1.03019 3139. 19.8665 1.00180 3189.77 19.8297 0.974190 3241.36 19.7913 0.947341 3293.79 19.7509 0.921234 3347.06 19.7084 0.895847 3401.20 19.6635 0.871160 3456.21 19.6159 0.847153 3512.11 19.5651 0.823805 3568.92 19.5107 0.801103 3626.64 19.4522 0.779026 3685.30 19.3887 0.757558 3744.91 19.3194 0.736681 3805.48 19.2430 0.716380 3867.03 19.1582 0.696636 3929.58 19.0626 0.676555 3993.13 18.9524 0.656887 4057.72 18.8235 0.637792 4123.35 18.6692 0.619252 4190.04 18.4784 0.601250 4257.81 18.2306 0.583771 4326.68 17.8833 0.566801 4396.66 17.3182 0.550324 4467.77 15.8638 0.534326 4472. 15.6584 0.533398 4492.70 9.61866 0.528888 4492.90 9.61954 4.10855 4530. 16.4170 4.05808 4603.27 17.7259 3.96138 4677.72 18.3611 3.86698 4753.38 18.7881 3.77483 4830.26 19.1104 3.68488 4908.39 19.3688 3.59707 4987.78 19.5839 3.51136 5068.45 19.7674 3.42768 5150.43 19.9268 3.34600 5233.73 20.0672 3.26627 5318.39 20.1924 3.18843 5404.41 20.3049 3.11246 5491.82 20.4071 3.03829 5580.64 20.5010 2.96589 5670.91 20.5896 2.89350 5762.63 20.6698 2.81762 5855.83 20.7399 2.74374 5950.55 20.8035 2.67179 6046.79 20.8612 2.60173 6144.59 20.9138 2.53350 6243.98 20.9618 2.46706 6344.97 21.0058 2.40237 6447.59 21.0460 2.33938 6551.88 21.0830 2.27803 6657.85 21.1169 2.21830 6765.54 21.1481 2.16012 6874.96 21.1769 2.10348 6986.16 21.2034 2.04832 7099.16 21.2280 1.99461 7213.98 21.2508 1.94230 7330.66 21.2726 1.89137 7449.23 21.2935 1.84092 7569.71 21.3122 1.78939 7692.15 21.3280 1.73931 7816.56 21.3419 1.69062 7942.99 21.3542 1.64330 8071.46 21.3649 1.59731 8202.01 21.3744 1.55259 8334.67 21.3827 1.50914 8469.48 21.3899 1.46689 8606.46 21.3960 1.42584 8745.67 21.4013 1.38593 8887.12 21.4058 1.34713 9030.86 21.4095 1.30942 9176.93 21.4125 1.27277 9325.36 21.4149 1.23715 9476.19 21.4167 1.20252 9629.46 21.4181 1.16886 9785.21 21.4194 1.13614 9943.47 21.4202 1.10358 10104.3 21.4201 1.07186 10267.7 21.4195 1.04099 10433.8 21.4184 1.01093 10602.6 21.4168 0.981680 10774.1 21.4149 0.953215 10948.3 21.4126 0.925517 11125.4 21.4100 0.898568 11305.3 21.4070 0.872351 11488.2 21.4038 0.846849 11674.0 21.4003 0.822044 11862.8 21.3965 0.797920 12054.7 21.3926 0.774460 12249.7 21.3884 0.751648 12447.8 21.3840 0.729468 12649.1 21.3795 0.707905 12853.7 21.3749 0.686943 13061.6 21.3701 0.666567 13272.9 21.3652 0.646762 13487.6 21.3601 0.627514 13705.7 21.3550 0.608809 13927.4 21.3498 0.590633 14152.7 21.3445 0.572971 14381.6 21.3392 0.555812 14614.2 21.3338 0.539141 14850.5 21.3284 0.522946 15090.7 21.3229 0.507215 15334.8 21.3174 0.491935 15582.8 21.3119 0.477094 15834.9 21.3064 0.462681 16091.0 21.3009 0.448684 16351.3 21.2953 0.435092 16615.7 21.2898 0.421894 16884.5 21.2843 0.409080 17157.6 21.2788 0.396639 17435.1 21.2733 0.384560 17717.1 21.2679 0.372835 18003.6 21.2624 0.361452 18294.8 21.2571 0.350404 18590.7 21.2517 0.339680 18891.4 21.2464 0.329272 19197.0 21.2411 0.319170 19507.5 21.2359 0.309367 19823.0 21.2307 0.299854 20143.6 21.2256 0.290623 20469.4 21.2205 0.281666 20800.5 21.2155 0.272975 21136.9 21.2106 0.264543 21478.8 21.2057 0.256362 21826.2 21.2008 0.248426 22179.2 21.1960 0.240727 22538.0 21.1913 0.233258 22902.5 21.1867 0.226014 23272.9 21.1821 0.218987 23649.3 21.1775 0.212171 24031.8 21.1731 0.205560 24420.5 21.1687 0.199149 24815.5 21.1643 0.192932 25216.9 21.1601 0.186902 25624.8 21.1558 0.181055 26039.2 21.1517 0.175385 26460.4 21.1476 0.169887 26888.4 21.1436 0.164557 27323.3 21.1397 0.159388 27765.2 21.1358 0.154377 28214.3 21.1320 0.149519 28670.6 21.1283 0.144809 29134.3 21.1246 0.140242 29605.6 21.1223 0.135816 30000.0 21.1168 0.132267 periodictable-1.5.0/periodictable/xsf/se.nff000066400000000000000000000315441310514471200210400ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 5.20241 10.1617 -9999. 5.36005 10.3261 -9999. 5.52247 10.4931 -9999. 5.63017 10.6628 -9999. 5.66221 10.8353 -9999. 5.69443 11.0106 -9999. 5.71762 11.1886 -9999. 5.72709 11.3696 -9999. 5.73659 11.5535 -9999. 5.74610 11.7404 -9999. 5.75558 11.9303 -9999. 5.74367 12.1232 -9999. 5.73179 12.3193 -9999. 5.71993 12.5186 -9999. 5.70809 12.7210 -9999. 5.69116 12.9268 -9999. 5.66798 13.1359 -9999. 5.64489 13.3483 -9999. 5.62190 13.5642 -9999. 5.59899 13.7836 -9999. 5.57619 14.0066 -9999. 5.55347 14.2331 -9999. 5.53085 14.4633 -9999. 5.50832 14.6973 -9999. 5.48588 14.9350 -9999. 5.46416 15.1765 -9999. 5.47179 15.4220 -9999. 5.47945 15.6714 -9999. 5.48710 15.9249 -9999. 5.49477 16.1825 -9999. 5.50245 16.4442 -9999. 5.51014 16.7102 -9999. 5.48519 16.9805 -9999. 5.45830 17.2551 -9999. 5.43154 17.5342 -9999. 5.40491 17.8178 -9999. 5.37840 18.1060 -9999. 5.35997 18.3989 -9999. 5.34380 18.6964 -9999. 5.32768 18.9988 -9999. 5.31161 19.3061 -9999. 5.29558 19.6184 -9999. 5.27674 19.9357 -9999. 5.22931 20.2582 -9999. 5.18230 20.5858 -9999. 5.13572 20.9188 -9999. 5.08955 21.2571 -9999. 5.04380 21.6009 -9999. 4.97976 21.9503 -9999. 4.85658 22.3053 -9999. 4.73645 22.6661 -9999. 4.61930 23.0327 -9999. 4.50120 23.4053 -9999. 4.28248 23.7838 -9999. 4.07439 24.1685 -9999. 3.87642 24.5594 -9999. 3.68806 24.9566 -9999. 3.50886 25.3603 -9999. 3.33836 25.7705 -9999. 3.17615 26.1873 -9999. 3.02182 26.6109 -9999. 2.87499 27.0413 -9999. 2.73530 27.4786 -9999. 2.60239 27.9231 -9999. 2.47594 28.3747 -9999. 2.35563 28.8337 -9999. 2.24117 29.3000 7.81210 2.13227 29.7739 7.77264 2.02867 30.2555 7.73078 1.93009 30.7449 7.68731 1.83631 31.2421 7.64329 1.74503 31.7475 7.59476 1.65666 32.2609 7.54326 1.57276 32.7827 7.48954 1.49311 33.3130 7.43389 1.41750 33.8518 7.37649 1.34571 34.3993 7.31752 1.27756 34.9557 7.25709 1.21287 35.5211 7.19532 1.15144 36.0956 7.13248 1.09313 36.6794 7.06867 1.03679 37.2727 7.00248 0.982849 37.8755 6.93433 0.931714 38.4882 6.86438 0.883238 39.1107 6.79256 0.837286 39.7432 6.71871 0.793723 40.3861 6.64258 0.752427 41.0393 6.56315 0.713280 41.7031 6.47810 0.678280 42.3776 6.39431 0.651254 43.0630 6.31141 0.625303 43.7595 6.22705 0.600387 44.4673 6.13977 0.576630 45.1865 6.05017 0.556066 45.9174 5.95778 0.536235 46.6600 5.85925 0.517111 47.4147 5.75263 0.507983 48.1816 5.65006 0.504227 48.9609 5.54687 0.500499 49.7528 5.43915 0.496798 50.5576 5.32589 0.496344 51.3753 5.20726 0.496500 52.2062 5.07947 0.496658 53.0506 4.93771 0.499383 53.9087 4.77801 0.503749 54.7806 4.58914 0.516424 55.6667 4.33738 0.531435 56.5670 3.96589 0.711860 57.4820 3.76831 1.14783 58.4117 3.91120 1.47960 59.3564 4.02255 1.60918 60.3165 4.11620 1.64922 61.2921 4.16779 1.65907 62.2834 4.10086 1.55870 63.2908 3.98540 1.58412 64.3145 3.85329 1.60996 65.3547 3.71941 1.70211 66.4118 3.60305 1.80064 67.4859 3.49493 1.90700 68.5775 3.39162 2.02051 69.6867 3.29206 2.14079 70.8138 3.19656 2.26823 71.9591 3.10795 2.40325 73.1230 3.02786 2.53434 74.3057 2.94133 2.66485 75.5076 2.85209 2.80208 76.7289 2.76166 2.94638 77.9699 2.67068 3.09810 79.2310 2.57929 3.25764 80.5125 2.48724 3.42540 81.8147 2.39199 3.60179 83.1380 2.29482 3.79869 84.4827 2.20835 4.01211 85.8491 2.13130 4.23751 87.2377 2.06442 4.47559 88.6487 2.01156 4.72704 90.0825 1.98340 4.99261 91.5395 1.98281 5.23688 93.0201 1.96942 5.47150 94.5246 1.95483 5.71661 96.0535 1.94508 5.97271 97.6071 1.94410 6.24029 99.1858 1.95559 6.51984 100.790 1.98647 6.81193 102.420 2.05687 7.11710 104.077 2.15896 7.37029 105.760 2.23502 7.60472 107.471 2.30298 7.84660 109.209 2.37114 8.09618 110.975 2.44374 8.35369 112.770 2.52391 8.61940 114.594 2.61557 8.89355 116.448 2.72500 9.17644 118.331 2.87341 9.45712 120.245 3.01602 9.69210 122.190 3.14924 9.93291 124.166 3.28130 10.1797 126.175 3.41817 10.4327 128.215 3.56279 10.6919 130.289 3.71854 10.9575 132.397 3.89005 11.2298 134.538 4.09069 11.5088 136.714 4.32489 11.7464 138.925 4.53966 11.9622 141.172 4.74380 12.1819 143.456 4.95076 12.4056 145.776 5.16419 12.6335 148.134 5.38908 12.8656 150.530 5.64366 13.1013 152.964 5.89986 13.2929 155.439 6.14556 13.4874 157.953 6.39191 13.6847 160.507 6.64329 13.8849 163.103 6.90320 14.0880 165.742 7.17585 14.2941 168.422 7.47221 14.5032 171.146 7.79913 14.6762 173.915 8.10884 14.8250 176.727 8.40802 14.9753 179.586 8.70975 15.1271 182.491 9.01757 15.2805 185.442 9.33525 15.4355 188.442 9.66739 15.5920 191.489 10.0225 15.7501 194.587 10.4583 15.8792 197.734 10.8558 15.9185 200.932 11.2145 15.9579 204.182 11.5646 15.9973 207.485 11.9143 16.0369 210.840 12.2802 16.0751 214.251 12.6402 16.0661 217.716 12.9846 16.0491 221.237 13.3097 16.0256 224.816 13.6240 16.0020 228.452 13.9308 15.9785 232.147 14.2323 15.9551 235.902 14.5299 15.9315 239.717 14.8248 15.9081 243.595 15.1184 15.8849 247.535 15.4118 15.8615 251.538 15.7061 15.8381 255.607 16.0025 15.8146 259.741 16.3030 15.7914 263.942 16.6102 15.7682 268.211 16.9286 15.7453 272.549 17.2691 15.7222 276.957 17.6616 15.6548 281.437 18.0279 15.5322 285.989 18.3558 15.3759 290.615 18.6547 15.2162 295.315 18.9311 15.0580 300.092 19.1928 14.9015 304.945 19.4423 14.7465 309.878 19.6816 14.5932 314.890 19.9120 14.4416 319.983 20.1346 14.2917 325.158 20.3505 14.1433 330.418 20.5602 13.9963 335.762 20.7641 13.8508 341.192 20.9634 13.7073 346.711 21.1585 13.5647 352.319 21.3494 13.4235 358.017 21.5370 13.2841 363.808 21.7223 13.1463 369.692 21.9060 13.0098 375.672 22.0892 12.8746 381.748 22.2738 12.7407 387.922 22.4642 12.6049 394.197 22.6642 12.4637 400.573 22.8618 12.2932 407.052 23.0364 12.1128 413.635 23.1962 11.9347 420.326 23.3462 11.7599 427.124 23.4891 11.5878 434.032 23.6255 11.4175 441.052 23.7567 11.2501 448.186 23.8874 11.0842 455.435 24.0123 10.9150 462.802 24.1307 10.7448 470.287 24.2415 10.5754 477.894 24.3458 10.4089 485.623 24.4452 10.2448 493.478 24.5401 10.0832 501.459 24.6310 9.92421 509.570 24.7187 9.76800 517.812 24.8051 9.61373 526.187 24.8893 9.45967 534.698 24.9704 9.30428 543.346 25.0465 9.14959 552.134 25.1209 8.99757 561.065 25.1928 8.83996 570.139 25.2558 8.68154 579.361 25.3117 8.52741 588.732 25.3632 8.37670 598.254 25.4116 8.22908 607.930 25.4572 8.08404 617.763 25.5009 7.94153 627.755 25.5453 7.80096 637.908 25.5894 7.65600 648.226 25.6287 7.50350 658.711 25.6534 7.34742 669.365 25.6628 7.19460 680.191 25.6596 7.06113 691.193 25.6608 6.94248 702.372 25.6757 6.82881 713.733 25.6945 6.70560 725.277 25.7048 6.57686 737.008 25.7089 6.45050 748.928 25.7087 6.32662 761.042 25.7053 6.20507 773.351 25.6994 6.08515 785.859 25.6906 5.96488 798.570 25.6759 5.84480 811.486 25.6561 5.72708 824.611 25.6319 5.61178 837.949 25.6037 5.49887 851.502 25.5715 5.38761 865.274 25.5350 5.27801 879.269 25.4936 5.17013 893.491 25.4475 5.06442 907.943 25.3969 4.96093 922.628 25.3428 4.85961 937.551 25.2832 4.75681 952.715 25.2169 4.65526 968.124 25.1430 4.55507 983.783 25.0617 4.45706 999.695 24.9729 4.36118 1015.86 24.8762 4.26740 1032.29 24.7714 4.17564 1048.99 24.6578 4.08507 1065.96 24.5334 3.99563 1083.20 24.3972 3.90798 1100.72 24.2482 3.82225 1118.52 24.0848 3.73840 1136.61 23.9053 3.65645 1155. 23.7075 3.57632 1173.68 23.4885 3.49798 1192.66 23.2446 3.42124 1211.95 22.9710 3.34624 1231.55 22.6617 3.27298 1251.47 22.3083 3.20135 1271.72 21.8995 3.13149 1292.29 21.4189 3.06339 1313.19 20.8413 2.99669 1334.43 20.1259 2.93141 1356.01 19.2002 2.86751 1377.94 17.9159 2.80518 1400.23 15.8838 2.74413 1422.88 11.2425 2.68425 1433.80 -9.16067 2.65616 1434. -9.15379 16.4055 1445.89 11.9859 16.2342 1469.28 16.9350 15.9067 1493.04 19.3189 15.5857 1517.19 20.8997 15.2740 1541.73 22.0662 14.9689 1566.67 22.9617 14.6699 1592.01 23.6407 14.3768 1617.76 24.0830 14.0897 1643.92 23.9200 13.8082 1651.90 21.5003 13.7244 1652.10 21.5059 15.6001 1670.51 25.0654 15.3744 1697.53 26.1650 15.0534 1724.99 26.9569 14.7391 1752.89 27.6121 14.4185 1781.24 28.1758 14.1004 1810.05 28.6722 13.7862 1839.32 29.1154 13.4790 1869.07 29.5163 13.1787 1899.30 29.8817 12.8849 1930.02 30.2170 12.5980 1961.24 30.5263 12.3174 1992.96 30.8102 12.0429 2025.20 31.0855 11.7824 2057.95 31.3440 11.5096 2091.24 31.5785 11.2412 2125.06 31.7954 10.9772 2159.43 31.9963 10.7179 2194.36 32.1827 10.4632 2229.85 32.3557 10.2132 2265.92 32.5165 9.96774 2302.57 32.6655 9.72676 2339.81 32.8040 9.49082 2377.66 32.9325 9.25902 2416.11 33.0515 9.03199 2455.19 33.1616 8.80949 2494.90 33.2639 8.59185 2535.26 33.3582 8.37818 2576.26 33.4453 8.16932 2617.93 33.5257 7.96484 2660.27 33.5997 7.76451 2703.30 33.6677 7.56869 2747.03 33.7299 7.37695 2791.46 33.7867 7.18953 2836.61 33.8385 7.00650 2882.49 33.8858 6.82741 2929.11 33.9286 6.65222 2976.48 33.9669 6.48092 3024.63 34.0012 6.31378 3073.55 34.0319 6.15069 3123.26 34.0593 5.99126 3173.78 34.0831 5.83532 3225.11 34.1038 5.68325 3277.27 34.1216 5.53479 3330.28 34.1366 5.38979 3384.15 34.1490 5.24833 3438.88 34.1589 5.11032 3494.50 34.1665 4.97558 3551.02 34.1719 4.84418 3608.46 34.1752 4.71598 3666.82 34.1766 4.59096 3726.13 34.1762 4.46898 3786.40 34.1741 4.35005 3847.64 34.1703 4.23413 3909.87 34.1651 4.12106 3973.11 34.1585 4.01086 4037.38 34.1505 3.90339 4102.68 34.1412 3.79871 4169.03 34.1308 3.69664 4236.46 34.1194 3.59721 4304.98 34.1068 3.50029 4374.62 34.0933 3.40589 4445.37 34.0790 3.31390 4517.27 34.0637 3.22426 4590.33 34.0477 3.13699 4664.58 34.0310 3.05195 4740.03 34.0136 2.96915 4816.69 33.9955 2.88846 4894.60 33.9768 2.80987 4973.77 33.9576 2.73340 5054.21 33.9378 2.65895 5135.96 33.9176 2.58640 5219.03 33.8969 2.51575 5303.44 33.8757 2.44699 5389.22 33.8541 2.38004 5476.39 33.8322 2.31490 5564.97 33.8099 2.25139 5654.98 33.7872 2.18962 5746.44 33.7641 2.12952 5839.39 33.7408 2.07105 5933.83 33.7172 2.01411 6029.81 33.6933 1.95872 6127.33 33.6690 1.90474 6226.44 33.6445 1.85226 6327.15 33.6197 1.80112 6429.48 33.5946 1.75142 6533.48 33.5692 1.70309 6639.15 33.5436 1.65594 6746.54 33.5175 1.61012 6855.65 33.4912 1.56560 6966.54 33.4646 1.52219 7079.22 33.4377 1.48005 7193.72 33.4104 1.43895 7310.07 33.3826 1.39897 7428.31 33.3545 1.36011 7548.45 33.3259 1.32229 7670.54 33.2968 1.28550 7794.61 33.2672 1.24970 7920.68 33.2370 1.21487 8048.79 33.2061 1.18098 8178.98 33.1746 1.14801 8311.26 33.1423 1.11595 8445.69 33.1091 1.08475 8582.29 33.0750 1.05439 8721.11 33.0399 1.02486 8862.16 33.0035 0.996119 9005.50 32.9659 0.968173 9151.16 32.9267 0.940974 9299.17 32.8859 0.914524 9449.58 32.8431 0.888791 9602.42 32.7982 0.863753 9757.73 32.7508 0.839401 9915.55 32.7005 0.815708 10075.9 32.6469 0.792654 10238.9 32.5893 0.770227 10404.5 32.5271 0.748408 10572.8 32.4593 0.727180 10743.8 32.3848 0.706528 10917.6 32.3020 0.686435 11094.2 32.2088 0.666886 11273.6 32.1023 0.647866 11455.9 31.9779 0.629361 11641.2 31.8291 0.611357 11829.5 31.6446 0.593839 12020.8 31.4039 0.576795 12215.3 31.0623 0.560210 12412.8 30.4902 0.544073 12613.6 28.7508 0.528371 12657.7 22.3125 0.525017 12657.9 22.3128 3.85811 12817.6 30.2182 3.78519 13025.0 31.1582 3.69390 13235.6 31.6814 3.60420 13449.7 32.0478 3.51608 13667.2 32.3297 3.42956 13888.3 32.5582 3.34463 14112.9 32.7495 3.26132 14341.2 32.9132 3.17960 14573.1 33.0555 3.09948 14808.9 33.1806 3.02096 15048.4 33.2917 2.94403 15291.8 33.3909 2.86868 15539.1 33.4800 2.79490 15790.4 33.5605 2.72267 16045.8 33.6333 2.65199 16305.4 33.6994 2.58283 16569.1 33.7596 2.51520 16837.1 33.8144 2.44905 17109.4 33.8645 2.38439 17386.1 33.9102 2.32119 17667.4 33.9520 2.25943 17953.1 33.9901 2.19909 18243.5 34.0250 2.14015 18538.6 34.0569 2.08259 18838.4 34.0861 2.02640 19143.1 34.1126 1.97154 19452.7 34.1369 1.91799 19767.4 34.1589 1.86574 20087.1 34.1789 1.81476 20412.0 34.1971 1.76502 20742.1 34.2135 1.71652 21077.6 34.2284 1.66921 21418.5 34.2417 1.62308 21765.0 34.2536 1.57811 22117.0 34.2643 1.53428 22474.7 34.2737 1.49155 22838.2 34.2820 1.44992 23207.6 34.2893 1.40935 23583.0 34.2955 1.36982 23964.4 34.3009 1.33132 24352.0 34.3054 1.29382 24745.9 34.3091 1.25729 25146.2 34.3121 1.22173 25552.9 34.3144 1.18709 25966.2 34.3161 1.15338 26386.1 34.3172 1.12055 26812.9 34.3177 1.08860 27246.6 34.3177 1.05750 27687.3 34.3172 1.02724 28135.1 34.3163 0.997790 28590.2 34.3149 0.969135 29052.6 34.3132 0.941255 29522.5 34.3111 0.914132 30000.0 34.3087 0.887748 periodictable-1.5.0/periodictable/xsf/si.nff000066400000000000000000000474261310514471200210520ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.94851 10.1617 -9999. 3.95531 10.3261 -9999. 3.96212 10.4931 -9999. 3.96894 10.6628 -9999. 3.97577 10.8353 -9999. 3.98262 11.0105 -9999. 3.98948 11.1886 -9999. 3.99635 11.3696 -9999. 4.00322 11.5535 -9999. 4.01012 11.7404 -9999. 4.01702 11.9303 -9999. 4.02394 12.1232 -9999. 4.00019 12.3193 -9999. 3.95930 12.5186 -9999. 3.91883 12.7210 -9999. 3.87876 12.9268 -9999. 3.83911 13.1359 -9999. 3.79987 13.3483 -9999. 3.76102 13.5642 -9999. 3.72257 13.7836 -9999. 3.68452 14.0066 -9999. 3.64513 14.2331 -9999. 3.55020 14.4633 -9999. 3.45774 14.6972 -9999. 3.36769 14.9350 -9999. 3.27998 15.1765 -9999. 3.19455 15.4220 -9999. 3.11136 15.6714 -9999. 3.03032 15.9249 -9999. 2.95140 16.1825 -9999. 2.83114 16.4442 -9999. 2.69869 16.7102 -9999. 2.57244 16.9805 -9999. 2.45210 17.2551 -9999. 2.33738 17.5342 -9999. 2.22803 17.8178 -9999. 2.12380 18.1060 -9999. 1.97554 18.3988 -9999. 1.76138 18.6964 -9999. 1.57043 18.9988 -9999. 1.40019 19.3061 -9999. 1.24840 19.6184 -9999. 1.11306 19.9357 -9999. 0.992396 20.2581 -9999. 0.862336 20.5858 -9999. 0.753564 20.9187 -9999. 0.698871 21.2571 -9999. 0.648148 21.6009 -9999. 0.602543 21.9503 -9999. 0.561516 22.3053 -9999. 0.523281 22.6661 -9999. 0.496895 23.0327 -9999. 0.478071 23.4052 -9999. 0.459962 23.7838 -9999. 0.442538 24.1685 -9999. 0.425774 24.5594 -9999. 0.413096 24.9566 -9999. 0.403041 25.3602 -9999. 0.393231 25.7704 -9999. 0.383660 26.1872 -9999. 0.374321 26.6108 -9999. 0.365210 27.0412 -9999. 0.366288 27.4786 -9999. 0.367374 27.9230 -9999. 0.368463 28.3747 -9999. 0.369555 28.8336 -9999. 0.370650 29.3000 3.83380 0.371749 29.7739 3.80691 0.372851 30.2554 3.78097 0.373956 30.7448 3.75582 0.375064 31.2421 3.73048 0.376176 31.7474 3.70550 0.378088 32.2609 3.68147 0.381996 32.7827 3.65905 0.385945 33.3129 3.63764 0.389935 33.8517 3.61703 0.393965 34.3992 3.59711 0.398038 34.9556 3.57779 0.402152 35.5210 3.55900 0.406309 36.0955 3.54071 0.410509 36.6793 3.52286 0.414753 37.2726 3.50545 0.419040 37.8754 3.48848 0.423372 38.4880 3.47200 0.427748 39.1106 3.45628 0.432170 39.7431 3.44176 0.435537 40.3860 3.42689 0.437136 41.0392 3.41050 0.438741 41.7029 3.39378 0.440351 42.3774 3.37667 0.441968 43.0629 3.35917 0.443590 43.7594 3.34130 0.445218 44.4671 3.32304 0.446852 45.1864 3.30440 0.448493 45.9172 3.28549 0.450139 46.6599 3.26615 0.451198 47.4146 3.24599 0.451979 48.1815 3.22476 0.452762 48.9608 3.20267 0.453547 49.7527 3.17964 0.454332 50.5574 3.15558 0.455119 51.3751 3.13042 0.455908 52.2061 3.10325 0.456698 53.0505 3.07444 0.458301 53.9085 3.04507 0.461948 54.7804 3.01545 0.465624 55.6665 2.98498 0.469328 56.5668 2.95338 0.473062 57.4817 2.92040 0.476826 58.4115 2.88519 0.480620 59.3562 2.84598 0.484444 60.3163 2.80606 0.494947 61.2918 2.76788 0.506504 62.2832 2.73042 0.518332 63.2906 2.69333 0.530436 64.3142 2.65696 0.542822 65.3545 2.62418 0.554884 66.4115 2.58874 0.558968 67.4857 2.54971 0.563081 68.5772 2.50917 0.567224 69.6864 2.46935 0.571398 70.8135 2.43129 0.566814 71.9588 2.38275 0.552979 73.1227 2.32504 0.539483 74.3054 2.26322 0.526316 75.5072 2.19828 0.504782 76.7285 2.11635 0.477417 77.9695 2.01618 0.451535 79.2306 1.90170 0.427364 80.5121 1.77437 0.422623 81.8143 1.64458 0.417936 83.1376 1.50518 0.413300 84.4823 1.34727 0.409326 85.8487 1.17621 0.415946 87.2373 0.995339 0.422674 88.6483 0.794497 0.429510 90.0821 0.568059 0.436457 91.5391 0.306962 0.444926 93.0197 0.161588E-02 0.456528 94.5242 -0.366911 0.468434 96.0530 -0.841388 0.480650 97.6066 -1.52605 0.495035 99.1853 -2.88115 0.517644 99.5000 -3.50392 0.522228 99.5240 -3.56793 0.517644 99.5490 -3.65086 0.517841 99.5760 -3.74861 0.521284 99.6010 -3.84977 0.535297 99.6260 -3.95788 0.552022 99.6490 -4.07048 0.581748 99.6760 -4.21370 0.630001 99.6990 -4.33738 0.708784 99.7260 -4.47439 0.813415 99.7490 -4.57087 0.941569 99.7750 -4.65499 1.07721 99.8260 -4.76959 1.37513 99.8510 -4.79109 1.52203 99.8750 -4.78699 1.65993 99.8990 -4.76674 1.77995 99.9260 -4.73984 1.87968 99.9510 -4.72571 1.97448 99.9740 -4.69897 2.05815 100.000 -4.67405 2.13311 100.030 -4.65490 2.20171 100.120 -4.60024 2.41667 100.180 -4.60059 2.49729 100.220 -4.62085 2.58505 100.250 -4.64510 2.62089 100.280 -4.70275 2.67241 100.300 -4.73916 2.73072 100.350 -4.82406 2.91360 100.380 -4.87754 3.01959 100.450 -4.89461 3.39622 100.480 -4.89177 3.52655 100.500 -4.87133 3.64732 100.550 -4.80557 3.86847 100.600 -4.71048 4.10668 100.620 -4.63514 4.23678 100.680 -4.54337 4.36464 100.700 -4.48607 4.49509 100.750 -4.33702 4.75764 100.770 -4.23325 4.85961 100.800 -4.07337 4.94637 100.850 -3.81798 5.07430 100.900 -3.56548 5.12335 101.000 -3.15785 5.13032 101.020 -3.08861 5.12048 101.250 -2.52100 5.15904 101.320 -2.30405 5.19959 101.380 -2.08534 5.20146 101.400 -2.00971 5.18989 101.450 -1.81270 5.13442 101.500 -1.65152 5.02977 101.600 -1.41105 4.78618 101.630 -1.36359 4.72648 101.650 -1.35292 4.65861 101.750 -1.25455 4.44125 101.820 -1.21389 4.30165 101.880 -1.19458 4.18620 101.900 -1.20985 4.13288 101.950 -1.20581 4.08850 102.000 -1.19801 3.97606 102.030 -1.22710 3.93010 102.050 -1.24904 3.89784 102.100 -1.28103 3.86731 102.150 -1.30990 3.80579 102.180 -1.33991 3.78427 102.250 -1.39700 3.76802 102.300 -1.42608 3.74849 102.350 -1.46728 3.74261 102.400 -1.50309 3.76084 102.450 -1.52538 3.79386 102.530 -1.50608 3.87484 102.550 -1.48153 3.89373 102.600 -1.42009 3.90179 102.650 -1.36279 3.88239 102.700 -1.31820 3.83958 102.780 -1.29202 3.76416 102.880 -1.29963 3.67993 102.950 -1.32951 3.64539 103.000 -1.34633 3.63286 103.120 -1.36198 3.65919 103.200 -1.32264 3.65521 103.280 -1.27117 3.62578 103.320 -1.25882 3.57767 103.350 -1.24200 3.56029 103.430 -1.23327 3.47903 103.450 -1.26147 3.44200 103.550 -1.32267 3.37538 103.600 -1.36022 3.35329 103.620 -1.37658 3.35242 103.700 -1.42690 3.33036 103.800 -1.48061 3.33205 103.880 -1.50969 3.33940 104.000 -1.53630 3.33472 104.100 -1.56167 3.31576 104.220 -1.62193 3.27368 104.280 -1.65400 3.27417 104.430 -1.72694 3.28606 104.470 -1.75387 3.27978 104.500 -1.76829 3.28791 104.530 -1.78693 3.28885 104.570 -1.80294 3.29751 104.650 -1.83679 3.30856 104.730 -1.87270 3.30556 104.750 -1.88124 3.31109 104.800 -1.90801 3.30176 104.900 -1.98706 3.33116 104.930 -2.00067 3.33359 104.950 -2.00298 3.34991 105.030 -2.04570 3.36298 105.150 -2.11934 3.39504 105.180 -2.13949 3.40977 105.250 -2.17952 3.43515 105.320 -2.21343 3.47153 105.350 -2.23848 3.47688 105.430 -2.28483 3.52378 105.500 -2.32999 3.56457 105.550 -2.35832 3.60198 105.600 -2.38578 3.64781 105.630 -2.39089 3.66569 105.750 -2.44861 3.77644 105.780 -2.45326 3.79743 105.850 -2.48245 3.88408 105.870 -2.48052 3.91584 105.970 -2.42689 4.01616 106.030 -2.39972 4.04717 106.070 -2.38240 4.06604 106.100 -2.37398 4.06874 106.230 -2.38361 4.11947 106.270 -2.37996 4.15308 106.320 -2.37462 4.16809 106.400 -2.36004 4.21391 106.430 -2.36196 4.22064 106.450 -2.36509 4.23983 106.550 -2.33925 4.28215 106.620 -2.33379 4.30894 106.650 -2.33507 4.32546 106.700 -2.32865 4.34622 106.750 -2.32543 4.37918 106.800 -2.31100 4.39528 106.870 -2.30275 4.43789 106.920 -2.28031 4.45074 106.970 -2.27262 4.47446 107.000 -2.25035 4.47193 107.150 -2.24976 4.52075 107.170 -2.23267 4.52195 107.200 -2.22431 4.53560 107.280 -2.22372 4.53468 107.300 -2.22218 4.54692 107.320 -2.21789 4.54827 107.350 -2.21747 4.55993 107.400 -2.22568 4.56521 107.420 -2.21201 4.58499 107.500 -2.21196 4.60002 107.530 -2.21439 4.60834 107.550 -2.21478 4.62406 107.580 -2.20227 4.63210 107.600 -2.20862 4.62922 107.620 -2.19987 4.64804 107.670 -2.19745 4.66695 107.730 -2.18227 4.67472 107.750 -2.19300 4.68717 107.850 -2.17068 4.70239 107.880 -2.18424 4.71832 107.930 -2.18294 4.73505 107.950 -2.19199 4.75539 108.070 -2.15772 4.79660 108.220 -2.13084 4.82955 108.280 -2.11240 4.85593 108.420 -2.08897 4.88059 108.450 -2.08958 4.88346 108.520 -2.07611 4.91320 108.570 -2.06068 4.91793 108.600 -2.05985 4.93016 108.730 -2.02793 4.92866 108.830 -2.03087 4.94162 108.900 -2.01993 4.96783 109.000 -1.99875 4.97239 109.030 -1.99361 4.97267 109.070 -1.99579 4.95935 109.120 -2.00066 4.97576 109.200 -2.00421 4.98276 109.250 -1.99981 4.99897 109.270 -1.98698 4.98829 109.350 -2.00603 4.99135 109.380 -2.00850 4.98316 109.400 -2.01211 4.99342 109.430 -2.02183 4.98967 109.450 -2.01515 5.00593 109.530 -2.04292 5.01580 109.550 -2.03376 5.03141 109.570 -2.03838 5.02656 109.600 -2.03677 5.04483 109.620 -2.03705 5.03873 109.670 -2.02773 5.05325 109.800 -2.05572 5.08673 109.970 -2.05841 5.12220 110.000 -2.08477 5.13791 110.500 -2.08318 5.28267 111.000 -2.07105 5.45779 111.500 -2.02987 5.61544 112.500 -1.94845 5.85909 114.000 -1.92517 6.16450 114.500 -1.96395 6.33338 115.000 -1.98987 6.51862 115.500 -1.96320 6.72312 117.000 -1.77809 7.40254 117.500 -1.61173 7.59488 118.000 -1.45934 7.77180 118.500 -1.28616 7.87553 119.000 -1.13984 8.02234 119.500 -0.959918 8.05843 121.433 -0.578394 8.42371 121.500 -0.573231 8.43660 122.000 -0.405651 8.51447 123.500 -0.264126E-01 8.67192 124.000 0.779155E-01 8.69958 124.500 0.171345 8.77704 125.000 0.293945 8.78726 127.000 0.572464 9.00076 127.500 0.671836 9.04215 128.500 0.827038 9.19455 129.500 0.995074 9.33439 130.000 1.11832 9.43724 131.500 1.53131 9.68832 133.000 2.07611 9.80683 133.500 2.28741 9.78221 134.500 2.61972 9.60861 136.000 2.84736 9.24827 136.500 2.87943 9.17385 137.000 2.87745 9.11857 137.500 2.85152 9.03612 139.500 2.83348 9.09883 140.000 2.84307 9.12631 140.500 2.88384 9.18357 141.500 3.00310 9.19764 142.000 3.03093 9.17508 142.500 3.03358 9.18522 143.000 3.03374 9.17393 144.000 3.03215 9.32209 145.000 3.09900 9.41818 145.500 3.16288 9.49844 146.000 3.22259 9.51997 146.500 3.28049 9.57995 147.000 3.34172 9.60862 147.500 3.41479 9.66258 148.000 3.48151 9.67350 148.500 3.56199 9.71113 149.500 3.68256 9.71835 150.000 3.70254 9.69979 150.500 3.68373 9.74096 151.000 3.69207 9.84710 151.500 3.76904 10.0037 152.000 3.94900 10.1180 152.500 4.15147 10.1431 153.500 4.47402 9.96424 154.500 4.52214 9.69132 155.000 4.47788 9.64167 155.500 4.41664 9.63644 156.000 4.38177 9.66128 156.500 4.35929 9.73288 157.500 4.39020 9.79855 158.000 4.36737 9.87036 158.500 4.42951 9.99628 159.000 4.48663 9.99841 160.000 4.57954 10.1071 162.500 4.84589 10.5019 163.500 5.05409 10.6336 164.500 5.27583 10.7324 165.500 5.50795 10.7656 166.500 5.73389 10.8239 167.000 5.79695 10.7800 167.500 5.86489 10.9015 169.000 6.35522 10.9520 170.000 6.66644 10.9210 171.500 7.13398 10.7554 172.000 7.24279 10.5495 172.500 7.29281 10.5369 173.000 7.38343 10.4391 173.500 7.52303 10.4208 174.000 7.60600 10.1923 174.500 7.64212 10.1249 175.000 7.66842 9.98038 176.000 7.68591 9.82584 176.500 7.67332 9.72546 177.000 7.68563 9.66145 178.000 7.67511 9.60542 178.500 7.69740 9.51565 179.000 7.64095 9.49283 179.500 7.63925 9.43704 179.990 7.55398 9.49765 182.901 7.85149 9.42072 185.859 7.94847 9.34442 188.866 8.10574 9.26640 191.920 8.27005 9.17918 195.025 8.43202 9.09278 198.179 8.59128 9.00719 201.384 8.74251 8.92241 204.641 8.88646 8.85010 207.951 9.03960 8.78533 211.315 9.19861 8.72104 214.733 9.36085 8.65722 218.206 9.53668 8.59386 221.735 9.72509 8.52313 225.322 9.90451 8.41115 228.966 10.0644 8.30065 232.669 10.2142 8.19159 236.432 10.3574 8.08397 240.257 10.4958 7.97776 244.143 10.6314 7.87295 248.091 10.7716 7.76952 252.104 10.9063 7.65024 256.182 11.0283 7.53005 260.325 11.1426 7.41174 264.536 11.2509 7.29529 268.814 11.3543 7.18067 273.162 11.4535 7.06784 277.580 11.5489 6.95680 282.070 11.6411 6.84750 286.632 11.7306 6.73991 291.268 11.8181 6.63402 295.979 11.9057 6.52979 300.767 11.9918 6.42157 305.631 12.0733 6.31071 310.575 12.1486 6.20175 315.598 12.2203 6.09469 320.702 12.2889 5.98947 325.890 12.3551 5.88607 331.161 12.4191 5.78445 336.517 12.4812 5.68459 341.960 12.5420 5.58645 347.491 12.6018 5.49000 353.111 12.6614 5.39523 358.822 12.7222 5.30208 364.626 12.7889 5.21055 370.523 12.8576 5.10056 376.516 12.9142 4.98768 382.606 12.9608 4.87731 388.795 13.0027 4.76937 395.083 13.0407 4.66382 401.473 13.0753 4.56061 407.967 13.1069 4.45967 414.565 13.1360 4.36098 421.270 13.1628 4.26447 428.084 13.1876 4.17009 435.008 13.2107 4.07781 442.044 13.2322 3.98756 449.194 13.2527 3.89931 456.459 13.2727 3.81302 463.842 13.2933 3.72727 471.344 13.3117 3.63809 478.968 13.3260 3.55105 486.715 13.3375 3.46608 494.587 13.3472 3.38316 502.587 13.3552 3.30221 510.715 13.3617 3.22320 518.976 13.3670 3.14609 527.370 13.3711 3.07081 535.900 13.3742 2.99734 544.567 13.3764 2.92563 553.375 13.3779 2.85563 562.326 13.3789 2.78730 571.421 13.3797 2.72061 580.663 13.3815 2.65552 590.055 13.3832 2.58813 599.599 13.3823 2.52006 609.297 13.3786 2.45378 619.151 13.3731 2.38925 629.166 13.3663 2.32641 639.342 13.3582 2.26522 649.683 13.3491 2.20565 660.191 13.3390 2.14764 670.869 13.3278 2.09115 681.720 13.3158 2.03616 692.746 13.3006 1.98261 703.951 13.2845 1.93392 715.336 13.2706 1.88812 726.906 13.2578 1.84339 738.664 13.2453 1.79973 750.611 13.2332 1.75710 762.751 13.2215 1.71548 775.088 13.2102 1.67484 787.625 13.1996 1.63517 800.364 13.1912 1.59508 813.309 13.1807 1.55256 826.464 13.1685 1.51118 839.831 13.1555 1.47089 853.415 13.1418 1.43168 867.218 13.1278 1.39352 881.245 13.1136 1.35637 895.498 13.1001 1.32021 909.982 13.0874 1.28196 924.700 13.0717 1.24308 939.656 13.0542 1.20538 954.855 13.0353 1.16882 970.299 13.0154 1.13337 985.992 12.9946 1.09899 1001.94 12.9729 1.06561 1018.15 12.9502 1.03318 1034.61 12.9266 1.00174 1051.35 12.9020 0.971249 1068.35 12.8761 0.941688 1085.63 12.8487 0.913028 1103.19 12.8192 0.887547 1121.03 12.7911 0.864407 1139.17 12.7632 0.841817 1157.59 12.7350 0.819826 1176.31 12.7063 0.798411 1195.34 12.6771 0.777531 1214.67 12.6470 0.757139 1234.32 12.6159 0.737234 1254.28 12.5837 0.717856 1274.57 12.5503 0.698989 1295.19 12.5156 0.680609 1316.13 12.4792 0.662552 1337.42 12.4409 0.644954 1359.05 12.4006 0.627806 1381.04 12.3579 0.611117 1403.37 12.3125 0.594814 1426.07 12.2640 0.578892 1449.14 12.2120 0.563357 1472.58 12.1559 0.548240 1496.39 12.0950 0.533519 1520.60 12.0284 0.518512 1545.19 11.9546 0.503884 1570.18 11.8721 0.489627 1595.58 11.7790 0.475781 1621.39 11.6727 0.462322 1647.61 11.5493 0.449240 1674.26 11.4029 0.436529 1701.34 11.2243 0.424180 1728.86 10.9982 0.412181 1756.82 10.6935 0.399995 1785.24 10.2377 0.388066 1814.11 9.37942 0.376400 1815. 9.33435 0.376049 1838.80 2.82013 0.366843 1839. 2.82204 2.26608 1838.90 7.96957 4.15773 1860. 9.34866 4.09222 1890.08 10.4859 4.00184 1920.65 11.1017 3.91340 1951.72 11.5305 3.82687 1983.29 11.8609 3.74224 2015.37 12.1301 3.65896 2047.96 12.3571 3.57698 2081.09 12.5533 3.49664 2114.75 12.7254 3.41523 2148.95 12.8775 3.33521 2183.71 13.0131 3.25641 2219.03 13.1350 3.17868 2254.92 13.2452 3.10245 2291.39 13.3453 3.02741 2328.45 13.4369 2.95359 2366.11 13.5205 2.88121 2404.38 13.5972 2.80993 2443.27 13.6676 2.74011 2482.79 13.7324 2.67152 2522.95 13.7921 2.60424 2563.75 13.8472 2.53844 2605.22 13.8981 2.47374 2647.36 13.9449 2.41045 2690.18 13.9882 2.34854 2733.69 14.0282 2.28769 2777.90 14.0651 2.22827 2822.83 14.0991 2.17014 2868.49 14.1305 2.11320 2914.89 14.1594 2.05756 2962.03 14.1859 2.00307 3009.94 14.2104 1.94988 3058.62 14.2329 1.89788 3108.09 14.2535 1.84703 3158.37 14.2723 1.79742 3209.45 14.2894 1.74890 3261.36 14.3051 1.70154 3314.11 14.3194 1.65534 3367.71 14.3322 1.61015 3422.18 14.3438 1.56612 3477.53 14.3542 1.52314 3533.78 14.3635 1.48119 3590.94 14.3718 1.44032 3649.02 14.3791 1.40039 3708.04 14.3855 1.36149 3768.01 14.3910 1.32359 3828.96 14.3957 1.28658 3890.89 14.3997 1.25056 3953.82 14.4029 1.21543 4017.77 14.4055 1.18120 4082.75 14.4075 1.14788 4148.79 14.4089 1.11537 4215.89 14.4097 1.08375 4284.08 14.4101 1.05295 4353.37 14.4100 1.02294 4423.78 14.4094 0.993744 4495.33 14.4085 0.965295 4568.04 14.4071 0.937606 4641.93 14.4054 0.910663 4717.01 14.4034 0.884415 4793.30 14.4011 0.858896 4870.83 14.3984 0.834074 4949.61 14.3956 0.809917 5029.67 14.3925 0.786429 5111.02 14.3891 0.763535 5193.68 14.3856 0.741289 5277.69 14.3818 0.719672 5363.05 14.3779 0.698635 5449.79 14.3739 0.678189 5537.94 14.3697 0.658294 5627.51 14.3654 0.638950 5718.53 14.3609 0.620147 5811.02 14.3564 0.601873 5905.01 14.3517 0.584116 6000.52 14.3470 0.566843 6097.57 14.3422 0.550055 6196.20 14.3374 0.533751 6296.42 14.3325 0.517913 6349. 14.3300 0.509889 6432. 14.3259 0.497536 6536.03 14.3209 0.482727 6641.75 14.3159 0.468336 6749.17 14.3109 0.454339 6858.33 14.3059 0.440746 6969.26 14.3008 0.427550 7081.98 14.2958 0.414725 7196.53 14.2907 0.402271 7312.93 14.2857 0.390179 7431.21 14.2806 0.378427 7551.40 14.2756 0.367020 7673.54 14.2706 0.355946 7797.65 14.2657 0.345189 7923.77 14.2607 0.334747 8051.94 14.2558 0.324605 8182.17 14.2510 0.314762 8314.51 14.2461 0.305207 8448.99 14.2414 0.295929 8585.64 14.2366 0.286926 8724.51 14.2319 0.278183 8865.62 14.2273 0.269697 9009.02 14.2227 0.261465 9154.73 14.2181 0.253469 9302.80 14.2136 0.245713 9453.27 14.2091 0.238188 9606.17 14.2047 0.230880 9761.54 14.2004 0.223790 9919.42 14.1961 0.216911 10079.9 14.1919 0.210235 10242.9 14.1877 0.203758 10408.6 14.1836 0.197474 10576.9 14.1795 0.191376 10748.0 14.1756 0.185461 10921.8 14.1716 0.179721 11098.5 14.1677 0.174154 11278.0 14.1639 0.168752 11460.4 14.1602 0.163513 11645.8 14.1565 0.158430 11834.1 14.1528 0.153500 12025.5 14.1492 0.148717 12220.0 14.1457 0.144079 12417.7 14.1423 0.139580 12618.5 14.1389 0.135216 12822.6 14.1355 0.130984 13030.0 14.1322 0.126879 13240.8 14.1290 0.122899 13454.9 14.1258 0.119038 13672.6 14.1227 0.115294 13893.7 14.1197 0.111664 14118.4 14.1167 0.108143 14346.8 14.1137 0.104730 14578.8 14.1108 0.101419 14814.6 14.1080 0.982093E-01 15054.2 14.1052 0.950968E-01 15297.7 14.1025 0.920790E-01 15545.2 14.0998 0.891530E-01 15796.6 14.0972 0.863160E-01 16052.1 14.0946 0.835654E-01 16311.7 14.0921 0.808987E-01 16575.5 14.0896 0.783132E-01 16843.6 14.0872 0.758067E-01 17116.1 14.0848 0.733767E-01 17392.9 14.0825 0.710210E-01 17674.2 14.0802 0.687373E-01 17960.1 14.0780 0.665234E-01 18250.6 14.0758 0.643773E-01 18545.8 14.0736 0.622970E-01 18845.7 14.0715 0.602804E-01 19150.5 14.0695 0.583256E-01 19460.3 14.0675 0.564308E-01 19775.0 14.0655 0.545942E-01 20094.9 14.0636 0.528124E-01 20419.9 14.0617 0.510884E-01 20750.2 14.0598 0.494193E-01 21085.8 14.0580 0.478034E-01 21426.8 14.0562 0.462390E-01 21773.4 14.0545 0.447245E-01 22125.6 14.0528 0.432583E-01 22483.4 14.0511 0.418390E-01 22847.1 14.0495 0.404650E-01 23216.6 14.0479 0.391349E-01 23592.1 14.0463 0.378475E-01 23973.7 14.0448 0.366013E-01 24361.5 14.0433 0.353950E-01 24755.5 14.0419 0.342274E-01 25155.9 14.0405 0.330973E-01 25562.8 14.0391 0.320035E-01 25976.2 14.0377 0.309448E-01 26396.4 14.0364 0.299202E-01 26823.3 14.0351 0.289286E-01 27257.2 14.0338 0.279690E-01 27698.0 14.0326 0.270403E-01 28146.0 14.0314 0.261415E-01 28601.3 14.0302 0.252718E-01 29063.9 14.0291 0.244301E-01 29533.9 14.0279 0.236157E-01 30000.0 14.0269 0.228464E-01 periodictable-1.5.0/periodictable/xsf/sm.nff000066400000000000000000000316311310514471200210450ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.187643 10.1617 -9999. 0.195336 10.3261 -9999. 0.203345 10.4931 -9999. 0.211681 10.6628 -9999. 0.220360 10.8353 -9999. 0.229394 11.0106 -9999. 0.238799 11.1886 -9999. 0.248589 11.3696 -9999. 0.258781 11.5535 -9999. 0.269391 11.7404 -9999. 0.280435 11.9303 -9999. 0.291933 12.1232 -9999. 0.303902 12.3193 -9999. 0.315122 12.5186 -9999. 0.326091 12.7210 -9999. 0.337442 12.9268 -9999. 0.349187 13.1359 -9999. 0.361342 13.3483 -9999. 0.373919 13.5642 -9999. 0.386934 13.7836 -9999. 0.399806 14.0066 -9999. 0.411591 14.2331 -9999. 0.423723 14.4633 -9999. 0.436213 14.6973 -9999. 0.449071 14.9350 -9999. 0.462308 15.1765 -9999. 0.475936 15.4220 -9999. 0.488902 15.6714 -9999. 0.501112 15.9249 -9999. 0.513626 16.1825 -9999. 0.526453 16.4442 -9999. 0.539600 16.7102 -9999. 0.553075 16.9805 -9999. 0.566841 17.2551 -9999. 0.579760 17.5342 -9999. 0.592972 17.8178 -9999. 0.606486 18.1060 -9999. 0.620308 18.3989 -9999. 0.634445 18.6964 -9999. 0.653063 18.9988 -9999. 0.676143 19.3061 -9999. 0.700039 19.6184 -9999. 0.724780 19.9357 -9999. 0.784056 20.2582 -9999. 0.883332 20.5858 -9999. 1.09093 20.9188 -9999. 1.46853 21.2571 -9999. 1.67010 21.6009 -9999. 1.69471 21.9503 -9999. 1.71967 22.3053 -9999. 1.86242 22.6661 -9999. 2.36732 23.0327 -9999. 2.78527 23.4053 -9999. 2.93280 23.7838 -9999. 2.76046 24.1685 -9999. 3.25280 24.5594 -9999. 6.09720 24.9566 -9999. 6.85931 25.3603 -9999. 8.39557 25.7705 -9999. 9.52920 26.1873 -9999. 10.4409 26.6109 -9999. 11.0802 27.0413 -9999. 11.4150 27.4786 -9999. 11.6261 27.9231 -9999. 11.8410 28.3747 -9999. 12.0600 28.8337 -9999. 12.1251 29.3000 3.67989 12.1732 29.7739 4.48481 12.2215 30.2555 5.29747 11.8462 30.7449 5.78823 11.4180 31.2421 6.13025 11.1392 31.7475 6.45226 10.8773 32.2609 6.72631 10.6236 32.7827 6.97408 10.4245 33.3130 7.21595 10.2292 33.8518 7.45001 10.0374 34.3993 7.66944 9.81508 34.9557 7.83314 9.58734 35.5211 7.95815 9.39447 36.0956 8.06517 9.21136 36.6794 8.12784 9.05710 37.2727 8.21301 8.95389 37.8755 8.31454 8.85188 38.4882 8.42555 8.75100 39.1107 8.53469 8.62261 39.7432 8.62101 8.49238 40.3861 8.68864 8.36412 41.0393 8.73853 8.24511 41.7031 8.77940 8.13213 42.3776 8.80390 8.02070 43.0630 8.79972 7.91079 43.7595 8.75345 7.85618 44.4673 8.74672 7.83991 45.1865 8.75021 7.82365 45.9174 8.74685 7.82414 46.6600 8.76634 7.83959 47.4147 8.79872 7.85506 48.1816 8.83798 7.87056 48.9609 8.88246 7.88610 49.7528 8.93104 7.90166 50.5576 8.98296 7.91726 51.3753 9.03769 7.93289 52.2062 9.09488 7.94854 53.0506 9.15429 7.96424 53.9087 9.21576 7.97995 54.7806 9.27926 7.99571 55.6667 9.34485 8.01149 56.5670 9.41271 8.02730 57.4820 9.48317 8.04314 58.4117 9.55682 8.05902 59.3564 9.63468 8.07493 60.3165 9.71869 8.09086 61.2921 9.81342 8.10683 62.2834 9.93583 8.12258 63.2908 10.0538 8.06486 64.3145 10.1420 8.00755 65.3547 10.2121 7.95066 66.4118 10.2712 7.89416 67.4859 10.3210 7.83806 68.5775 10.3626 7.78237 69.6867 10.3965 7.72707 70.8138 10.4231 7.67216 71.9591 10.4424 7.61765 73.1230 10.4545 7.56352 74.3057 10.4592 7.50977 75.5076 10.4560 7.45641 76.7289 10.4442 7.40343 77.9699 10.4206 7.35082 79.2310 10.3904 7.31125 80.5125 10.3583 7.27231 81.8147 10.3221 7.23357 83.1380 10.2803 7.19505 84.4827 10.2327 7.15672 85.8491 10.1803 7.11861 87.2377 10.1288 7.08069 88.6487 10.0658 7.02009 90.0825 9.98247 6.95914 91.5395 9.88342 6.89871 93.0201 9.77015 6.83880 94.5246 9.64395 6.77942 96.0535 9.50854 6.72055 97.6071 9.38136 6.65219 99.1858 9.21400 6.52657 100.790 8.99910 6.40332 102.420 8.74616 6.28240 104.077 8.46619 6.16376 105.760 8.18923 6.04736 107.471 7.98315 5.76749 109.209 7.47769 5.31242 110.975 6.74254 4.89326 112.770 5.78224 4.56480 114.594 4.68996 4.31173 116.448 3.39911 4.08331 118.331 1.84323 3.88138 120.245 -0.126763 3.68942 122.190 -2.69754 3.61752 124.166 -6.66110 3.60649 126.175 -11.9181 5.74129 128.215 -17.7288 10.0510 130.289 -24.0933 17.7139 132.397 -29.4826 40.6437 134.538 -14.4932 61.6573 136.714 11.3596 48.3033 138.925 13.4249 38.5673 141.172 13.1399 39.2774 143.456 18.5220 38.9314 145.776 20.9031 34.8056 148.134 21.9813 32.8474 150.530 23.1756 31.1344 152.964 24.2213 29.5108 155.439 25.0857 27.9718 157.953 25.7767 26.5131 160.507 26.3055 25.1305 163.103 26.6707 23.8199 165.742 26.7506 22.6759 168.422 26.8924 21.7892 171.146 27.0758 20.9373 173.915 27.2272 20.1186 176.727 27.3378 19.3320 179.586 27.3986 18.5761 182.491 27.3767 17.8498 185.442 27.2860 17.2560 188.442 27.2475 16.7480 191.489 27.2237 16.2550 194.587 27.1940 15.7765 197.734 27.1491 15.3120 200.932 27.0809 14.8613 204.182 26.9758 14.4238 207.485 26.7704 14.0581 210.840 26.6234 13.7991 214.251 26.5218 13.5450 217.716 26.4233 13.2955 221.237 26.3171 13.0506 224.816 26.1873 12.8102 228.452 25.9581 12.6363 232.147 25.8060 12.5773 235.902 25.7218 12.5186 239.717 25.6607 12.4602 243.595 25.6159 12.4020 247.535 25.5822 12.3441 251.538 25.5558 12.2865 255.607 25.5329 12.2292 259.741 25.5085 12.1721 263.942 25.4668 12.1228 268.211 25.4417 12.1103 272.549 25.4323 12.0977 276.957 25.4318 12.0852 281.437 25.4356 12.0726 285.989 25.4406 12.0601 290.615 25.4434 12.0476 295.315 25.4377 12.0351 300.092 25.4022 12.0226 304.945 25.3565 12.0903 309.878 25.3530 12.1845 314.890 25.3857 12.2794 319.983 25.4379 12.3750 325.158 25.5074 12.4714 330.418 25.5936 12.5686 335.762 25.6974 12.6665 341.192 25.8259 12.7651 346.711 25.9744 12.8353 352.319 26.1169 12.8938 358.017 26.2625 12.9592 363.808 26.4205 13.0250 369.692 26.6021 13.0911 375.672 26.8053 13.1317 381.748 27.0028 13.1524 387.922 27.2045 13.1731 394.197 27.4602 13.1938 400.573 27.7017 13.1095 407.052 27.8954 13.0206 413.635 28.0665 12.9322 420.326 28.2227 12.8444 427.124 28.3670 12.7573 434.032 28.5013 12.6707 441.052 28.6266 12.5847 448.186 28.7414 12.4993 455.435 28.8451 12.4204 462.802 28.9490 12.3501 470.287 29.0520 12.2801 477.894 29.1526 12.2106 485.623 29.2505 12.1415 493.478 29.3457 12.0728 501.459 29.4384 12.0045 509.570 29.5288 11.9365 517.812 29.6172 11.8690 526.187 29.7048 11.8018 534.698 29.7945 11.7350 543.346 29.8858 11.6573 552.134 29.9705 11.5735 561.065 30.0471 11.4825 570.139 30.1124 11.3886 579.361 30.1681 11.2969 588.732 30.2169 11.2063 598.254 30.2598 11.1169 607.930 30.2970 11.0282 617.763 30.3294 10.9402 627.755 30.3597 10.8523 637.908 30.3863 10.7576 648.226 30.4044 10.6529 658.711 30.4035 10.5422 669.365 30.3827 10.4327 680.191 30.3440 10.3400 691.193 30.3044 10.2601 702.372 30.2741 10.1827 713.733 30.2414 10.0891 725.277 30.1884 9.98484 737.008 30.1177 9.88152 748.928 30.0316 9.77931 761.042 29.9310 9.67802 773.351 29.8166 9.57598 785.859 29.6854 9.46862 798.570 29.5290 9.35722 811.486 29.3476 9.24738 824.611 29.1406 9.13867 837.949 28.9064 9.03111 851.502 28.6417 8.92277 865.274 28.3419 8.81322 879.269 27.9994 8.70279 893.491 27.6092 8.59372 907.943 27.1642 8.48604 922.628 26.6564 8.37975 937.551 26.0696 8.26918 952.715 25.3843 8.15848 968.124 24.5735 8.04787 983.783 23.6009 7.93903 999.695 22.4089 7.83112 1015.86 20.9003 7.72409 1032.29 18.8895 7.61393 1048.99 15.9650 7.50411 1065.96 10.8265 7.39460 1083.20 -23.6926 7.28668 1083.30 -29.0953 7.28606 1083.50 -29.0928 31.6445 1100.72 10.9604 31.6276 1118.52 16.5827 31.6104 1136.61 19.9638 31.5930 1155. 22.4386 31.5757 1173.68 24.4225 31.5585 1192.66 26.0997 31.5410 1211.95 27.5683 31.5236 1231.55 28.8870 31.5063 1251.47 30.0941 31.4896 1271.72 31.2161 31.4732 1292.29 32.2725 31.4573 1313.19 33.2781 31.4416 1334.43 34.2445 31.4259 1356.01 35.1815 31.4100 1377.94 36.0981 31.3941 1400.23 37.0040 31.3783 1422.88 37.9111 31.3624 1445.89 38.8430 31.3469 1469.28 39.8460 31.2682 1493.04 40.9287 31.0935 1517.19 41.6229 30.5206 1541.73 41.7905 30.3890 1566.67 43.0125 31.1611 1592.01 44.5181 30.6883 1617.76 45.4958 30.0368 1643.92 46.2652 29.3991 1670.51 46.7543 28.7751 1697.53 46.9732 28.4528 1724.99 47.8102 28.6694 1752.89 48.8525 28.2188 1781.24 49.6129 27.6305 1810.05 50.2561 27.0516 1839.32 50.8268 26.4846 1869.07 51.3445 25.9293 1899.30 51.8191 25.3856 1930.02 52.2577 24.8536 1961.24 52.6651 24.3327 1992.96 53.0410 23.8226 2025.20 53.4090 23.3356 2057.95 53.7569 22.8334 2091.24 54.0741 22.3398 2125.06 54.3695 21.8549 2159.43 54.6444 21.3780 2194.36 54.9009 20.9102 2229.85 55.1397 20.4501 2265.92 55.3619 19.9990 2302.57 55.5692 19.5565 2339.81 55.7624 19.1221 2377.66 55.9418 18.6956 2416.11 56.1082 18.2774 2455.19 56.2624 17.8675 2494.90 56.4051 17.4655 2535.26 56.5370 17.0716 2576.26 56.6586 16.6856 2617.93 56.7703 16.3072 2660.27 56.8730 15.9367 2703.30 56.9664 15.5733 2747.03 57.0515 15.2180 2791.46 57.1286 14.8694 2836.61 57.1981 14.5287 2882.49 57.2599 14.1944 2929.11 57.3150 13.8681 2976.48 57.3638 13.5481 3024.63 57.4061 13.2349 3073.55 57.4420 12.9279 3123.26 57.4716 12.6279 3173.78 57.4960 12.3348 3225.11 57.5151 12.0476 3277.27 57.5288 11.7668 3330.28 57.5375 11.4920 3384.15 57.5414 11.2232 3438.88 57.5405 10.9603 3494.50 57.5350 10.7033 3551.02 57.5251 10.4519 3608.46 57.5108 10.2060 3666.82 57.4923 9.96565 3726.13 57.4696 9.73066 3786.40 57.4428 9.50083 3847.64 57.4119 9.27620 3909.87 57.3770 9.05659 3973.11 57.3380 8.84191 4037.38 57.2951 8.63210 4102.68 57.2482 8.42703 4169.03 57.1972 8.22642 4236.46 57.1420 8.03052 4304.98 57.0826 7.83891 4374.62 57.0188 7.65174 4445.37 56.9505 7.46877 4517.27 56.8774 7.28994 4590.33 56.7995 7.11527 4664.58 56.7164 6.94441 4740.03 56.6277 6.77752 4816.69 56.5331 6.61443 4894.60 56.4322 6.45499 4973.77 56.3244 6.29934 5054.21 56.2091 6.14716 5135.96 56.0854 5.99837 5219.03 55.9525 5.85303 5303.44 55.8092 5.71104 5389.22 55.6542 5.57232 5476.39 55.4858 5.43666 5564.97 55.3018 5.30422 5654.98 55.0996 5.17468 5746.44 54.8757 5.04828 5839.39 54.6255 4.92457 5933.83 54.3427 4.80378 6029.81 54.0184 4.68575 6127.33 53.6395 4.57018 6226.44 53.1852 4.45744 6327.15 52.6205 4.34728 6429.48 51.8768 4.23965 6533.48 50.7892 4.13439 6639.15 48.7285 4.03168 6716.10 32.8682 3.95950 6716.30 32.8693 11.4876 6746.54 46.6005 11.3890 6855.65 50.1964 11.0435 6966.54 51.3796 10.7083 7079.22 51.8655 10.3833 7193.72 51.7456 10.0681 7310.07 47.2296 9.76239 7311.70 43.8229 9.75823 7311.90 43.8242 13.5243 7428.31 52.6752 13.1281 7548.45 53.6945 12.7375 7670.54 53.9953 12.3584 7736.70 50.8676 12.1601 7736.90 50.8705 13.9217 7794.61 54.5294 13.7754 7920.68 55.7174 13.4646 8048.79 56.4843 13.1578 8178.98 57.0922 12.8558 8311.26 57.6046 12.5583 8445.69 58.0492 12.2654 8582.29 58.4413 11.9768 8721.11 58.7910 11.6931 8862.16 59.1056 11.4145 9005.50 59.3903 11.1405 9151.16 59.6486 10.8712 9299.17 59.8838 10.6069 9449.58 60.0988 10.3477 9602.42 60.2955 10.0933 9757.73 60.4757 9.84361 9915.55 60.6408 9.59912 10075.9 60.7925 9.35927 10238.9 60.9315 9.12426 10404.5 61.0589 8.89408 10572.8 61.1758 8.66866 10743.8 61.2829 8.44800 10917.6 61.3808 8.23204 11094.2 61.4704 8.02074 11273.6 61.5521 7.81405 11455.9 61.6264 7.61192 11641.2 61.6940 7.41429 11829.5 61.7552 7.22111 12020.8 61.8105 7.03231 12215.3 61.8603 6.84785 12412.8 61.9049 6.66765 12613.6 61.9446 6.49165 12817.6 61.9798 6.31979 13025.0 62.0107 6.15199 13235.6 62.0376 5.98820 13449.7 62.0608 5.82834 13667.2 62.0805 5.67235 13888.3 62.0969 5.52016 14112.9 62.1103 5.37169 14341.2 62.1208 5.22688 14573.1 62.1285 5.08566 14808.9 62.1338 4.94796 15048.4 62.1366 4.81371 15291.8 62.1373 4.68284 15539.1 62.1359 4.55528 15790.4 62.1325 4.43097 16045.8 62.1273 4.30984 16305.4 62.1204 4.19181 16569.1 62.1119 4.07683 16837.1 62.1020 3.96482 17109.4 62.0906 3.85573 17386.1 62.0780 3.74949 17667.4 62.0641 3.64602 17953.1 62.0491 3.54528 18243.5 62.0331 3.44720 18538.6 62.0161 3.35172 18838.4 61.9981 3.25877 19143.1 61.9794 3.16830 19452.7 61.9598 3.08025 19767.4 61.9394 2.99456 20087.1 61.9184 2.91118 20412.0 61.8968 2.83004 20742.1 61.8745 2.75110 21077.6 61.8517 2.67430 21418.5 61.8283 2.59960 21765.0 61.8045 2.52692 22117.0 61.7802 2.45624 22474.7 61.7555 2.38749 22838.2 61.7303 2.32063 23207.6 61.7048 2.25561 23583.0 61.6789 2.19238 23964.4 61.6526 2.13090 24352.0 61.6260 2.07112 24745.9 61.5990 2.01300 25146.2 61.5718 1.95650 25552.9 61.5441 1.90157 25966.2 61.5162 1.84817 26386.1 61.4879 1.79627 26812.9 61.4593 1.74582 27246.6 61.4304 1.69678 27687.3 61.4010 1.64912 28135.1 61.3713 1.60281 28590.2 61.3413 1.55779 29052.6 61.3111 1.51405 29522.5 61.2843 1.47154 30000.0 61.2356 1.43024 periodictable-1.5.0/periodictable/xsf/sn.nff000066400000000000000000000317671310514471200210600ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.97344 10.1617 -9999. 3.94095 10.3261 -9999. 3.90871 10.4931 -9999. 3.87675 10.6628 -9999. 3.84504 10.8353 -9999. 3.81359 11.0106 -9999. 3.78240 11.1886 -9999. 3.75146 11.3696 -9999. 3.72078 11.5535 -9999. 3.64688 11.7404 -9999. 3.57189 11.9303 -9999. 3.49845 12.1232 -9999. 3.42652 12.3193 -9999. 3.30574 12.5186 -9999. 3.15089 12.7210 -9999. 3.00330 12.9268 -9999. 2.86262 13.1359 -9999. 2.72511 13.3483 -9999. 2.48316 13.5642 -9999. 2.26270 13.7836 -9999. 2.06181 14.0066 -9999. 1.89987 14.2331 -9999. 1.75449 14.4633 -9999. 1.62024 14.6973 -9999. 1.49626 14.9350 -9999. 1.38177 15.1765 -9999. 1.27604 15.4220 -9999. 1.18242 15.6714 -9999. 1.10196 15.9249 -9999. 1.02698 16.1825 -9999. 0.957105 16.4442 -9999. 0.892970 16.7102 -9999. 0.849459 16.9805 -9999. 0.808068 17.2551 -9999. 0.768695 17.5342 -9999. 0.736073 17.8178 -9999. 0.710695 18.1060 -9999. 0.686194 18.3989 -9999. 0.662536 18.6964 -9999. 0.646280 18.9988 -9999. 0.633782 19.3061 -9999. 0.621526 19.6184 -9999. 0.609507 19.9357 -9999. 0.602556 20.2582 -9999. 0.600727 20.5858 -9999. 0.598903 20.9188 -9999. 0.598391 21.2571 -9999. 0.611967 21.6009 -9999. 0.625852 21.9503 -9999. 0.640967 22.3053 -9999. 0.671939 22.6661 -9999. 0.704407 23.0327 -9999. 0.759304 23.4053 -9999. 0.855339 23.7838 -9999. 1.13890 24.1685 -9999. 1.85247 24.5594 -9999. 3.05677 24.9566 -9999. 3.71424 25.3603 -9999. 4.00664 25.7705 -9999. 4.16638 26.1873 -9999. 4.33249 26.6109 -9999. 4.50523 27.0413 -9999. 4.64204 27.4786 -9999. 4.71650 27.9231 -9999. 4.79216 28.3747 -9999. 4.86903 28.8337 -9999. 4.94188 29.3000 -0.617521 4.84384 29.7739 -0.530603 4.74774 30.2555 -0.493238 4.65354 30.7449 -0.504236 4.53693 31.2421 -0.579138 4.42302 31.7475 -0.740259 4.35143 32.2609 -0.891436 4.35427 32.7827 -1.04661 4.35711 33.3130 -1.23597 4.35995 33.8518 -1.49552 4.43789 34.3993 -1.69890 4.57867 34.9557 -1.88562 4.72392 35.5211 -2.07385 4.87378 36.0956 -2.28420 5.04642 36.6794 -2.47739 5.25911 37.2727 -2.65929 5.48077 37.8755 -2.83839 5.71177 38.4882 -3.02366 5.95251 39.1107 -3.23022 6.20530 39.7432 -3.43246 6.52769 40.3861 -3.61050 6.86683 41.0393 -3.77494 7.22358 41.7031 -3.92842 7.59887 42.3776 -4.07153 7.99366 43.0630 -4.20419 8.40895 43.7595 -4.32668 8.84582 44.4673 -4.44102 9.30963 45.1865 -4.53474 9.80363 45.9174 -4.60691 10.3239 46.6600 -4.65499 10.8717 47.4147 -4.67411 11.4486 48.1816 -4.65234 12.0561 48.9609 -4.56273 12.6958 49.7528 -4.43830 13.2701 50.5576 -4.31588 13.8664 51.3753 -4.17074 14.4895 52.2062 -3.98944 15.1406 53.0506 -3.74917 15.8210 53.9087 -3.39804 16.4976 54.7806 -3.04284 17.0915 55.6667 -2.68217 17.7067 56.5670 -2.27866 18.3441 57.4820 -1.80131 19.0045 58.4117 -1.16270 19.6886 59.3564 -0.460873 20.0565 60.3165 0.129707 20.4000 61.2921 0.670513 20.7493 62.2834 1.20275 21.1046 63.2908 1.73961 21.4660 64.3145 2.29963 21.8321 65.3547 2.86725 22.1597 66.4118 3.43340 22.4921 67.4859 4.00987 22.8296 68.5775 4.60720 23.1721 69.6867 5.23614 23.5197 70.8138 5.92357 23.8726 71.9591 6.64032 24.1389 73.1230 7.35628 24.4043 74.3057 8.09902 24.6726 75.5076 8.91923 24.9438 76.7289 9.76309 25.0654 77.9699 10.5832 25.1833 79.2310 11.4212 25.3018 80.5125 12.3556 25.4208 81.8147 13.2865 25.2904 83.1380 14.1304 25.1553 84.4827 14.9303 25.0209 85.8491 15.7199 24.8872 87.2377 16.5145 24.7543 88.6487 17.3428 24.6220 90.0825 18.3032 24.4095 91.5395 19.1538 24.0449 93.0201 19.9274 23.6857 94.5246 20.6797 23.3319 96.0535 21.4286 22.9834 97.6071 22.1926 22.6400 99.1858 22.9954 22.3018 100.790 23.8941 21.9687 102.420 25.1183 21.6405 104.077 26.3331 20.5085 105.760 27.0621 19.2823 107.471 27.5490 18.1295 109.209 27.8883 17.0456 110.975 28.1232 16.0265 112.770 28.2816 15.0683 114.594 28.3843 14.1673 116.448 28.4516 13.3203 118.331 28.5212 12.5239 120.245 28.6342 11.6421 122.190 28.5830 10.7199 124.166 28.4188 9.87078 126.175 28.2007 9.08886 128.215 27.9444 8.36888 130.289 27.6604 7.70596 132.397 27.3575 7.09555 134.538 27.0417 6.53348 136.714 26.7199 6.01594 138.925 26.3990 5.53939 141.172 26.0924 5.10060 143.456 25.8509 4.69656 145.776 25.5731 4.10482 148.134 25.1581 3.55493 150.530 24.6499 3.07869 152.964 24.0595 2.66626 155.439 23.4721 2.45191 157.953 22.9265 2.26918 160.507 22.3905 2.14900 163.103 21.8667 2.06322 165.742 21.3828 2.08757 168.422 20.9480 2.12123 171.146 20.5514 2.19082 173.915 20.1926 2.27062 176.727 19.8502 2.35332 179.586 19.5147 2.47643 182.491 19.2290 2.63391 185.442 18.9866 2.80141 188.442 18.8102 2.95840 191.489 18.6334 3.08230 194.587 18.4567 3.21138 197.734 18.2923 3.34587 200.932 18.1414 3.48600 204.182 18.0055 3.63199 207.485 17.8878 3.78409 210.840 17.8000 3.94257 214.251 17.7252 4.06524 217.716 17.6481 4.18812 221.237 17.5727 4.31471 224.816 17.5048 4.44513 228.452 17.4462 4.57949 232.147 17.3993 4.71791 235.902 17.3679 4.86052 239.717 17.3628 5.00743 243.595 17.3941 5.11627 247.535 17.4057 5.19413 251.538 17.4007 5.27318 255.607 17.3938 5.35343 259.741 17.3872 5.43490 263.942 17.3830 5.51761 268.211 17.3833 5.60158 272.549 17.3935 5.68683 276.957 17.4160 5.75534 281.437 17.4310 5.81259 285.989 17.4409 5.87041 290.615 17.4531 5.92880 295.315 17.4733 5.98777 300.092 17.5238 6.03117 304.945 17.5480 6.03085 309.878 17.5522 6.03053 314.890 17.5453 6.03020 319.983 17.5306 6.02988 325.158 17.5113 6.02956 330.418 17.4967 6.02923 335.762 17.4742 5.99582 341.192 17.4281 5.95607 346.711 17.3609 5.91657 352.319 17.2779 5.87733 358.017 17.1797 5.83836 363.808 17.0666 5.79964 369.692 16.9412 5.76118 375.672 16.8043 5.71383 381.748 16.6377 5.65477 387.922 16.4418 5.59631 394.197 16.2164 5.53847 400.573 15.9588 5.48122 407.052 15.6587 5.42457 413.635 15.3143 5.38633 420.326 14.9415 5.36289 427.124 14.5275 5.33955 434.032 14.0569 5.31631 441.052 13.5023 5.29318 448.186 12.8642 5.32243 455.435 12.1419 5.36541 462.802 11.2473 5.45708 470.287 10.2553 5.64796 477.894 9.09164 5.84552 484.800 7.97502 6.02804 485.000 7.87726 5.61713 485.623 7.37798 5.73466 493.478 4.97250 7.42813 501.459 3.21411 9.62162 509.570 1.78526 12.4628 517.812 0.935425 16.1431 526.187 2.94277 20.5203 534.698 5.10761 22.2248 543.346 7.30398 23.8532 552.134 9.17847 24.6222 561.065 10.7540 25.4160 570.139 12.5226 25.9913 579.361 13.9927 26.1106 588.732 15.2416 26.2303 598.254 16.4342 26.3507 607.930 17.6582 26.3487 617.763 18.6768 26.1323 627.755 19.5244 25.9177 637.908 20.2437 25.7049 648.226 20.8447 25.5233 658.711 21.3958 25.3932 669.365 21.8923 25.2638 680.191 22.3550 25.1350 691.193 22.7845 24.8825 702.372 22.4190 24.4398 713.733 21.8164 25.1689 725.277 21.9609 26.5068 737.008 22.7980 27.9157 748.928 24.5054 28.7472 761.042 25.9928 28.7866 773.351 27.2082 28.8260 785.859 28.3562 28.6369 798.570 29.3355 28.3879 811.486 30.2241 28.1411 824.611 31.0892 27.8964 837.949 31.9210 27.5869 851.502 32.6694 27.2397 865.274 33.3558 26.8968 879.269 33.9932 26.5583 893.491 34.5632 26.2241 907.943 35.1278 25.9951 922.628 35.7312 25.7818 937.551 36.3806 25.5701 952.715 37.0694 25.3603 968.124 38.0719 25.1521 983.783 39.1540 24.3413 999.695 39.3529 23.2912 1015.86 39.5068 22.8698 1032.29 39.8687 22.4083 1048.99 40.2083 21.9512 1065.96 40.5260 21.4987 1083.20 40.8244 21.0554 1100.72 41.1048 20.6212 1118.52 41.3681 20.1961 1136.61 41.6155 19.7796 1155. 41.8479 19.3717 1173.68 42.0660 18.9723 1192.66 42.2707 18.5810 1211.95 42.4628 18.1979 1231.55 42.6431 17.8228 1251.47 42.8122 17.4556 1271.72 42.9705 17.0964 1292.29 43.1196 16.7452 1313.19 43.2597 16.4010 1334.43 43.3910 16.0639 1356.01 43.5140 15.7338 1377.94 43.6292 15.4103 1400.23 43.7368 15.0936 1422.88 43.8371 14.7834 1445.89 43.9303 14.4796 1469.28 44.0166 14.1825 1493.04 44.0960 13.8921 1517.19 44.1704 13.6104 1541.73 44.2408 13.3349 1566.67 44.3072 13.0649 1592.01 44.3693 12.8004 1617.76 44.4276 12.5411 1643.92 44.4818 12.2869 1670.51 44.5325 12.0383 1697.53 44.5803 11.7946 1724.99 44.6287 11.5556 1752.89 44.6734 11.3146 1781.24 44.7115 11.0762 1810.05 44.7435 10.8411 1839.32 44.7697 10.6111 1869.07 44.7916 10.3860 1899.30 44.8093 10.1654 1930.02 44.8230 9.94960 1961.24 44.8332 9.73846 1992.96 44.8388 9.53185 2025.20 44.8470 9.33397 2057.95 44.8534 9.13169 2091.24 44.8532 8.93205 2125.06 44.8487 8.73611 2159.43 44.8402 8.54320 2194.36 44.8278 8.35387 2229.85 44.8112 8.16753 2265.92 44.7909 7.98494 2302.57 44.7670 7.80508 2339.81 44.7388 7.62824 2377.66 44.7066 7.45474 2416.11 44.6703 7.28406 2455.19 44.6298 7.11654 2494.90 44.5850 6.95170 2535.26 44.5355 6.78984 2576.26 44.4813 6.63078 2617.93 44.4221 6.47454 2660.27 44.3577 6.32104 2703.30 44.2877 6.17018 2747.03 44.2119 6.02202 2791.46 44.1297 5.87647 2836.61 44.0409 5.73352 2882.49 43.9447 5.59303 2929.11 43.8405 5.45502 2976.48 43.7274 5.31947 3024.63 43.6047 5.18631 3073.55 43.4712 5.05555 3123.26 43.3255 4.92704 3173.78 43.1659 4.80082 3225.11 42.9905 4.67688 3277.27 42.7967 4.55512 3330.28 42.5811 4.43544 3384.15 42.3396 4.31794 3438.88 42.0664 4.20252 3494.50 41.7538 4.08922 3551.02 41.3906 3.97787 3608.46 40.9597 3.86841 3666.82 40.4342 3.76105 3726.13 39.7661 3.65559 3786.40 38.8555 3.55191 3847.64 37.4303 3.45004 3909.87 33.8781 3.35003 3928.70 21.3670 3.32065 3928.90 21.3687 10.8165 3973.11 35.7824 10.6258 4037.38 37.5436 10.3581 4102.68 37.8216 10.0972 4156. 31.1452 9.89191 4156.20 31.1480 13.5880 4169.03 37.0202 13.5233 4236.46 39.7808 13.1917 4304.98 40.9163 12.8690 4374.62 41.5729 12.5550 4445.37 41.5607 12.2471 4464.60 39.1491 12.1656 4464.80 39.1509 13.7097 4517.27 42.6724 13.4942 4590.33 43.6361 13.2039 4664.58 44.3357 12.9168 4740.03 44.9116 12.6326 4816.69 45.4069 12.3519 4894.60 45.8429 12.0747 4973.77 46.2318 11.8010 5054.21 46.5818 11.5311 5135.96 46.8989 11.2652 5219.03 47.1876 11.0033 5303.44 47.4516 10.7455 5389.22 47.6934 10.4916 5476.39 47.9153 10.2420 5564.97 48.1194 9.99683 5654.98 48.3075 9.75571 5746.44 48.4807 9.51892 5839.39 48.6403 9.28642 5933.83 48.7875 9.05831 6029.81 48.9233 8.83453 6127.33 49.0484 8.61505 6226.44 49.1635 8.39981 6327.15 49.2695 8.18894 6429.48 49.3670 7.98243 6533.48 49.4566 7.78004 6639.15 49.5386 7.58182 6746.54 49.6136 7.38798 6855.65 49.6823 7.19822 6966.54 49.7448 7.01252 7079.22 49.8015 6.83093 7193.72 49.8529 6.65333 7310.07 49.8993 6.47986 7428.31 49.9410 6.31012 7548.45 49.9782 6.14438 7670.54 50.0113 5.98237 7794.61 50.0404 5.82412 7920.68 50.0658 5.66971 8048.79 50.0879 5.51872 8178.98 50.1065 5.37147 8311.26 50.1223 5.22782 8445.69 50.1352 5.08748 8582.29 50.1453 4.95070 8721.11 50.1530 4.81718 8862.16 50.1582 4.68692 9005.50 50.1612 4.56000 9151.16 50.1622 4.43604 9299.17 50.1611 4.31531 9449.58 50.1583 4.19766 9602.42 50.1537 4.08290 9757.73 50.1474 3.97106 9915.55 50.1396 3.86235 10075.9 50.1306 3.75621 10238.9 50.1202 3.65281 10404.5 50.1086 3.55209 10572.8 50.0957 3.45399 10743.8 50.0818 3.35846 10917.6 50.0669 3.26544 11094.2 50.0510 3.17486 11273.6 50.0342 3.08668 11455.9 50.0167 3.00085 11641.2 49.9983 2.91730 11829.5 49.9792 2.83598 12020.8 49.9595 2.75684 12215.3 49.9391 2.67984 12412.8 49.9182 2.60491 12613.6 49.8967 2.53201 12817.6 49.8746 2.46109 13025.0 49.8522 2.39210 13235.6 49.8292 2.32499 13449.7 49.8058 2.25973 13667.2 49.7821 2.19625 13888.3 49.7579 2.13452 14112.9 49.7334 2.07449 14341.2 49.7086 2.01612 14573.1 49.6834 1.95937 14808.9 49.6579 1.90420 15048.4 49.6320 1.85056 15291.8 49.6059 1.79842 15539.1 49.5794 1.74774 15790.4 49.5527 1.69848 16045.8 49.5256 1.65060 16305.4 49.4982 1.60406 16569.1 49.4704 1.55884 16837.1 49.4423 1.51489 17109.4 49.4138 1.47218 17386.1 49.3850 1.43069 17667.4 49.3557 1.39037 17953.1 49.3259 1.35119 18243.5 49.2957 1.31313 18538.6 49.2649 1.27616 18838.4 49.2335 1.24024 19143.1 49.2015 1.20535 19452.7 49.1688 1.17145 19767.4 49.1353 1.13853 20087.1 49.1009 1.10655 20412.0 49.0654 1.07549 20742.1 49.0289 1.04532 21077.6 48.9911 1.01602 21418.5 48.9520 0.987571 21765.0 48.9111 0.959938 22117.0 48.8685 0.933104 22474.7 48.8237 0.907047 22838.2 48.7764 0.881743 23207.6 48.7263 0.857173 23583.0 48.6728 0.833315 23964.4 48.6153 0.810150 24352.0 48.5531 0.787658 24745.9 48.4850 0.765820 25146.2 48.4098 0.744618 25552.9 48.3257 0.724034 25966.2 48.2300 0.704050 26386.1 48.1191 0.684648 26812.9 47.9872 0.665814 27246.6 47.8249 0.647529 27687.3 47.6150 0.629780 28135.1 47.3212 0.612549 28590.2 46.8413 0.595823 29052.6 45.5641 0.579586 29200.0 38.6877 0.574557 29200.2 38.6878 3.54851 29522.5 46.4003 3.48783 30000.0 47.3136 3.40099 periodictable-1.5.0/periodictable/xsf/sr.nff000066400000000000000000000316771310514471200210640ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.171262 10.1617 -9999. 0.174896 10.3261 -9999. 0.178608 10.4931 -9999. 0.182398 10.6628 -9999. 0.186269 10.8353 -9999. 0.190614 11.0106 -9999. 0.195136 11.1886 -9999. 0.199766 11.3696 -9999. 0.204505 11.5535 -9999. 0.209357 11.7404 -9999. 0.214324 11.9303 -9999. 0.219410 12.1232 -9999. 0.225385 12.3193 -9999. 0.231522 12.5186 -9999. 0.237827 12.7210 -9999. 0.244303 12.9268 -9999. 0.250955 13.1359 -9999. 0.258014 13.3483 -9999. 0.266925 13.5642 -9999. 0.276144 13.7836 -9999. 0.285681 14.0066 -9999. 0.295547 14.2331 -9999. 0.305755 14.4633 -9999. 0.316410 14.6973 -9999. 0.329067 14.9350 -9999. 0.342230 15.1765 -9999. 0.355920 15.4220 -9999. 0.370157 15.6714 -9999. 0.384964 15.9249 -9999. 0.400363 16.1825 -9999. 0.416922 16.4442 -9999. 0.434177 16.7102 -9999. 0.452147 16.9805 -9999. 0.470860 17.2551 -9999. 0.490347 17.5342 -9999. 0.510641 17.8178 -9999. 0.532703 18.1060 -9999. 0.560547 18.3989 -9999. 0.589847 18.6964 -9999. 0.620679 18.9988 -9999. 0.653122 19.3061 -9999. 0.687261 19.6184 -9999. 0.723863 19.9357 -9999. 0.769653 20.2582 -9999. 0.818341 20.5858 -9999. 0.870107 20.9188 -9999. 0.925148 21.2571 -9999. 0.983672 21.6009 -9999. 1.06431 21.9503 -9999. 1.16788 22.3053 -9999. 1.28153 22.6661 -9999. 2.58184 23.0327 -9999. 5.67161 23.4053 -9999. 12.3368 23.7838 -9999. 13.4118 24.1685 -9999. 14.5585 24.5594 -9999. 15.7782 24.9566 -9999. 16.8964 25.3603 -9999. 17.7614 25.7705 -9999. 18.6706 26.1873 -9999. 19.2298 26.6109 -9999. 19.7747 27.0413 -9999. 20.3350 27.4786 -9999. 20.4560 27.9231 -9999. 20.3882 28.3747 -9999. 20.3207 28.8337 -9999. 20.0875 29.3000 5.58141 19.7809 29.7739 6.60730 19.4790 30.2555 7.63084 19.1817 30.7449 8.77090 18.7445 31.2421 9.69125 18.0643 31.7475 10.4429 17.4087 32.2609 11.0918 16.7769 32.7827 11.6698 16.1681 33.3130 12.1950 15.5813 33.8518 12.6843 15.0159 34.3993 13.1613 14.4709 34.9557 13.6862 13.9292 35.5211 14.1362 13.1751 36.0956 14.4427 12.4618 36.6794 14.6643 11.7872 37.2727 14.8303 11.1491 37.8755 14.9522 10.5455 38.4882 15.0386 9.97465 39.1107 15.0958 9.43467 39.7432 15.1291 8.92392 40.3861 15.1431 8.44081 41.0393 15.1421 7.98386 41.7031 15.1304 7.55165 42.3776 15.1160 7.14284 43.0630 15.1154 6.75616 43.7595 15.1207 6.31630 44.4673 15.0583 5.87774 45.1865 14.9620 5.46965 45.9174 14.8447 5.08988 46.6600 14.7127 4.73648 47.4147 14.5698 4.40762 48.1816 14.4189 4.10159 48.9609 14.2619 3.81682 49.7528 14.1006 3.55181 50.5576 13.9359 3.30520 51.3753 13.7683 3.07572 52.2062 13.5982 2.86507 53.0506 13.4305 2.67044 53.9087 13.2643 2.48903 54.7806 13.0991 2.31994 55.6667 12.9350 2.16233 56.5670 12.7720 2.01544 57.4820 12.6102 1.87852 58.4117 12.4493 1.75091 59.3564 12.2889 1.63196 60.3165 12.1294 1.52330 61.2921 11.9724 1.42235 62.2834 11.8166 1.32810 63.2908 11.6612 1.24010 64.3145 11.5054 1.15792 65.3547 11.3472 1.08119 66.4118 11.1805 1.00955 67.4859 11.0136 0.969212 68.5775 10.8617 0.934670 69.6867 10.7174 0.901357 70.8138 10.5746 0.869234 71.9591 10.4313 0.842044 73.1230 10.2820 0.823873 74.3057 10.1443 0.817443 75.5076 10.0094 0.811064 76.7289 9.87887 0.816739 77.9699 9.75628 0.823115 79.2310 9.63849 0.829541 80.5125 9.52258 0.836017 81.8147 9.40891 0.845842 83.1380 9.29799 0.855911 84.4827 9.18864 0.866099 85.8491 9.07960 0.876409 87.2377 8.96870 0.887895 88.6487 8.85941 0.903027 90.0825 8.75147 0.918415 91.5395 8.64363 0.934067 93.0201 8.53538 0.949985 94.5246 8.42636 0.966175 96.0535 8.31675 0.982639 97.6071 8.20536 0.997154 99.1858 8.09019 1.01132 100.790 7.97126 1.02569 102.420 7.84816 1.04026 104.077 7.72030 1.05505 105.760 7.58691 1.07004 107.471 7.44686 1.08524 109.209 7.29903 1.10190 110.975 7.14368 1.11954 112.770 6.97897 1.13746 114.594 6.80222 1.15567 116.448 6.60827 1.17417 118.331 6.39577 1.20264 120.245 6.16448 1.23546 122.190 5.91059 1.28442 124.166 5.62348 1.33915 126.175 5.29974 1.44541 128.215 4.90059 1.57652 130.289 4.60439 1.99485 132.397 4.56325 2.21466 134.538 4.37806 2.28553 136.714 4.07743 2.41905 138.925 3.71998 2.57557 141.172 3.34108 2.86818 143.456 2.97861 3.20328 145.776 2.61650 3.62092 148.134 2.32405 4.12550 150.530 2.12973 4.62736 152.964 1.93804 5.13125 155.439 1.77018 5.68999 157.953 1.69456 6.30959 160.507 1.72149 6.83708 163.103 1.72234 7.33910 165.742 1.72733 7.87796 168.422 1.82247 8.41780 171.146 1.89822 8.89448 173.915 1.97473 9.39816 176.727 2.08111 9.93035 179.586 2.27211 10.4927 182.491 2.49029 10.9233 185.442 2.68376 11.3608 188.442 2.87596 11.8157 191.489 3.11275 12.2889 194.587 3.36572 12.6906 197.734 3.60571 13.0968 200.932 3.85244 13.5161 204.182 4.11125 13.9288 207.485 4.38289 14.3528 210.840 4.68302 14.7898 214.251 5.07149 15.2400 217.716 5.46285 15.5540 221.237 5.81390 15.8709 224.816 6.15796 16.1942 228.452 6.50922 16.5241 232.147 6.89036 16.8511 235.902 7.26412 17.1427 239.717 7.63325 17.4393 243.595 8.00630 17.7410 247.535 8.38948 18.0480 251.538 8.78673 18.3602 255.607 9.20100 18.6789 259.741 9.64337 19.0088 263.942 10.1235 19.3444 268.211 10.6582 19.6860 272.549 11.3146 20.0229 276.957 11.9672 20.1598 281.437 12.5906 20.2977 285.989 13.2334 20.4364 290.615 14.0056 20.4847 295.315 14.6405 20.3331 300.092 15.1737 20.1826 304.945 15.6327 20.0332 309.878 16.0272 19.9267 314.890 16.4314 19.8652 319.983 16.8373 19.8038 325.158 17.2385 19.7428 330.418 17.6346 19.6821 335.762 18.0262 19.6215 341.192 18.4138 19.5610 346.711 18.7988 19.5008 352.319 19.1826 19.4408 358.017 19.5664 19.3808 363.808 19.9521 19.3209 369.692 20.3424 19.2612 375.672 20.7408 19.2016 381.748 21.1555 19.1424 387.922 21.6053 19.0674 394.197 22.0816 18.9573 400.573 22.5518 18.7584 407.052 22.9583 18.5266 413.635 23.3271 18.2977 420.326 23.6718 18.0717 427.124 23.9986 17.8485 434.032 24.3106 17.6276 441.052 24.6107 17.4097 448.186 24.9071 17.1928 455.435 25.1924 16.9694 462.802 25.4653 16.7419 470.287 25.7235 16.5139 477.894 25.9699 16.2899 485.623 26.2072 16.0682 493.478 26.4361 15.8493 501.459 26.6580 15.6334 509.570 26.8746 15.4206 517.812 27.0894 15.2094 526.187 27.3017 14.9961 534.698 27.5082 14.7755 543.346 27.7025 14.5532 552.134 27.8907 14.3345 561.065 28.0731 14.1104 570.139 28.2444 13.8856 579.361 28.4049 13.6640 588.732 28.5581 13.4465 598.254 28.7055 13.2328 607.930 28.8485 13.0226 617.763 28.9883 12.8156 627.755 29.1294 12.6110 637.908 29.2702 12.3991 648.226 29.4042 12.1753 658.711 29.5167 11.9455 669.365 29.6073 11.7201 680.191 29.6800 11.5229 691.193 29.7612 11.3473 702.372 29.8662 11.1775 713.733 29.9787 10.9875 725.277 30.0751 10.7852 737.008 30.1603 10.5865 748.928 30.2386 10.3916 761.042 30.3123 10.2002 773.351 30.3828 10.0109 785.859 30.4496 9.82093 798.570 30.5085 9.63106 811.486 30.5610 9.44480 824.611 30.6083 9.26218 837.949 30.6515 9.08311 851.502 30.6907 8.90671 865.274 30.7260 8.73301 879.269 30.7571 8.56208 893.491 30.7843 8.39438 907.943 30.8085 8.22998 922.628 30.8312 8.06880 937.551 30.8504 7.90588 952.715 30.8648 7.74494 968.124 30.8736 7.58616 983.783 30.8779 7.43076 999.695 30.8781 7.27860 1015.86 30.8742 7.12964 1032.29 30.8688 6.98536 1048.99 30.8616 6.84129 1065.96 30.8490 6.69726 1083.20 30.8313 6.55634 1100.72 30.8094 6.41842 1118.52 30.7835 6.28342 1136.61 30.7536 6.15110 1155. 30.7197 6.02166 1173.68 30.6822 5.89509 1192.66 30.6408 5.77091 1211.95 30.5954 5.64946 1231.55 30.5470 5.53074 1251.47 30.4951 5.41229 1271.72 30.4385 5.29437 1292.29 30.3746 5.17661 1313.19 30.3037 5.06127 1334.43 30.2258 4.94853 1356.01 30.1410 4.83838 1377.94 30.0489 4.73070 1400.23 29.9491 4.62544 1422.88 29.8410 4.52258 1445.89 29.7237 4.42190 1469.28 29.5963 4.32351 1493.04 29.4578 4.22743 1517.19 29.3069 4.13383 1541.73 29.1421 4.04241 1566.67 28.9615 3.95307 1592.01 28.7625 3.86580 1617.76 28.5422 3.78045 1643.92 28.2964 3.69695 1670.51 28.0198 3.61520 1697.53 27.7056 3.53527 1724.99 27.3422 3.45713 1752.89 26.9184 3.38438 1781.24 26.4154 3.31443 1810.05 25.8000 3.24684 1839.32 25.0138 3.18064 1869.07 23.9363 3.11578 1899.30 22.2438 3.05223 1930.02 18.0503 2.98998 1939.50 5.28010 2.97123 1939.70 5.28403 11.7640 1961.24 20.0566 11.4624 1992.96 21.0943 11.0379 2006.70 15.2358 10.8609 2006.90 15.2501 15.1320 2025.20 22.8854 14.9479 2057.95 25.2033 14.6279 2091.24 26.5585 14.3148 2125.06 27.4987 14.0082 2159.43 28.1344 13.7083 2194.36 28.3227 13.4144 2216.20 25.5952 13.2361 2216.40 25.6051 15.2077 2229.85 28.7670 15.0779 2265.92 30.1929 14.7390 2302.57 31.0805 14.4054 2339.81 31.7865 14.0767 2377.66 32.3848 13.7529 2416.11 32.9074 13.4348 2455.19 33.3715 13.1219 2494.90 33.7884 12.8145 2535.26 34.1654 12.5121 2576.26 34.5082 12.2152 2617.93 34.8211 11.9238 2660.27 35.1081 11.6383 2703.30 35.3718 11.3575 2747.03 35.6143 11.0821 2791.46 35.8373 10.8123 2836.61 36.0434 10.5483 2882.49 36.2339 10.2890 2929.11 36.4097 10.0350 2976.48 36.5718 9.78634 3024.63 36.7218 9.54315 3073.55 36.8604 9.30473 3123.26 36.9884 9.07165 3173.78 37.1064 8.84328 3225.11 37.2152 8.62019 3277.27 37.3154 8.40194 3330.28 37.4079 8.18871 3384.15 37.4929 7.98001 3438.88 37.5709 7.77603 3494.50 37.6422 7.57647 3551.02 37.7072 7.38193 3608.46 37.7668 7.19179 3666.82 37.8210 7.00602 3726.13 37.8701 6.82458 3786.40 37.9145 6.64742 3847.64 37.9544 6.47440 3909.87 37.9901 6.30553 3973.11 38.0218 6.14074 4037.38 38.0499 5.97991 4102.68 38.0746 5.82298 4169.03 38.0959 5.66985 4236.46 38.1142 5.52048 4304.98 38.1297 5.37480 4374.62 38.1424 5.23270 4445.37 38.1527 5.09411 4517.27 38.1605 4.95892 4590.33 38.1660 4.82720 4664.58 38.1696 4.69872 4740.03 38.1711 4.57351 4816.69 38.1707 4.45143 4894.60 38.1687 4.33245 4973.77 38.1650 4.21654 5054.21 38.1598 4.10354 5135.96 38.1532 3.99345 5219.03 38.1452 3.88617 5303.44 38.1360 3.78168 5389.22 38.1256 3.67982 5476.39 38.1141 3.58062 5564.97 38.1017 3.48401 5654.98 38.0882 3.38985 5746.44 38.0738 3.29825 5839.39 38.0586 3.20894 5933.83 38.0426 3.12199 6029.81 38.0259 3.03733 6127.33 38.0085 2.95494 6226.44 37.9905 2.87467 6327.15 37.9719 2.79654 6429.48 37.9527 2.72044 6533.48 37.9330 2.64635 6639.15 37.9129 2.57425 6746.54 37.8923 2.50402 6855.65 37.8712 2.43567 6966.54 37.8497 2.36917 7079.22 37.8279 2.30441 7193.72 37.8056 2.24132 7310.07 37.7831 2.18004 7428.31 37.7602 2.12035 7548.45 37.7370 2.06216 7670.54 37.7135 2.00563 7794.61 37.6897 1.95054 7920.68 37.6655 1.89697 8048.79 37.6411 1.84490 8178.98 37.6165 1.79419 8311.26 37.5916 1.74478 8445.69 37.5663 1.69672 8582.29 37.5407 1.64997 8721.11 37.5148 1.60447 8862.16 37.4886 1.56020 9005.50 37.4621 1.51713 9151.16 37.4352 1.47520 9299.17 37.4079 1.43441 9449.58 37.3803 1.39472 9602.42 37.3522 1.35611 9757.73 37.3236 1.31853 9915.55 37.2945 1.28195 10075.9 37.2648 1.24638 10238.9 37.2345 1.21176 10404.5 37.2036 1.17808 10572.8 37.1719 1.14530 10743.8 37.1394 1.11341 10917.6 37.1059 1.08238 11094.2 37.0715 1.05219 11273.6 37.0359 1.02281 11455.9 36.9990 0.994222 11641.2 36.9607 0.966406 11829.5 36.9208 0.939339 12020.8 36.8791 0.913002 12215.3 36.8352 0.887374 12412.8 36.7890 0.862436 12613.6 36.7399 0.838169 12817.6 36.6877 0.814555 13025.0 36.6316 0.791575 13235.6 36.5711 0.769214 13449.7 36.5053 0.747453 13667.2 36.4329 0.726275 13888.3 36.3526 0.705667 14112.9 36.2622 0.685610 14341.2 36.1589 0.666091 14573.1 36.0385 0.647094 14808.9 35.8946 0.628606 15048.4 35.7164 0.610611 15291.8 35.4841 0.593098 15539.1 35.1551 0.576052 15790.4 34.6058 0.559459 16045.8 32.9628 0.543310 16104.5 26.4571 0.539702 16104.7 26.4573 3.75733 16305.4 34.3200 3.68752 16569.1 35.2344 3.59899 16837.1 35.7413 3.51194 17109.4 36.0956 3.42639 17386.1 36.3681 3.34234 17667.4 36.5889 3.25981 17953.1 36.7737 3.17880 18243.5 36.9318 3.09932 18538.6 37.0692 3.02136 18838.4 37.1900 2.94492 19143.1 37.2972 2.87000 19452.7 37.3930 2.79660 19767.4 37.4790 2.72469 20087.1 37.5566 2.65429 20412.0 37.6268 2.58537 20742.1 37.6906 2.51793 21077.6 37.7486 2.45194 21418.5 37.8014 2.38740 21765.0 37.8496 2.32429 22117.0 37.8936 2.26259 22474.7 37.9338 2.20229 22838.2 37.9705 2.14336 23207.6 38.0040 2.08580 23583.0 38.0346 2.02957 23964.4 38.0625 1.97466 24352.0 38.0880 1.92105 24745.9 38.1112 1.86873 25146.2 38.1323 1.81766 25552.9 38.1514 1.76782 25966.2 38.1687 1.71920 26386.1 38.1843 1.67178 26812.9 38.1984 1.62553 27246.6 38.2110 1.58043 27687.3 38.2223 1.53645 28135.1 38.2324 1.49359 28590.2 38.2413 1.45181 29052.6 38.2494 1.41109 29522.5 38.2602 1.37142 30000.0 38.2499 1.33276 periodictable-1.5.0/periodictable/xsf/ta.nff000066400000000000000000000320301310514471200210240ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.13720 10.1617 -9999. 3.25228 10.3261 -9999. 3.37159 10.4931 -9999. 3.49517 10.6628 -9999. 3.62199 10.8353 -9999. 3.75342 11.0106 -9999. 3.88962 11.1886 -9999. 4.03075 11.3696 -9999. 4.17701 11.5535 -9999. 4.32468 11.7404 -9999. 4.46988 11.9303 -9999. 4.61995 12.1232 -9999. 4.77507 12.3193 -9999. 4.93539 12.5186 -9999. 5.10109 12.7210 -9999. 5.24026 12.9268 -9999. 5.37713 13.1359 -9999. 5.51759 13.3483 -9999. 5.66171 13.5642 -9999. 5.80960 13.7836 -9999. 5.96135 14.0066 -9999. 6.07338 14.2331 -9999. 6.15358 14.4633 -9999. 6.23483 14.6973 -9999. 6.31717 14.9350 -9999. 6.40058 15.1765 -9999. 6.48280 15.4220 -9999. 6.55992 15.6714 -9999. 6.63795 15.9249 -9999. 6.71691 16.1825 -9999. 6.79680 16.4442 -9999. 6.86154 16.7102 -9999. 6.84686 16.9805 -9999. 6.83221 17.2551 -9999. 6.81760 17.5342 -9999. 6.80302 17.8178 -9999. 6.73782 18.1060 -9999. 6.66358 18.3989 -9999. 6.59014 18.6964 -9999. 6.51752 18.9988 -9999. 6.44570 19.3061 -9999. 6.37067 19.6184 -9999. 6.29552 19.9357 -9999. 6.22126 20.2582 -9999. 6.14788 20.5858 -9999. 6.07537 20.9188 -9999. 6.00371 21.2571 -9999. 5.93288 21.6009 -9999. 5.86290 21.9503 -9999. 5.79375 22.3053 -9999. 5.72541 22.6661 -9999. 5.64529 23.0327 -9999. 5.54004 23.4053 -9999. 5.43674 23.7838 -9999. 5.33538 24.1685 -9999. 5.23590 24.5594 -9999. 5.15222 24.9566 -9999. 5.07690 25.3603 -9999. 5.00269 25.7705 -9999. 4.92956 26.1873 -9999. 4.85750 26.6109 -9999. 4.78650 27.0413 -9999. 4.71985 27.4786 -9999. 4.67861 27.9231 -9999. 4.63772 28.3747 -9999. 4.59720 28.8337 -9999. 4.55590 29.3000 1.97824 4.50988 29.7739 1.67726 4.46433 30.2555 1.33733 4.55361 30.7449 1.01580 4.65269 31.2421 0.647242 4.75393 31.7475 0.214456 5.02013 32.2609 -0.119069 5.36774 32.7827 -0.405135 5.73941 33.3130 -0.659484 6.13681 33.8518 -0.887586 6.56174 34.3993 -1.09200 7.01697 34.9557 -1.26731 7.51043 35.5211 -1.40818 8.03858 36.0956 -1.50978 8.60389 36.6794 -1.56306 9.20893 37.2727 -1.53669 9.85654 37.8755 -1.36993 10.4630 38.4882 -1.24061 11.0174 39.1107 -1.09937 11.6011 39.7432 -0.909361 12.2157 40.3861 -0.635268 12.8629 41.0393 -0.267859 13.4251 41.7031 0.819637E-01 13.9630 42.3776 0.463006 14.5224 43.0630 0.911653 15.1042 43.7595 1.50220 15.6787 44.4673 2.11311 16.0596 45.1865 2.70208 16.4497 45.9174 3.33137 16.8493 46.6600 4.09616 17.1763 47.4147 4.79686 17.3444 48.1816 5.46219 17.5141 48.9609 6.13445 17.6855 49.7528 6.85896 17.8585 50.5576 7.72304 18.0333 51.3753 8.62639 17.8674 52.2062 9.37180 17.6491 53.0506 10.0708 17.4336 53.9087 10.8099 17.2206 54.7806 11.5646 16.7637 55.6667 12.1136 16.2323 56.5670 12.5479 15.7179 57.4820 12.9007 15.2197 58.4117 13.1791 14.7373 59.3564 13.4077 14.3109 60.3165 13.6136 13.9004 61.2921 13.7931 13.5017 62.2834 13.9443 13.1144 63.2908 14.0686 12.7383 64.3145 14.1669 12.3729 65.3547 14.2401 12.0180 66.4118 14.2883 11.6733 67.4859 14.3109 11.3385 68.5775 14.3059 11.0133 69.6867 14.2671 10.6973 70.8138 14.1701 10.3937 71.9591 14.0672 10.1993 73.1230 13.9852 10.0086 74.3057 13.9001 9.82835 75.5076 13.8176 9.66050 76.7289 13.7282 9.49552 77.9699 13.6173 9.33334 79.2310 13.4489 9.17394 80.5125 13.2834 9.14489 81.8147 13.1704 9.12327 83.1380 13.0792 9.10170 84.4827 12.9990 9.08018 85.8491 12.9243 9.05872 87.2377 12.8505 9.03731 88.6487 12.7705 9.01881 90.0825 12.6935 9.01381 91.5395 12.6187 9.00882 93.0201 12.5413 9.00383 94.5246 12.4568 8.99884 96.0535 12.3601 8.99386 97.6071 12.2371 8.98888 99.1858 12.0351 9.03862 100.790 11.8965 9.16727 102.420 11.8005 9.29776 104.077 11.7206 9.43010 105.760 11.6522 9.56433 107.471 11.5920 9.70046 109.209 11.5371 9.83853 110.975 11.4834 9.97857 112.770 11.4187 10.1206 114.594 11.3497 10.3038 116.448 11.3112 10.5067 118.331 11.2928 10.7137 120.245 11.2903 10.9247 122.190 11.3038 11.1399 124.166 11.3357 11.3594 126.175 11.4011 11.5702 128.215 11.4589 11.7520 130.289 11.5128 11.9366 132.397 11.5679 12.1242 134.538 11.6267 12.3147 136.714 11.6904 12.5081 138.925 11.7612 12.7046 141.172 11.8481 12.9023 143.456 11.9327 13.0791 145.776 12.0063 13.2584 148.134 12.0765 13.4522 150.530 12.1558 13.6543 152.964 12.2419 13.8594 155.439 12.3340 14.0677 157.953 12.4322 14.2790 160.507 12.5374 14.4936 163.103 12.6532 14.7114 165.742 12.7899 14.9132 168.422 12.9049 15.0953 171.146 12.9848 15.2970 173.915 13.0711 15.5258 176.727 13.1768 15.7888 179.586 13.3044 16.0575 182.491 13.4519 16.3307 185.442 13.6176 16.6080 188.442 13.8050 16.8898 191.489 14.0305 17.1683 194.587 14.2621 17.4096 197.734 14.4986 17.6412 200.932 14.7289 17.8649 204.182 14.9616 18.0913 207.485 15.2031 18.3208 210.840 15.4670 18.5535 214.251 15.7375 18.7488 217.716 16.0041 18.9378 221.237 16.2616 19.1222 224.816 16.5170 19.3079 228.452 16.7730 19.4957 232.147 17.0316 19.6854 235.902 17.2945 19.8774 239.717 17.5627 20.0710 243.595 17.8372 20.2662 247.535 18.1188 20.4629 251.538 18.4086 20.6618 255.607 18.7089 20.8630 259.741 19.0223 21.0663 263.942 19.3521 21.2713 268.211 19.7031 21.4780 272.549 20.0898 21.6869 276.957 20.5517 21.8418 281.437 20.9902 21.9268 285.989 21.3890 21.9666 290.615 21.7581 22.0002 295.315 22.1050 22.0338 300.092 22.4393 22.0677 304.945 22.7639 22.1017 309.878 23.0806 22.1355 314.890 23.3905 22.1694 319.983 23.6948 22.2032 325.158 23.9937 22.2369 330.418 24.2880 22.2711 335.762 24.5782 22.3053 341.192 24.8642 22.3392 346.711 25.1457 22.3733 352.319 25.4227 22.4076 358.017 25.6955 22.4424 363.808 25.9630 22.4769 369.692 26.2242 22.5112 375.672 26.4759 22.5451 381.748 26.7145 22.5802 387.922 26.9332 22.6188 394.197 27.0923 22.6646 400.573 27.2409 22.8306 407.052 27.4655 23.0463 413.635 27.7411 23.2654 420.326 28.0552 23.4852 427.124 28.4045 23.7069 434.032 28.7933 23.9315 441.052 29.2281 24.1581 448.186 29.7977 24.3604 455.435 30.3773 24.4309 462.802 30.9341 24.4070 470.287 31.4285 24.3326 477.894 31.8690 24.2592 485.623 32.2864 24.1856 493.478 32.6867 24.1118 501.459 33.0730 24.0375 509.570 33.4492 23.9639 517.812 33.8243 23.8861 526.187 34.1903 23.7917 534.698 34.5275 23.6650 543.346 34.7921 23.5229 552.134 34.8901 23.3826 561.065 34.9467 23.7024 570.139 35.5102 24.1839 579.361 36.2270 24.1955 588.732 36.8945 24.0659 598.254 37.4335 23.8475 607.930 37.9034 23.6311 617.763 38.3363 23.4165 627.755 38.7489 23.2027 637.908 39.1456 22.9781 648.226 39.5222 22.7368 658.711 39.8637 22.4858 669.365 40.1695 22.2374 680.191 40.4459 22.0257 691.193 40.7325 21.8417 702.372 41.0553 21.6614 713.733 41.3883 21.4386 725.277 41.6874 21.1880 737.008 41.9626 20.9402 748.928 42.2228 20.6951 761.042 42.4721 20.4527 773.351 42.7141 20.2104 785.859 42.9476 19.9629 798.570 43.1653 19.7119 811.486 43.3700 19.4637 824.611 43.5643 19.2185 837.949 43.7513 18.9765 851.502 43.9311 18.7330 865.274 44.1027 18.4878 879.269 44.2619 18.2416 893.491 44.4111 17.9985 907.943 44.5529 17.7586 922.628 44.6941 17.5219 937.551 44.8257 17.2695 952.715 44.9436 17.0158 968.124 45.0449 16.7615 983.783 45.1335 16.5109 999.695 45.2119 16.2627 1015.86 45.2830 16.0170 1032.29 45.3414 15.7633 1048.99 45.3852 15.5100 1065.96 45.4114 15.2568 1083.20 45.4218 15.0076 1100.72 45.4174 14.7623 1118.52 45.3986 14.5209 1136.61 45.3655 14.2833 1155. 45.3179 14.0494 1173.68 45.2555 13.8193 1192.66 45.1779 13.5924 1211.95 45.0845 13.3693 1231.55 44.9767 13.1499 1251.47 44.8529 12.9282 1271.72 44.7095 12.7043 1292.29 44.5375 12.4769 1313.19 44.3361 12.2532 1334.43 44.1049 12.0334 1356.01 43.8418 11.8176 1377.94 43.5436 11.6053 1400.23 43.2061 11.3968 1422.88 42.8246 11.1921 1445.89 42.3922 10.9904 1469.28 41.9004 10.7918 1493.04 41.3389 10.5961 1517.19 40.6902 10.3998 1541.73 39.9330 10.2065 1566.67 39.0388 10.0168 1592.01 37.9653 9.83048 1617.76 36.6451 9.64752 1643.92 34.9623 9.46783 1670.51 32.6905 9.29154 1697.53 29.2697 9.11830 1724.99 22.0968 8.94782 1735. 4.24359 8.88710 1735.20 4.15165 19.7275 1752.89 19.0016 23.0041 1781.24 20.1406 29.3353 1810.05 26.4010 37.4091 1839.32 33.8200 38.2464 1869.07 38.0706 37.3684 1899.30 41.0410 36.5105 1930.02 43.3374 35.6714 1961.24 45.1885 34.8515 1992.96 46.7053 34.0503 2025.20 47.9578 33.2750 2057.95 48.9736 32.5099 2091.24 49.7460 31.7623 2125.06 50.2181 31.0313 2159.43 50.1454 30.3178 2193.90 41.8841 29.6298 2194.10 41.8914 34.5927 2194.36 43.9311 34.5862 2229.85 52.0931 33.7286 2265.92 53.9219 32.8926 2302.57 55.1844 32.0767 2339.81 56.1508 31.2817 2377.66 56.8921 30.5072 2416.11 57.3862 29.7511 2455.19 57.2830 29.0142 2468.60 54.4774 28.7682 2468.80 54.4810 30.7128 2494.90 58.3585 30.2252 2535.26 59.5054 29.4962 2576.26 60.2863 28.7842 2617.93 60.8784 28.0897 2660.27 61.2837 27.4133 2703.30 60.9856 26.7526 2707.90 59.8129 26.6835 2708.10 59.8221 27.7560 2747.03 62.2261 27.2313 2791.46 62.9476 26.6532 2836.61 63.5314 26.0836 2882.49 64.0434 25.5214 2929.11 64.5045 24.9680 2976.48 64.9260 24.4237 3024.63 65.3131 23.8872 3073.55 65.6705 23.3605 3123.26 66.0014 22.8422 3173.78 66.3080 22.3330 3225.11 66.5922 21.8327 3277.27 66.8559 21.3416 3330.28 67.1003 20.8592 3384.15 67.3272 20.3867 3438.88 67.5376 19.9224 3494.50 67.7322 19.4673 3551.02 67.9126 19.0213 3608.46 68.0793 18.5836 3666.82 68.2327 18.1547 3726.13 68.3743 17.7348 3786.40 68.5039 17.3227 3847.64 68.6226 16.9200 3909.87 68.7314 16.5253 3973.11 68.8304 16.1388 4037.38 68.9202 15.7604 4102.68 69.0012 15.3901 4169.03 69.0739 15.0276 4236.46 69.1387 14.6729 4304.98 69.1961 14.3258 4374.62 69.2463 13.9862 4445.37 69.2897 13.6539 4517.27 69.3265 13.3289 4590.33 69.3573 13.0113 4664.58 69.3822 12.7004 4740.03 69.4013 12.3965 4816.69 69.4150 12.0994 4894.60 69.4235 11.8088 4973.77 69.4271 11.5248 5054.21 69.4258 11.2471 5135.96 69.4198 10.9758 5219.03 69.4094 10.7105 5303.44 69.3946 10.4515 5389.22 69.3756 10.1981 5476.39 69.3525 9.95074 5564.97 69.3256 9.70905 5654.98 69.2946 9.47265 5746.44 69.2597 9.24197 5839.39 69.2210 9.01663 5933.83 69.1786 8.79649 6029.81 69.1324 8.58146 6127.33 69.0824 8.37138 6226.44 69.0286 8.16637 6327.15 68.9711 7.96623 6429.48 68.9097 7.77072 6533.48 68.8443 7.57977 6639.15 68.7747 7.39339 6746.54 68.7010 7.21144 6855.65 68.6227 7.03362 6966.54 68.5396 6.86032 7079.22 68.4517 6.69110 7193.72 68.3584 6.52574 7310.07 68.2593 6.36455 7428.31 68.1541 6.20713 7548.45 68.0419 6.05341 7670.54 67.9222 5.90358 7794.61 67.7940 5.75720 7920.68 67.6562 5.61435 8048.79 67.5074 5.47501 8178.98 67.3461 5.33911 8311.26 67.1701 5.20646 8445.69 66.9767 5.07705 8582.29 66.7618 4.95039 8721.11 66.5205 4.82720 8862.16 66.2459 4.70686 9005.50 65.9271 4.58942 9151.16 65.5475 4.47489 9299.17 65.0790 4.36318 9449.58 64.4664 4.25404 9602.42 63.5787 4.14765 9757.73 61.9472 4.04384 9881. 47.4734 3.96442 9881.20 47.4747 10.4207 9915.55 59.4412 10.3542 10075.9 63.0151 10.0527 10238.9 64.1843 9.75991 10404.5 64.8094 9.47567 10572.8 65.1371 9.19970 10743.8 65.2157 8.93178 10917.6 64.9575 8.67165 11094.2 63.4845 8.41911 11136.0 57.0506 8.36092 11136.2 57.0520 11.7588 11273.6 65.0180 11.4902 11455.9 65.9758 11.1481 11641.2 65.9661 10.8162 11681.4 63.5302 10.7462 11681.6 63.5307 12.0831 11829.5 67.0386 11.8723 12020.8 67.8327 11.6088 12215.3 68.4049 11.3488 12412.8 68.8701 11.0923 12613.6 69.2660 10.8395 12817.6 69.6112 10.5905 13025.0 69.9168 10.3453 13235.6 70.1900 10.1039 13449.7 70.4360 9.86656 13667.2 70.6588 9.63316 13888.3 70.8612 9.40379 14112.9 71.0457 9.17846 14341.2 71.2142 8.95720 14573.1 71.3683 8.74000 14808.9 71.5094 8.52689 15048.4 71.6387 8.31784 15291.8 71.7572 8.11286 15539.1 71.8657 7.91194 15790.4 71.9652 7.71503 16045.8 72.0562 7.52215 16305.4 72.1393 7.33323 16569.1 72.2153 7.14827 16837.1 72.2845 6.96723 17109.4 72.3474 6.79006 17386.1 72.4045 6.61673 17667.4 72.4562 6.44719 17953.1 72.5027 6.28140 18243.5 72.5446 6.11931 18538.6 72.5819 5.96088 18838.4 72.6151 5.80605 19143.1 72.6444 5.65477 19452.7 72.6701 5.50699 19767.4 72.6923 5.36265 20087.1 72.7113 5.22170 20412.0 72.7273 5.08408 20742.1 72.7405 4.94974 21077.6 72.7510 4.81861 21418.5 72.7590 4.69065 21765.0 72.7647 4.56580 22117.0 72.7683 4.44399 22474.7 72.7698 4.32517 22838.2 72.7693 4.20929 23207.6 72.7671 4.09628 23583.0 72.7632 3.98608 23964.4 72.7577 3.87865 24352.0 72.7507 3.77392 24745.9 72.7424 3.67185 25146.2 72.7327 3.57236 25552.9 72.7219 3.47541 25966.2 72.7099 3.38095 26386.1 72.6968 3.28891 26812.9 72.6828 3.19925 27246.6 72.6678 3.11191 27687.3 72.6520 3.02684 28135.1 72.6354 2.94399 28590.2 72.6182 2.86331 29052.6 72.6007 2.78475 29522.5 72.5898 2.70825 30000.0 72.5392 2.63378 periodictable-1.5.0/periodictable/xsf/tb.nff000066400000000000000000000320721310514471200210330ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.159742 10.1617 -9999. 0.166245 10.3261 -9999. 0.173012 10.4931 -9999. 0.180055 10.6628 -9999. 0.187385 10.8353 -9999. 0.195013 11.0106 -9999. 0.202952 11.1886 -9999. 0.211214 11.3696 -9999. 0.219812 11.5535 -9999. 0.228226 11.7404 -9999. 0.236751 11.9303 -9999. 0.245594 12.1232 -9999. 0.254768 12.3193 -9999. 0.264285 12.5186 -9999. 0.273910 12.7210 -9999. 0.283712 12.9268 -9999. 0.293864 13.1359 -9999. 0.304379 13.3483 -9999. 0.315270 13.5642 -9999. 0.326552 13.7836 -9999. 0.337737 14.0066 -9999. 0.348276 14.2331 -9999. 0.359144 14.4633 -9999. 0.370352 14.6973 -9999. 0.381909 14.9350 -9999. 0.393826 15.1765 -9999. 0.405719 15.4220 -9999. 0.417451 15.6714 -9999. 0.429521 15.9249 -9999. 0.441941 16.1825 -9999. 0.454720 16.4442 -9999. 0.467868 16.7102 -9999. 0.481745 16.9805 -9999. 0.496359 17.2551 -9999. 0.511416 17.5342 -9999. 0.526930 17.8178 -9999. 0.542915 18.1060 -9999. 0.559384 18.3989 -9999. 0.576354 18.6964 -9999. 0.593148 18.9988 -9999. 0.608687 19.3061 -9999. 0.624634 19.6184 -9999. 0.640999 19.9357 -9999. 0.657792 20.2582 -9999. 0.675025 20.5858 -9999. 0.692710 20.9188 -9999. 0.724043 21.2571 -9999. 0.776670 21.6009 -9999. 0.833122 21.9503 -9999. 0.893678 22.3053 -9999. 0.979492 22.6661 -9999. 1.10391 23.0327 -9999. 1.24412 23.4053 -9999. 1.40705 23.7838 -9999. 1.59497 24.1685 -9999. 1.81469 24.5594 -9999. 2.08010 24.9566 -9999. 2.39091 25.3603 -9999. 2.75770 25.7705 -9999. 3.19423 26.1873 -9999. 3.69098 26.6109 -9999. 4.10723 27.0413 -9999. 4.57043 27.4786 -9999. 5.24241 27.9231 -9999. 6.01694 28.3747 -9999. 6.60161 28.8337 -9999. 7.20507 29.3000 0.651582 7.86585 29.7739 0.948041 8.62195 30.2555 1.55893 9.28488 30.7449 2.08510 9.66368 31.2421 2.56789 10.0579 31.7475 3.13073 10.4175 32.2609 3.68079 10.6738 32.7827 4.28397 10.9364 33.3130 4.92504 10.9587 33.8518 5.42173 10.9326 34.3993 5.84829 10.9065 34.9557 6.24186 10.8776 35.5211 6.60670 10.8443 36.0956 6.95255 10.8111 36.6794 7.29092 10.7780 37.2727 7.64482 10.7177 37.8755 7.95242 10.6153 38.4882 8.22692 10.5139 39.1107 8.48003 10.4123 39.7432 8.71062 10.3046 40.3861 8.91904 10.1981 41.0393 9.10497 10.0926 41.7031 9.26303 10.0016 42.3776 9.42216 9.92379 43.0630 9.57536 9.84662 43.7595 9.71641 9.77007 44.4673 9.83881 9.70466 45.1865 9.96488 9.65008 45.9174 10.0877 9.59580 46.6600 10.1980 9.54183 47.4147 10.2943 9.51503 48.1816 10.4103 9.50090 48.9609 10.5395 9.48681 49.7528 10.6853 9.47067 50.5576 10.8281 9.41852 51.3753 10.9560 9.36665 52.2062 11.0748 9.31505 53.0506 11.1879 9.26375 53.9087 11.2960 9.21273 54.7806 11.3997 9.16199 55.6667 11.4992 9.11154 56.5670 11.5953 9.06136 57.4820 11.6888 9.01146 58.4117 11.7830 8.95721 59.3564 11.8669 8.89748 60.3165 11.9431 8.83814 61.2921 12.0125 8.77920 62.2834 12.0753 8.72066 63.2908 12.1311 8.66251 64.3145 12.1794 8.60473 65.3547 12.2190 8.54736 66.4118 12.2466 8.49036 67.4859 12.2514 8.43388 68.5775 12.2487 8.42013 69.6867 12.2626 8.41337 70.8138 12.2822 8.40662 71.9591 12.3032 8.39986 73.1230 12.3237 8.39312 74.3057 12.3423 8.38639 75.5076 12.3564 8.37966 76.7289 12.3608 8.37945 77.9699 12.3696 8.38679 79.2310 12.3796 8.39413 80.5125 12.3871 8.40148 81.8147 12.3907 8.40884 83.1380 12.3865 8.41620 84.4827 12.3626 8.42425 85.8491 12.3414 8.47264 87.2377 12.3344 8.52130 88.6487 12.3329 8.57025 90.0825 12.3340 8.61947 91.5395 12.3359 8.66899 93.0201 12.3363 8.71878 94.5246 12.3285 8.76885 96.0535 12.3263 8.84827 97.6071 12.3402 8.92850 99.1858 12.3698 9.00947 100.790 12.4237 9.09117 102.420 12.5446 9.12287 104.077 12.6061 9.08698 105.760 12.6262 9.05122 107.471 12.6310 9.01560 109.209 12.6419 8.96983 110.975 12.6146 8.88177 112.770 12.5455 8.79458 114.594 12.4456 8.70825 116.448 12.3175 8.62277 118.331 12.1643 8.53812 120.245 11.9969 8.45430 122.190 11.8745 8.31163 124.166 11.5952 8.02328 126.175 11.1709 7.74493 128.215 10.6144 7.47623 130.289 9.92880 7.21686 132.397 9.08448 6.89601 134.538 7.97678 6.55137 136.714 6.46892 5.94455 138.925 4.06168 5.45334 141.172 0.388114 5.10897 143.456 -6.29039 5.19253 145.776 -16.6894 12.8836 148.134 -20.6146 33.5857 150.530 0.144398E-02 46.5790 152.964 14.1930 42.5670 155.439 21.5318 36.3238 157.953 23.6132 29.9094 160.507 22.7550 25.9582 163.103 22.0993 24.5422 165.742 22.1845 23.6741 168.422 22.3931 22.8367 171.146 22.6604 22.1813 173.915 22.9563 21.5515 176.727 23.2307 20.9397 179.586 23.4066 20.3905 182.491 23.6184 19.9507 185.442 23.8346 19.5204 188.442 24.0288 19.0993 191.489 24.1720 18.6873 194.587 24.2966 18.3677 197.734 24.4312 18.0626 200.932 24.5559 17.7625 204.182 24.6523 17.4953 207.485 24.7626 17.2606 210.840 24.8736 17.0290 214.251 24.9794 16.7996 217.716 25.0632 16.5628 221.237 25.1112 16.3294 224.816 25.0856 16.0993 228.452 25.0021 16.0346 232.147 25.0119 16.0485 235.902 25.1024 16.0624 239.717 25.2504 16.0764 243.595 25.4363 16.0110 247.535 25.5902 15.9135 251.538 25.7147 15.8167 255.607 25.8244 15.7245 259.741 25.9255 15.6375 263.942 26.0134 15.5510 268.211 26.0694 15.4649 272.549 26.0766 15.4347 276.957 26.1377 15.4750 281.437 26.2352 15.5154 285.989 26.3550 15.5559 290.615 26.4938 15.5965 295.315 26.6610 15.6373 300.092 26.8530 15.6447 304.945 27.0261 15.6246 309.878 27.1885 15.6046 314.890 27.3458 15.5846 319.983 27.4994 15.5647 325.158 27.6484 15.5447 330.418 27.7868 15.5248 335.762 27.9239 15.5305 341.192 28.0736 15.5421 346.711 28.2344 15.5537 352.319 28.4028 15.5653 358.017 28.5815 15.5769 363.808 28.7773 15.5787 369.692 28.9649 15.5610 375.672 29.1472 15.5434 381.748 29.3287 15.5257 387.922 29.5113 15.5081 394.197 29.6976 15.4906 400.573 29.8973 15.4682 407.052 30.0878 15.4231 413.635 30.2691 15.3782 420.326 30.4453 15.3334 427.124 30.6180 15.2887 434.032 30.7880 15.2442 441.052 30.9557 15.1998 448.186 31.1193 15.1555 455.435 31.2824 15.1168 462.802 31.4481 15.0791 470.287 31.6155 15.0415 477.894 31.7851 15.0040 485.623 31.9576 14.9665 493.478 32.1428 14.9292 501.459 32.3270 14.8701 509.570 32.5022 14.8090 517.812 32.6744 14.7482 526.187 32.8525 14.6876 534.698 33.0278 14.6120 543.346 33.1947 14.5346 552.134 33.3580 14.4576 561.065 33.5202 14.3810 570.139 33.6839 14.3048 579.361 33.8537 14.2291 588.732 34.0492 14.1537 598.254 34.2377 14.0114 607.930 34.3961 13.8611 617.763 34.5297 13.7124 627.755 34.6490 13.5653 637.908 34.7563 13.4198 648.226 34.8530 13.2759 658.711 34.9401 13.1335 669.365 35.0181 12.9926 680.191 35.0902 12.8525 691.193 35.1520 12.7099 702.372 35.2030 12.5689 713.733 35.2446 12.4295 725.277 35.2774 12.2916 737.008 35.3015 12.1552 748.928 35.3175 12.0203 761.042 35.3283 11.8870 773.351 35.3294 11.7447 785.859 35.3153 11.6011 798.570 35.2862 11.4593 811.486 35.2437 11.3191 824.611 35.1878 11.1808 837.949 35.1187 11.0440 851.502 35.0356 10.9070 865.274 34.9366 10.7695 879.269 34.8184 10.6317 893.491 34.6806 10.4957 907.943 34.5224 10.3613 922.628 34.3442 10.2287 937.551 34.1406 10.0912 952.715 33.9072 9.95386 968.124 33.6395 9.81685 983.783 33.3352 9.68203 999.695 32.9904 9.54793 1015.86 32.6002 9.41447 1032.29 32.1508 9.27440 1048.99 31.6311 9.13631 1065.96 31.0283 9.00026 1083.20 30.3249 8.86615 1100.72 29.4953 8.73396 1118.52 28.5020 8.60365 1136.61 27.2887 8.47560 1155. 25.7630 8.34937 1173.68 23.7598 8.22492 1192.66 20.9402 8.10249 1211.95 16.4119 7.98186 1231.55 5.86091 7.86299 1241. -39.6154 7.80701 1241.20 -39.5880 39.5864 1251.47 7.88700 39.1186 1271.72 19.5288 38.2240 1292.29 25.2158 37.3498 1313.19 29.0414 36.4957 1334.43 31.9206 35.6610 1356.01 34.2140 34.8454 1377.94 36.1013 34.0484 1400.23 37.6850 33.2696 1422.88 39.0278 32.5088 1445.89 40.1696 31.7655 1469.28 41.1342 31.0390 1493.04 41.9325 30.3289 1517.19 42.5611 29.6352 1541.73 42.9931 28.9575 1566.67 43.1453 28.2955 1592.01 42.5693 27.6483 1611.20 35.9249 27.1746 1611.40 35.9465 31.7793 1617.76 41.7756 31.6085 1643.92 44.6986 30.9220 1670.51 46.0603 30.2504 1697.53 46.9951 29.5936 1724.99 47.6333 28.9514 1752.89 47.7067 28.3231 1767.60 45.3081 28.0012 1767.80 45.3277 30.0151 1781.24 48.5041 29.7007 1810.05 49.8811 29.0454 1839.32 50.7855 28.4047 1869.07 51.4981 27.7782 1899.30 52.0712 27.1660 1930.02 52.4890 26.5667 1961.24 52.4352 25.9806 1967.40 51.1135 25.8676 1967.60 51.1167 26.9456 1992.96 53.4307 26.5000 2025.20 54.1982 25.9522 2057.95 54.8065 25.4023 2091.24 55.3334 24.8609 2125.06 55.8051 24.3287 2159.43 56.2347 23.8055 2194.36 56.6289 23.2910 2229.85 56.9927 22.7855 2265.92 57.3293 22.2889 2302.57 57.6417 21.8012 2339.81 57.9317 21.3222 2377.66 58.2015 20.8519 2416.11 58.4518 20.3900 2455.19 58.6846 19.9375 2494.90 58.9013 19.4933 2535.26 59.1028 19.0576 2576.26 59.2895 18.6302 2617.93 59.4629 18.2116 2660.27 59.6237 17.8009 2703.30 59.7722 17.3984 2747.03 59.9099 17.0047 2791.46 60.0370 16.6181 2836.61 60.1535 16.2398 2882.49 60.2607 15.8694 2929.11 60.3589 15.5064 2976.48 60.4487 15.1511 3024.63 60.5297 14.8027 3073.55 60.6033 14.4626 3123.26 60.6698 14.1289 3173.78 60.7289 13.8021 3225.11 60.7808 13.4830 3277.27 60.8272 13.1711 3330.28 60.8672 12.8647 3384.15 60.9011 12.5658 3438.88 60.9299 12.2733 3494.50 60.9532 11.9870 3551.02 60.9713 11.7071 3608.46 60.9846 11.4332 3666.82 60.9930 11.1654 3726.13 60.9970 10.9036 3786.40 60.9966 10.6476 3847.64 60.9919 10.3973 3909.87 60.9831 10.1525 3973.11 60.9704 9.91329 4037.38 60.9537 9.67927 4102.68 60.9333 9.45067 4169.03 60.9091 9.22709 4236.46 60.8812 9.00870 4304.98 60.8498 8.79506 4374.62 60.8147 8.58635 4445.37 60.7761 8.38237 4517.27 60.7339 8.18299 4590.33 60.6882 7.98821 4664.58 60.6389 7.79767 4740.03 60.5858 7.61156 4816.69 60.5289 7.42979 4894.60 60.4682 7.25208 4973.77 60.4036 7.07853 5054.21 60.3348 6.90880 5135.96 60.2616 6.74299 5219.03 60.1838 6.58095 5303.44 60.1011 6.42274 5389.22 60.0133 6.26796 5476.39 59.9198 6.11675 5564.97 59.8201 5.96912 5654.98 59.7139 5.82484 5746.44 59.6004 5.68387 5839.39 59.4787 5.54609 5933.83 59.3477 5.41143 6029.81 59.2065 5.28005 6127.33 59.0536 5.15149 6226.44 58.8868 5.02586 6327.15 58.7040 4.90319 6429.48 58.5021 4.78328 6533.48 58.2771 4.66619 6639.15 58.0235 4.55177 6746.54 57.7334 4.43979 6855.65 57.3954 4.33054 6966.54 56.9917 4.22382 7079.22 56.4915 4.11929 7193.72 55.8351 4.01741 7310.07 54.8793 3.91758 7428.31 53.0769 3.82042 7513.90 39.2329 3.75252 7514.10 39.2334 10.2014 7548.45 51.2377 10.1318 7670.54 54.2723 9.89089 7794.61 55.2962 9.65587 7920.68 55.7667 9.42627 8048.79 55.8349 9.20232 8178.98 55.1954 8.98365 8251.50 48.1279 8.86556 8251.70 48.1303 12.4114 8311.26 55.4242 12.2418 8445.69 57.0018 11.8720 8582.29 57.5979 11.5134 8707.90 54.7474 11.1982 8708.10 54.7481 12.7208 8721.11 57.1654 12.6934 8862.16 58.8928 12.4030 9005.50 59.6695 12.1180 9151.16 60.2602 11.8371 9299.17 60.7491 11.5607 9449.58 61.1689 11.2890 9602.42 61.5370 11.0219 9757.73 61.8636 10.7592 9915.55 62.1560 10.5019 10075.9 62.4202 10.2486 10238.9 62.6589 10.0001 10404.5 62.8760 9.75621 10572.8 63.0738 9.51700 10743.8 63.2544 9.28247 10917.6 63.4195 9.05258 11094.2 63.5707 8.82732 11273.6 63.7091 8.60665 11455.9 63.8360 8.39055 11641.2 63.9521 8.17898 11829.5 64.0584 7.97189 12020.8 64.1557 7.76925 12215.3 64.2447 7.57100 12412.8 64.3259 7.37710 12613.6 64.3999 7.18749 12817.6 64.4672 7.00213 13025.0 64.5283 6.82094 13235.6 64.5835 6.64387 13449.7 64.6334 6.47088 13667.2 64.6782 6.30188 13888.3 64.7184 6.13682 14112.9 64.7540 5.97564 14341.2 64.7856 5.81828 14573.1 64.8133 5.66465 14808.9 64.8374 5.51472 15048.4 64.8581 5.36839 15291.8 64.8756 5.22562 15539.1 64.8902 5.08634 15790.4 64.9020 4.95047 16045.8 64.9111 4.81795 16305.4 64.9179 4.68872 16569.1 64.9223 4.56272 16837.1 64.9246 4.43986 17109.4 64.9249 4.32011 17386.1 64.9233 4.20337 17667.4 64.9200 4.08960 17953.1 64.9150 3.97873 18243.5 64.9085 3.87070 18538.6 64.9005 3.76544 18838.4 64.8912 3.66289 19143.1 64.8807 3.56301 19452.7 64.8689 3.46571 19767.4 64.8561 3.37095 20087.1 64.8422 3.27867 20412.0 64.8274 3.18880 20742.1 64.8117 3.10130 21077.6 64.7952 3.01611 21418.5 64.7778 2.93317 21765.0 64.7598 2.85243 22117.0 64.7410 2.77384 22474.7 64.7217 2.69734 22838.2 64.7017 2.62289 23207.6 64.6812 2.55043 23583.0 64.6601 2.47992 23964.4 64.6385 2.41131 24352.0 64.6165 2.34454 24745.9 64.5940 2.27958 25146.2 64.5712 2.21638 25552.9 64.5479 2.15489 25966.2 64.5242 2.09508 26386.1 64.5002 2.03689 26812.9 64.4758 1.98029 27246.6 64.4510 1.92524 27687.3 64.4260 1.87169 28135.1 64.4005 1.81961 28590.2 64.3748 1.76896 29052.6 64.3486 1.71970 29522.5 64.3222 1.67180 30000.0 64.2953 1.62522 periodictable-1.5.0/periodictable/xsf/tc.nff000066400000000000000000000315641310514471200210410ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.16890 10.1617 -9999. 1.22630 10.3261 -9999. 1.28651 10.4931 -9999. 1.34968 10.6628 -9999. 1.41595 10.8353 -9999. 1.48547 11.0106 -9999. 1.55841 11.1886 -9999. 1.63493 11.3696 -9999. 1.71520 11.5535 -9999. 1.79060 11.7404 -9999. 1.85821 11.9303 -9999. 1.92837 12.1232 -9999. 2.00119 12.3193 -9999. 2.07675 12.5186 -9999. 2.15643 12.7210 -9999. 2.24083 12.9268 -9999. 2.32854 13.1359 -9999. 2.41967 13.3483 -9999. 2.51072 13.5642 -9999. 2.59715 13.7836 -9999. 2.68656 14.0066 -9999. 2.77904 14.2331 -9999. 2.87471 14.4633 -9999. 2.97073 14.6973 -9999. 3.06680 14.9350 -9999. 3.16598 15.1765 -9999. 3.26836 15.4220 -9999. 3.37406 15.6714 -9999. 3.46886 15.9249 -9999. 3.54805 16.1825 -9999. 3.62904 16.4442 -9999. 3.71188 16.7102 -9999. 3.79661 16.9805 -9999. 3.88292 17.2551 -9999. 3.96908 17.5342 -9999. 4.05715 17.8178 -9999. 4.14718 18.1060 -9999. 4.23920 18.3989 -9999. 4.33326 18.6964 -9999. 4.42942 18.9988 -9999. 4.52770 19.3061 -9999. 4.58174 19.6184 -9999. 4.63623 19.9357 -9999. 4.69149 20.2582 -9999. 4.74862 20.5858 -9999. 4.80646 20.9188 -9999. 4.86499 21.2571 -9999. 4.92424 21.6009 -9999. 4.98421 21.9503 -9999. 5.04491 22.3053 -9999. 5.10635 22.6661 -9999. 5.16504 23.0327 -9999. 5.19243 23.4053 -9999. 5.21996 23.7838 -9999. 5.24765 24.1685 -9999. 5.27548 24.5594 -9999. 5.30345 24.9566 -9999. 5.30974 25.3603 -9999. 5.29950 25.7705 -9999. 5.28929 26.1873 -9999. 5.27909 26.6109 -9999. 5.26892 27.0413 -9999. 5.25876 27.4786 -9999. 5.22652 27.9231 -9999. 5.16540 28.3747 -9999. 5.10500 28.8337 -9999. 5.04531 29.3000 7.37166 4.98631 29.7739 7.43509 4.92525 30.2555 7.48267 4.81345 30.7449 7.49547 4.70419 31.2421 7.48578 4.59741 31.7475 7.46206 4.48968 32.2609 7.41243 4.36859 32.7827 7.33520 4.25077 33.3130 7.23723 4.12859 33.8518 7.08784 3.99000 34.3993 6.87034 3.86322 34.9557 6.61076 3.78904 35.5211 6.29120 3.73288 36.0956 5.94067 3.75422 36.6794 5.51899 3.83128 37.2727 5.09533 3.97773 37.8755 4.58341 4.26742 38.4882 4.18756 4.68469 39.1107 3.85000 5.14275 39.7432 3.52904 5.64560 40.3861 3.18421 6.22739 41.0393 2.92130 6.99385 41.7031 2.78250 7.85463 42.3776 2.81406 8.82136 43.0630 3.15931 9.80863 43.7595 3.57313 10.5860 44.4673 4.11858 11.3361 45.1865 4.67136 12.0004 45.9174 5.35619 12.7037 46.6600 6.10311 13.1431 47.4147 6.84115 13.5966 48.1816 7.72059 13.9698 48.9609 8.53817 14.1836 49.7528 9.36473 14.4007 50.5576 10.3179 14.6211 51.3753 11.3579 14.4911 52.2062 12.1996 14.2552 53.0506 12.9725 14.0231 53.9087 13.7587 13.7948 54.7806 14.7200 13.4012 55.6667 15.3820 12.6585 56.5670 15.7699 11.9812 57.4820 16.0790 11.4817 58.4117 16.3730 11.0031 59.3564 16.6473 10.5443 60.3165 16.8862 10.0809 61.2921 17.0869 9.63785 62.2834 17.2599 9.21431 63.2908 17.4121 8.80939 64.3145 17.5505 8.42224 65.3547 17.6871 8.05212 66.4118 17.8566 7.65887 67.4859 17.9548 7.21569 68.5775 18.0080 6.79817 69.6867 18.0407 6.40480 70.8138 18.0880 5.99628 71.9591 18.0544 5.56111 73.1230 17.9623 5.15754 74.3057 17.8236 4.82222 75.5076 17.7002 4.53199 76.7289 17.5808 4.25922 77.9699 17.4518 4.00287 79.2310 17.2983 3.78562 80.5125 17.1776 3.60675 81.8147 17.0829 3.43634 83.1380 17.0235 3.26444 84.4827 16.9418 3.02963 85.8491 16.8264 2.81171 87.2377 16.6882 2.61612 88.6487 16.5482 2.43998 90.0825 16.4067 2.27569 91.5395 16.2646 2.12247 93.0201 16.1165 1.96821 94.5246 15.9571 1.82456 96.0535 15.7841 1.69140 97.6071 15.6045 1.58592 99.1858 15.4315 1.49249 100.790 15.2549 1.40456 102.420 15.0546 1.33154 104.077 14.8707 1.30103 105.760 14.6982 1.27522 107.471 14.5376 1.26046 109.209 14.3801 1.24587 110.975 14.2249 1.24819 112.770 14.0799 1.25535 114.594 13.9359 1.27065 116.448 13.8044 1.29476 118.331 13.6800 1.31933 120.245 13.5563 1.34512 122.190 13.4387 1.38077 124.166 13.3280 1.41738 126.175 13.2213 1.45495 128.215 13.1149 1.49352 130.289 13.0121 1.54153 132.397 12.9165 1.59194 134.538 12.8263 1.64400 136.714 12.7415 1.69776 138.925 12.6648 1.75328 141.172 12.5929 1.79879 143.456 12.5184 1.84304 145.776 12.4431 1.88838 148.134 12.3683 1.93426 150.530 12.2939 1.98095 152.964 12.2204 2.02877 155.439 12.1481 2.07774 157.953 12.0781 2.12790 160.507 12.0151 2.17926 163.103 11.9537 2.21750 165.742 11.8853 2.25297 168.422 11.8136 2.28901 171.146 11.7411 2.32562 173.915 11.6743 2.35799 176.727 11.5967 2.37664 179.586 11.5091 2.39544 182.491 11.4135 2.41439 185.442 11.3103 2.43358 188.442 11.1999 2.45303 191.489 11.0817 2.47264 194.587 10.9557 2.49239 197.734 10.8223 2.51232 200.932 10.6781 2.52681 204.182 10.5201 2.54117 207.485 10.3473 2.55562 210.840 10.1584 2.57015 214.251 9.95073 2.58566 217.716 9.72317 2.60238 221.237 9.47149 2.61921 224.816 9.18736 2.63637 228.452 8.86388 2.66524 232.147 8.50599 2.70937 235.902 8.06419 2.76557 239.717 7.60929 2.91946 243.595 7.14670 3.08193 247.535 6.61980 3.25343 251.538 6.05436 3.53883 255.607 5.47050 3.83335 259.741 4.70238 4.19080 263.942 3.87048 4.73985 268.211 3.08638 5.62785 272.549 2.42175 6.68223 276.957 1.92526 7.92684 281.437 1.74073 9.37968 285.989 1.78665 10.6247 290.615 2.10913 11.9587 295.315 2.46263 12.9300 300.092 2.86646 13.9802 304.945 3.37108 14.9000 309.878 3.87091 15.7829 314.890 4.54441 16.6537 319.983 5.19136 17.3545 325.158 5.95551 18.0167 330.418 6.63523 18.4930 335.762 7.24587 18.9772 341.192 7.84397 19.4489 346.711 8.44774 19.9324 352.319 9.09472 20.4280 358.017 9.90055 20.8365 363.808 10.6174 21.0751 369.692 11.2407 21.3163 375.672 11.8406 21.5604 381.748 12.4293 21.8145 387.922 13.0240 22.0754 394.197 13.6347 22.3394 400.573 14.2715 22.6065 407.052 15.0272 22.8768 413.635 15.7847 22.9370 420.326 16.4398 22.9562 427.124 17.0414 22.9755 434.032 17.5885 22.9948 441.052 18.0684 23.0874 448.186 18.6886 23.3023 455.435 19.5037 23.3851 462.802 20.1795 23.2504 470.287 20.7707 23.1337 477.894 21.3262 23.0176 485.623 21.8514 22.9022 493.478 22.3522 22.7873 501.459 22.8295 22.6726 509.570 23.2798 22.5590 517.812 23.6778 22.4631 526.187 24.0509 22.4272 534.698 24.4514 22.5047 543.346 24.9815 22.6391 552.134 25.6947 22.7740 561.065 26.5180 22.6037 570.139 27.2204 22.2880 579.361 27.7809 21.9535 588.732 28.2829 21.6284 598.254 28.7466 21.3108 607.930 29.1808 20.9975 617.763 29.5917 20.6889 627.755 29.9881 20.3837 637.908 30.3714 20.0701 648.226 30.7344 19.7407 658.711 31.0588 19.4033 669.365 31.3427 19.0713 680.191 31.5923 18.7840 691.193 31.8512 18.5308 702.372 32.1444 18.2862 713.733 32.4463 18.0080 725.277 32.7185 17.7091 737.008 32.9702 17.4161 748.928 33.2089 17.1277 761.042 33.4378 16.8439 773.351 33.6602 16.5626 785.859 33.8749 16.2787 798.570 34.0751 15.9937 811.486 34.2637 15.7137 824.611 34.4433 15.4387 837.949 34.6160 15.1684 851.502 34.7824 14.9002 865.274 34.9422 14.6336 879.269 35.0929 14.3691 893.491 35.2364 14.1094 907.943 35.3747 13.8543 922.628 35.5128 13.6038 937.551 35.6445 13.3446 952.715 35.7670 13.0870 968.124 35.8789 12.8314 983.783 35.9830 12.5809 999.695 36.0816 12.3345 1015.86 36.1768 12.0919 1032.29 36.2652 11.8464 1048.99 36.3460 11.6034 1065.96 36.4173 11.3628 1083.20 36.4809 11.1272 1100.72 36.5380 10.8965 1118.52 36.5893 10.6705 1136.61 36.6350 10.4491 1155. 36.6756 10.2323 1173.68 36.7115 10.0201 1192.66 36.7429 9.81229 1211.95 36.7699 9.60876 1231.55 36.7927 9.40949 1251.47 36.8116 9.21458 1271.72 36.8267 9.02398 1292.29 36.8386 8.83764 1313.19 36.8472 8.65498 1334.43 36.8526 8.47613 1356.01 36.8549 8.30103 1377.94 36.8542 8.12948 1400.23 36.8505 7.96152 1422.88 36.8444 7.79715 1445.89 36.8361 7.63613 1469.28 36.8264 7.47744 1493.04 36.8155 7.32056 1517.19 36.7998 7.16085 1541.73 36.7780 7.00379 1566.67 36.7505 6.85016 1592.01 36.7187 6.70009 1617.76 36.6827 6.55328 1643.92 36.6427 6.40959 1670.51 36.5983 6.26893 1697.53 36.5498 6.13145 1724.99 36.4984 5.99714 1752.89 36.4425 5.86328 1781.24 36.3807 5.73151 1810.05 36.3129 5.60197 1839.32 36.2387 5.47539 1869.07 36.1582 5.35178 1899.30 36.0715 5.23118 1930.02 35.9779 5.11290 1961.24 35.8765 4.99737 1992.96 35.7666 4.88481 2025.20 35.6501 4.77624 2057.95 35.5241 4.66695 2091.24 35.3858 4.55979 2125.06 35.2346 4.45478 2159.43 35.0688 4.35192 2194.36 34.8864 4.25115 2229.85 34.6844 4.15241 2265.92 34.4595 4.05568 2302.57 34.2072 3.96096 2339.81 33.9212 3.86811 2377.66 33.5934 3.77722 2416.11 33.2118 3.68816 2455.19 32.7585 3.60095 2494.90 32.2052 3.51552 2535.26 31.5020 3.43186 2576.26 30.5482 3.34994 2617.93 29.0794 3.26969 2660.27 25.7283 3.19110 2676.80 12.8319 3.16127 2677. 12.8336 11.0693 2703.30 26.6708 10.9097 2747.03 28.4483 10.6527 2791.46 25.6981 10.4016 2793.10 22.1757 10.3925 2793.30 22.1803 14.3074 2836.61 30.6058 14.0749 2882.49 32.1711 13.8366 2929.11 33.1956 13.6029 2976.48 33.9061 13.3728 3024.63 34.1676 13.1468 3042.40 32.2661 13.0652 3042.60 32.2700 14.3922 3073.55 35.1555 14.1871 3123.26 36.1763 13.8680 3173.78 36.9158 13.5539 3225.11 37.5266 13.2442 3277.27 38.0531 12.9395 3330.28 38.5172 12.6397 3384.15 38.9310 12.3443 3438.88 39.3038 12.0547 3494.50 39.6418 11.7696 3551.02 39.9493 11.4895 3608.46 40.2303 11.2147 3666.82 40.4876 10.9448 3726.13 40.7241 10.6805 3786.40 40.9421 10.4208 3847.64 41.1421 10.1656 3909.87 41.3263 9.91610 3973.11 41.4964 9.67151 4037.38 41.6533 9.43192 4102.68 41.7980 9.19719 4169.03 41.9315 8.96736 4236.46 42.0546 8.74243 4304.98 42.1681 8.52225 4374.62 42.2725 8.30675 4445.37 42.3686 8.09594 4517.27 42.4568 7.88983 4590.33 42.5378 7.68828 4664.58 42.6119 7.49120 4740.03 42.6797 7.29860 4816.69 42.7415 7.11047 4894.60 42.7978 6.92660 4973.77 42.8488 6.74687 5054.21 42.8948 6.57146 5135.96 42.9363 6.40008 5219.03 42.9734 6.23282 5303.44 43.0065 6.06949 5389.22 43.0358 5.91010 5476.39 43.0616 5.75450 5564.97 43.0839 5.60265 5654.98 43.1031 5.45455 5746.44 43.1194 5.30998 5839.39 43.1329 5.16904 5933.83 43.1437 5.03150 6029.81 43.1521 4.89738 6127.33 43.1582 4.76666 6226.44 43.1621 4.63916 6327.15 43.1640 4.51495 6429.48 43.1641 4.39381 6533.48 43.1623 4.27569 6639.15 43.1589 4.16057 6746.54 43.1539 4.04840 6855.65 43.1474 3.93912 6966.54 43.1395 3.83261 7079.22 43.1304 3.72891 7193.72 43.1201 3.62786 7310.07 43.1086 3.52934 7428.31 43.0961 3.43356 7548.45 43.0827 3.34007 7670.54 43.0683 3.24908 7794.61 43.0530 3.16052 7920.68 43.0370 3.07424 8048.79 43.0201 2.99023 8178.98 43.0026 2.90849 8311.26 42.9844 2.82887 8445.69 42.9657 2.75144 8582.29 42.9464 2.67584 8721.11 42.9265 2.60243 8862.16 42.9061 2.53091 9005.50 42.8853 2.46127 9151.16 42.8639 2.39355 9299.17 42.8422 2.32769 9449.58 42.8201 2.26360 9602.42 42.7977 2.20111 9757.73 42.7749 2.14033 9915.55 42.7517 2.08123 10075.9 42.7282 2.02369 10238.9 42.7044 1.96771 10404.5 42.6803 1.91324 10572.8 42.6559 1.86024 10743.8 42.6312 1.80868 10917.6 42.6062 1.75851 11094.2 42.5808 1.70970 11273.6 42.5552 1.66222 11455.9 42.5293 1.61603 11641.2 42.5030 1.57109 11829.5 42.4764 1.52737 12020.8 42.4494 1.48485 12215.3 42.4221 1.44348 12412.8 42.3943 1.40324 12613.6 42.3661 1.36410 12817.6 42.3375 1.32603 13025.0 42.3083 1.28899 13235.6 42.2786 1.25297 13449.7 42.2483 1.21793 13667.2 42.2173 1.18385 13888.3 42.1856 1.15070 14112.9 42.1531 1.11846 14341.2 42.1196 1.08709 14573.1 42.0852 1.05659 14808.9 42.0496 1.02692 15048.4 42.0128 0.998065 15291.8 41.9745 0.969997 15539.1 41.9347 0.942699 15790.4 41.8930 0.916146 16045.8 41.8492 0.890320 16305.4 41.8029 0.865201 16569.1 41.7539 0.840769 16837.1 41.7017 0.817006 17109.4 41.6456 0.793892 17386.1 41.5849 0.771411 17667.4 41.5188 0.749543 17953.1 41.4460 0.728274 18243.5 41.3650 0.707585 18538.6 41.2735 0.687461 18838.4 41.1685 0.667887 19143.1 41.0452 0.648847 19452.7 40.8965 0.630327 19767.4 40.7097 0.612310 20087.1 40.4610 0.594786 20412.0 40.0945 0.577738 20742.1 39.4202 0.561154 21043.9 31.5802 0.546632 21044.1 31.5804 3.65633 21077.6 37.3416 3.64736 21418.5 39.8013 3.55820 21765.0 40.4975 3.47064 22117.0 40.9262 3.38468 22474.7 41.2375 3.30033 22838.2 41.4815 3.21759 23207.6 41.6813 3.13646 23583.0 41.8496 3.05694 23964.4 41.9943 2.97901 24352.0 42.1203 2.90268 24745.9 42.2314 2.82793 25146.2 42.3300 2.75475 25552.9 42.4181 2.68313 25966.2 42.4972 2.61305 26386.1 42.5686 2.54450 26812.9 42.6331 2.47747 27246.6 42.6917 2.41193 27687.3 42.7449 2.34787 28135.1 42.7933 2.28527 28590.2 42.8375 2.22410 29052.6 42.8782 2.16436 29522.5 42.9209 2.10602 30000.0 42.9302 2.04905 periodictable-1.5.0/periodictable/xsf/te.nff000066400000000000000000000317131310514471200210370ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 9.70237 10.1617 -9999. 9.72653 10.3261 -9999. 9.75076 10.4931 -9999. 9.77506 10.6628 -9999. 9.79940 10.8353 -9999. 9.77638 11.0106 -9999. 9.72308 11.1886 -9999. 9.67008 11.3696 -9999. 9.61736 11.5535 -9999. 9.54395 11.7404 -9999. 9.46085 11.9303 -9999. 9.37848 12.1232 -9999. 9.29150 12.3193 -9999. 9.19140 12.5186 -9999. 9.09238 12.7210 -9999. 8.99443 12.9268 -9999. 8.90490 13.1359 -9999. 8.81998 13.3483 -9999. 8.73588 13.5642 -9999. 8.65256 13.7836 -9999. 8.32120 14.0066 -9999. 7.97096 14.2331 -9999. 7.65865 14.4633 -9999. 7.37439 14.6973 -9999. 7.07333 14.9350 -9999. 6.76248 15.1765 -9999. 6.46529 15.4220 -9999. 6.20847 15.6714 -9999. 5.96465 15.9249 -9999. 5.75268 16.1825 -9999. 5.61163 16.4442 -9999. 5.47404 16.7102 -9999. 5.33982 16.9805 -9999. 5.19298 17.2551 -9999. 5.01356 17.5342 -9999. 4.84034 17.8178 -9999. 4.67310 18.1060 -9999. 4.51347 18.3989 -9999. 4.36101 18.6964 -9999. 4.21371 18.9988 -9999. 4.07139 19.3061 -9999. 3.93243 19.6184 -9999. 3.79030 19.9357 -9999. 3.65331 20.2582 -9999. 3.44444 20.5858 -9999. 3.21816 20.9188 -9999. 3.02493 21.2571 -9999. 2.84787 21.6009 -9999. 2.71658 21.9503 -9999. 2.59134 22.3053 -9999. 2.45805 22.6661 -9999. 2.32492 23.0327 -9999. 2.14513 23.4053 -9999. 1.97252 23.7838 -9999. 1.88535 24.1685 -9999. 1.80203 24.5594 -9999. 1.71319 24.9566 -9999. 1.60315 25.3603 -9999. 1.49563 25.7705 -9999. 1.38815 26.1873 -9999. 1.29731 26.6109 -9999. 1.23174 27.0413 -9999. 1.16940 27.4786 -9999. 1.10701 27.9231 -9999. 1.04796 28.3747 -9999. 0.977697 28.8337 -9999. 0.901840 29.3000 4.66549 0.844635 29.7739 4.51435 0.819874 30.2555 4.37442 0.795837 30.7449 4.23907 0.769363 31.2421 4.09926 0.740463 31.7475 3.95604 0.711461 32.2609 3.80382 0.679349 32.7827 3.63674 0.651564 33.3130 3.46693 0.642369 33.8518 3.29761 0.633303 34.3993 3.12308 0.624365 34.9557 2.94210 0.620165 35.5211 2.75495 0.616361 36.0956 2.55765 0.612579 36.6794 2.34757 0.612202 37.2727 2.12557 0.613164 37.8755 1.88656 0.614129 38.4882 1.62431 0.615267 39.1107 1.33139 0.617596 39.7432 0.993601 0.619936 40.3861 0.583056 0.627144 41.0393 0.143339E-01 0.639935 41.7031 -0.929514 0.819245 42.3776 -1.92937 1.82459 43.0630 -0.626741 3.56658 43.7595 0.121031 3.24620 44.4673 0.202208 2.84244 45.1865 -0.384846E-01 2.52394 45.9174 -0.434534 2.29379 46.6600 -1.16650 2.30390 47.4147 -1.71905 2.65964 48.1816 -2.07132 3.04134 48.9609 -2.42488 3.37898 49.7528 -2.77063 3.74833 50.5576 -3.11558 4.14647 51.3753 -3.46176 4.58690 52.2062 -3.79519 5.11915 53.0506 -4.00432 5.73446 53.9087 -4.16388 6.19007 54.7806 -4.37055 6.67913 55.6667 -4.59082 7.20044 56.5670 -4.82099 7.75616 57.4820 -5.06818 8.35480 58.4117 -5.29783 9.07518 59.3564 -5.44403 9.86977 60.3165 -5.44933 10.7339 61.2921 -5.35417 11.4165 62.2834 -5.33990 12.0916 63.2908 -5.37272 12.8499 64.3145 -5.34097 13.6901 65.3547 -5.23072 14.5851 66.4118 -4.98193 15.5387 67.4859 -4.63444 16.3146 68.5775 -4.33613 17.0857 69.6867 -4.03957 17.8933 70.8138 -3.70316 18.7391 71.9591 -3.29868 19.6248 73.1230 -2.75174 20.4734 74.3057 -2.24552 21.2461 75.5076 -1.74216 22.0480 76.7289 -1.22224 22.9240 77.9699 -0.590245 23.8649 79.2310 0.220840 24.8127 80.5125 1.07313 25.6337 81.8147 1.95946 26.4817 83.1380 2.95256 27.3386 84.4827 4.04183 28.1851 85.8491 5.34082 29.0579 87.2377 6.76500 29.5799 88.6487 8.11641 30.0536 90.0825 9.47543 30.5348 91.5395 10.9340 31.0238 93.0201 12.6284 31.5207 94.5246 14.4792 31.6132 96.0535 16.1942 31.5762 97.6071 17.9369 31.5391 99.1858 19.8977 31.5022 100.790 22.1452 30.9673 102.420 24.0618 30.1064 104.077 25.9762 29.2695 105.760 28.5945 27.8425 107.471 30.2059 25.5986 109.209 31.1504 23.5356 110.975 31.8342 21.6388 112.770 32.3748 19.8949 114.594 32.9718 18.2915 116.448 33.5739 16.1379 118.331 33.5231 13.9535 120.245 33.0690 12.0647 122.190 32.4406 10.4316 124.166 31.6745 9.03391 126.175 30.8947 7.90432 128.215 30.1341 6.91598 130.289 29.3754 6.05125 132.397 28.6234 5.29464 134.538 27.8788 4.63261 136.714 27.1440 4.05337 138.925 26.4146 3.54654 141.172 25.6791 3.10310 143.456 24.9069 2.77197 145.776 24.2260 2.54912 148.134 23.5780 2.34418 150.530 22.8673 2.22832 152.964 22.2811 2.23271 155.439 21.7876 2.23711 157.953 21.3333 2.24152 160.507 20.8875 2.25635 163.103 20.4837 2.30549 165.742 20.1167 2.35571 168.422 19.7704 2.40703 171.146 19.4298 2.45946 173.915 19.0971 2.54273 176.727 18.7943 2.64275 179.586 18.5077 2.74670 182.491 18.2378 2.87381 185.442 17.9924 3.01015 188.442 17.7687 3.15297 191.489 17.5641 3.30256 194.587 17.3793 3.45926 197.734 17.2212 3.62338 200.932 17.0783 3.76835 204.182 16.9417 3.91758 207.485 16.8142 4.07273 210.840 16.6998 4.23402 214.251 16.6011 4.40169 217.716 16.5255 4.57601 221.237 16.4843 4.73000 224.816 16.4354 4.86332 228.452 16.3813 5.00038 232.147 16.3330 5.14132 235.902 16.2926 5.28623 239.717 16.2631 5.43521 243.595 16.2532 5.58840 247.535 16.2667 5.72257 251.538 16.2704 5.83748 255.607 16.2716 5.95471 259.741 16.2763 6.07429 263.942 16.2881 6.19626 268.211 16.3124 6.32069 272.549 16.3690 6.44260 276.957 16.4173 6.50829 281.437 16.4493 6.57465 285.989 16.4719 6.64169 290.615 16.4908 6.70941 295.315 16.5075 6.77782 300.092 16.5236 6.84693 304.945 16.5401 6.91674 309.878 16.5584 6.98727 314.890 16.5802 7.05852 319.983 16.6084 7.13049 325.158 16.6672 7.20319 330.418 16.7215 7.21670 335.762 16.7469 7.22331 341.192 16.7570 7.22993 346.711 16.7567 7.23657 352.319 16.7481 7.24320 358.017 16.7328 7.24984 363.808 16.7126 7.25649 369.692 16.6896 7.26314 375.672 16.6670 7.26980 381.748 16.6929 7.27196 387.922 16.6825 7.16808 394.197 16.6085 7.06571 400.573 16.4966 6.96479 407.052 16.3510 6.86530 413.635 16.1716 6.76725 420.326 15.9554 6.67059 427.124 15.6874 6.57686 434.032 15.3957 6.52987 441.052 15.0843 6.48322 448.186 14.7445 6.43691 455.435 14.3667 6.39093 462.802 13.9434 6.34527 470.287 13.4659 6.29995 477.894 12.9230 6.25495 485.623 12.3007 6.21026 493.478 11.5506 6.17379 501.459 10.7071 6.19347 509.570 9.75004 6.21321 517.812 8.61606 6.23302 526.187 7.19534 6.25289 534.698 5.40571 6.37474 543.346 3.15720 6.57361 552.134 -0.113654E-01 6.77867 561.065 -5.23200 7.25851 570.139 -18.5842 8.01168 572.900 -52.3115 8.25338 573.100 -52.2341 40.3200 579.361 -8.43237 39.5620 588.732 1.87282 38.4686 598.254 7.39573 37.4054 607.930 11.1658 36.3717 617.763 13.9686 35.3665 627.755 16.1006 34.3891 637.908 17.6092 33.6322 648.226 18.9882 33.1867 658.711 20.3429 32.7472 669.365 21.5864 32.3134 680.191 22.7433 31.8854 691.193 23.8722 31.4631 702.372 24.8919 30.8824 713.733 25.7608 30.2964 725.277 26.4947 29.7216 737.008 27.1146 29.1576 748.928 27.5810 28.6044 761.042 27.8845 28.1608 773.351 28.1829 27.8626 785.859 28.4565 27.5675 798.570 28.2572 27.2803 811.486 28.2393 27.8616 824.611 28.6851 28.4553 837.949 29.3900 29.0617 851.502 30.7858 29.4727 865.274 31.9964 29.1527 879.269 32.8390 28.8362 893.491 33.6140 28.5232 907.943 34.3351 28.1796 922.628 34.9868 27.8200 937.551 35.5695 27.4650 952.715 36.0543 27.1145 968.124 36.5342 26.9431 983.783 37.1002 26.8099 999.695 37.7876 26.6442 1015.86 38.5881 26.4217 1032.29 39.3056 25.9082 1048.99 39.9085 25.3964 1065.96 40.4270 24.8883 1083.20 40.8939 24.3903 1100.72 41.3203 23.9023 1118.52 41.7132 23.4240 1136.61 42.0773 22.9555 1155. 42.4162 22.4962 1173.68 42.7323 22.0460 1192.66 43.0281 21.6051 1211.95 43.3055 21.1729 1231.55 43.5656 20.7492 1251.47 43.8099 20.3347 1271.72 44.0399 19.9290 1292.29 44.2573 19.5319 1313.19 44.4628 19.1427 1334.43 44.6572 18.7613 1356.01 44.8414 18.3876 1377.94 45.0163 18.0214 1400.23 45.1828 17.6624 1422.88 45.3416 17.3105 1445.89 45.4945 16.9656 1469.28 45.6439 16.6252 1493.04 45.7907 16.2879 1517.19 45.9264 15.9423 1541.73 46.0481 15.6020 1566.67 46.1584 15.2691 1592.01 46.2599 14.9432 1617.76 46.3538 14.6242 1643.92 46.4409 14.3119 1670.51 46.5222 14.0063 1697.53 46.5981 13.7073 1724.99 46.6750 13.4147 1752.89 46.7465 13.1176 1781.24 46.8082 12.8234 1810.05 46.8607 12.5328 1839.32 46.9045 12.2487 1869.07 46.9417 11.9710 1899.30 46.9728 11.6995 1930.02 46.9986 11.4343 1961.24 47.0195 11.1752 1992.96 47.0339 10.9220 2025.20 47.0514 10.6800 2057.95 47.0659 10.4326 2091.24 47.0720 10.1900 2125.06 47.0728 9.95209 2159.43 47.0690 9.71947 2194.36 47.0609 9.49115 2229.85 47.0480 9.26714 2265.92 47.0307 9.04814 2302.57 47.0090 8.83346 2339.81 46.9835 8.62396 2377.66 46.9542 8.41836 2416.11 46.9204 8.21687 2455.19 46.8830 8.02045 2494.90 46.8413 7.82754 2535.26 46.7959 7.63953 2576.26 46.7465 7.45519 2617.93 46.6929 7.27509 2660.27 46.6353 7.09909 2703.30 46.5736 6.92695 2747.03 46.5075 6.75870 2791.46 46.4371 6.59429 2836.61 46.3622 6.43359 2882.49 46.2825 6.27661 2929.11 46.1977 6.12319 2976.48 46.1077 5.97338 3024.63 46.0121 5.82702 3073.55 45.9106 5.68416 3123.26 45.8026 5.54454 3173.78 45.6875 5.40824 3225.11 45.5649 5.27515 3277.27 45.4338 5.14520 3330.28 45.2934 5.01833 3384.15 45.1426 4.89453 3438.88 44.9800 4.77363 3494.50 44.8040 4.65571 3551.02 44.6127 4.54053 3608.46 44.4033 4.42815 3666.82 44.1728 4.31851 3726.13 43.9170 4.21152 3786.40 43.6303 4.10716 3847.64 43.3051 4.00531 3909.87 42.9306 3.90593 3973.11 42.4907 3.80893 4037.38 41.9598 3.71440 4102.68 41.2938 3.62216 4169.03 40.4045 3.53212 4236.46 39.0689 3.44428 4304.98 36.3202 3.35866 4341.30 21.2235 3.31469 4341.50 21.2252 11.3604 4374.62 36.0199 11.2248 4445.37 38.6748 10.9438 4517.27 39.4443 10.6700 4590.33 38.6508 10.4029 4611.90 32.3643 10.3262 4612.10 32.3691 14.1634 4664.58 40.4554 13.9109 4740.03 42.0405 13.5604 4816.69 42.9005 13.2188 4894.60 43.2781 12.8855 4939.10 40.4125 12.7013 4939.30 40.4171 14.4492 4973.77 43.7779 14.3075 5054.21 45.0467 13.9858 5135.96 45.8702 13.6686 5219.03 46.5284 13.3558 5303.44 47.0861 13.0477 5389.22 47.5719 12.7443 5476.39 48.0020 12.4458 5564.97 48.3871 12.1521 5654.98 48.7342 11.8635 5746.44 49.0489 11.5798 5839.39 49.3354 11.3010 5933.83 49.5970 11.0274 6029.81 49.8365 10.7586 6127.33 50.0560 10.4950 6226.44 50.2576 10.2364 6327.15 50.4430 9.98292 6429.48 50.6134 9.73437 6533.48 50.7700 9.49083 6639.15 50.9142 9.25244 6746.54 51.0469 9.01886 6855.65 51.1689 8.79031 6966.54 51.2812 8.56648 7079.22 51.3840 8.34731 7193.72 51.4782 8.13295 7310.07 51.5645 7.92342 7428.31 51.6434 7.71862 7548.45 51.7154 7.51829 7670.54 51.7809 7.32240 7794.61 51.8401 7.13101 7920.68 51.8938 6.94428 8048.79 51.9423 6.76162 8178.98 51.9856 6.58325 8311.26 52.0244 6.40927 8445.69 52.0589 6.23916 8582.29 52.0889 6.07317 8721.11 52.1152 5.91143 8862.16 52.1381 5.75344 9005.50 52.1575 5.59935 9151.16 52.1738 5.44897 9299.17 52.1870 5.30225 9449.58 52.1975 5.15935 9602.42 52.2054 5.01995 9757.73 52.2108 4.88385 9915.55 52.2139 4.75128 10075.9 52.2148 4.62211 10238.9 52.2136 4.49623 10404.5 52.2106 4.37356 10572.8 52.2058 4.25403 10743.8 52.1994 4.13759 10917.6 52.1914 4.02415 11094.2 52.1820 3.91366 11273.6 52.1712 3.80605 11455.9 52.1591 3.70125 11641.2 52.1459 3.59921 11829.5 52.1316 3.49984 12020.8 52.1162 3.40311 12215.3 52.0998 3.30894 12412.8 52.0826 3.21727 12613.6 52.0645 3.12804 12817.6 52.0457 3.04120 13025.0 52.0261 2.95669 13235.6 52.0059 2.87445 13449.7 51.9850 2.79443 13667.2 51.9635 2.71657 13888.3 51.9415 2.64082 14112.9 51.9189 2.56713 14341.2 51.8959 2.49544 14573.1 51.8724 2.42570 14808.9 51.8485 2.35788 15048.4 51.8242 2.29191 15291.8 51.7995 2.22775 15539.1 51.7745 2.16535 15790.4 51.7491 2.10468 16045.8 51.7233 2.04568 16305.4 51.6973 1.98830 16569.1 51.6709 1.93252 16837.1 51.6441 1.87829 17109.4 51.6171 1.82556 17386.1 51.5898 1.77430 17667.4 51.5621 1.72447 17953.1 51.5341 1.67603 18243.5 51.5058 1.62894 18538.6 51.4771 1.58317 18838.4 51.4480 1.53868 19143.1 51.4185 1.49544 19452.7 51.3886 1.45342 19767.4 51.3582 1.41257 20087.1 51.3272 1.37288 20412.0 51.2958 1.33430 20742.1 51.2637 1.29681 21077.6 51.2309 1.26038 21418.5 51.1974 1.22498 21765.0 51.1631 1.19058 22117.0 51.1278 1.15716 22474.7 51.0915 1.12468 22838.2 51.0539 1.09312 23207.6 51.0151 1.06246 23583.0 50.9748 1.03267 23964.4 50.9327 1.00373 24352.0 50.8886 0.975603 24745.9 50.8422 0.948281 25146.2 50.7932 0.921736 25552.9 50.7411 0.895949 25966.2 50.6853 0.870896 26386.1 50.6250 0.846556 26812.9 50.5595 0.822911 27246.6 50.4875 0.799940 27687.3 50.4074 0.777626 28135.1 50.3169 0.755948 28590.2 50.2129 0.734890 29052.6 50.0908 0.714433 29522.5 49.9444 0.694560 30000.0 49.7483 0.675257 periodictable-1.5.0/periodictable/xsf/th.nff000066400000000000000000000320671310514471200210450ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 3.14769 10.1617 -9999. 3.10070 10.3261 -9999. 3.05442 10.4931 -9999. 3.00883 10.6628 -9999. 2.96392 10.8353 -9999. 2.91968 11.0106 -9999. 2.87611 11.1886 -9999. 2.83318 11.3696 -9999. 2.79089 11.5535 -9999. 2.74024 11.7404 -9999. 2.66201 11.9303 -9999. 2.58600 12.1232 -9999. 2.51217 12.3193 -9999. 2.44044 12.5186 -9999. 2.37457 12.7210 -9999. 2.32610 12.9268 -9999. 2.27863 13.1359 -9999. 2.23212 13.3483 -9999. 2.18656 13.5642 -9999. 2.13358 13.7836 -9999. 2.08142 14.0066 -9999. 2.03053 14.2331 -9999. 1.97588 14.4633 -9999. 1.91003 14.6973 -9999. 1.84637 14.9350 -9999. 1.78484 15.1765 -9999. 1.74404 15.4220 -9999. 1.70965 15.6714 -9999. 1.67593 15.9249 -9999. 1.68899 16.1825 -9999. 1.70819 16.4442 -9999. 1.72797 16.7102 -9999. 1.78318 16.9805 -9999. 1.84220 17.2551 -9999. 1.92527 17.5342 -9999. 2.02413 17.8178 -9999. 2.14532 18.1060 -9999. 2.27377 18.3989 -9999. 2.56475 18.6964 -9999. 3.05030 18.9988 -9999. 3.71448 19.3061 -9999. 4.55803 19.6184 -9999. 5.59314 19.9357 -9999. 6.60440 20.2582 -9999. 7.28920 20.5858 -9999. 8.02534 20.9188 -9999. 8.41645 21.2571 -9999. 8.82663 21.6009 -9999. 9.25680 21.9503 -9999. 9.70794 22.3053 -9999. 10.0376 22.6661 -9999. 10.2934 23.0327 -9999. 10.5556 23.4053 -9999. 10.8246 23.7838 -9999. 11.1004 24.1685 -9999. 11.3250 24.5594 -9999. 11.5480 24.9566 -9999. 11.7754 25.3603 -9999. 12.0073 25.7705 -9999. 12.2437 26.1873 -9999. 12.3447 26.6109 -9999. 12.4022 27.0413 -9999. 12.4599 27.4786 -9999. 12.5179 27.9231 -9999. 12.5762 28.3747 -9999. 12.6348 28.8337 -9999. 12.6732 29.3000 13.2132 12.6709 29.7739 13.5854 12.6685 30.2555 13.9532 12.6662 30.7449 14.3235 12.6638 31.2421 14.7028 12.6615 31.7475 15.0997 12.6591 32.2609 15.5313 12.6568 32.7827 16.0567 12.6544 33.3130 16.6210 12.3973 33.8518 17.0372 12.1030 34.3993 17.3790 11.8156 34.9557 17.6808 11.5351 35.5211 17.9530 11.2613 36.0956 18.2054 10.9939 36.6794 18.4508 10.7329 37.2727 18.6772 10.4363 37.8755 18.8660 10.1440 38.4882 19.0317 9.85986 39.1107 19.1812 9.58372 39.7432 19.3251 9.31531 40.3861 19.4837 9.04597 41.0393 19.6081 8.71266 41.7031 19.6836 8.39163 42.3776 19.7294 8.08243 43.0630 19.7518 7.78462 43.7595 19.7543 7.49779 44.4673 19.7388 7.22152 45.1865 19.7068 6.95544 45.9174 19.6589 6.69915 46.6600 19.5931 6.45232 47.4147 19.5152 6.22680 48.1816 19.4311 6.00983 48.9609 19.3386 5.80043 49.7528 19.2363 5.59831 50.5576 19.1238 5.40325 51.3753 19.0007 5.21498 52.2062 18.8664 5.03327 53.0506 18.7199 4.85789 53.9087 18.5596 4.68862 54.7806 18.3794 4.52525 55.6667 18.1609 4.38531 56.5670 17.9588 4.29022 57.4820 17.7684 4.19718 58.4117 17.5773 4.10616 59.3564 17.3820 4.01712 60.3165 17.1802 3.93000 61.2921 16.9699 3.84478 62.2834 16.7496 3.76141 63.2908 16.5175 3.67984 64.3145 16.2718 3.60004 65.3547 16.0104 3.52197 66.4118 15.7297 3.44698 67.4859 15.4324 3.37842 68.5775 15.1162 3.31123 69.6867 14.7776 3.24537 70.8138 14.4129 3.18083 71.9591 14.0181 3.11756 73.1230 13.5888 3.05556 74.3057 13.1193 2.99479 75.5076 12.6029 2.93506 76.7289 12.0304 2.87620 77.9699 11.3902 2.81851 79.2310 10.6650 2.76199 80.5125 9.83938 2.71774 81.8147 8.90003 2.67394 83.1380 7.75320 2.59535 84.4827 6.34578 2.59967 85.8491 4.49988 2.64646 87.2377 1.73152 3.05615 88.6487 -1.71762 5.14780 90.0825 -4.45996 9.81732 91.5395 -1.34486 18.7222 93.0201 7.03967 11.9522 94.5246 2.65975 4.89822 96.0535 -4.99629 4.83257 97.6071 -13.7597 7.70272 99.1858 -22.8361 14.7427 100.790 -31.0722 28.2176 102.420 -29.8439 54.0075 104.077 -10.0772 67.7876 105.760 6.22173 71.2667 107.471 22.1569 70.8206 109.209 36.0201 61.6804 110.975 42.3187 51.0300 112.770 43.1115 42.2184 114.594 42.5829 37.7589 116.448 42.6353 34.1549 118.331 42.2321 31.2204 120.245 42.2281 29.1424 122.190 42.3772 27.2027 124.166 42.5633 25.3922 126.175 42.8301 23.6692 128.215 42.9109 21.7419 130.289 42.7596 19.9716 132.397 42.4052 18.3454 134.538 41.7283 16.9753 136.714 41.2559 16.1644 138.925 40.9691 15.3923 141.172 40.8214 14.6570 143.456 40.7473 13.8323 145.776 40.5986 12.9870 148.134 40.4210 12.1934 150.530 40.2409 11.4483 152.964 40.0864 10.7487 155.439 40.1246 9.98505 157.953 39.9420 8.99408 160.507 39.5664 8.10146 163.103 39.1087 7.29740 165.742 38.5928 6.59466 168.422 38.0564 5.97352 171.146 37.4922 5.41091 173.915 36.8414 4.92550 176.727 36.2629 4.66099 179.586 35.7623 4.41068 182.491 35.3072 4.17382 185.442 34.8743 3.94968 188.442 34.4544 3.73757 191.489 34.0365 3.53685 194.587 33.6150 3.36901 197.734 33.2107 3.22282 200.932 32.8109 3.08297 204.182 32.3793 2.94919 207.485 31.9570 2.92693 210.840 31.5873 2.92049 214.251 31.2551 2.91406 217.716 30.9408 2.90764 221.237 30.6385 2.90124 224.816 30.3429 2.89485 228.452 30.0408 2.88848 232.147 29.7384 2.91151 235.902 29.4589 2.94828 239.717 29.1935 2.98552 243.595 28.9381 3.02323 247.535 28.6897 3.05696 251.538 28.4398 3.08723 255.607 28.1868 3.11780 259.741 27.9271 3.14868 263.942 27.6464 3.18699 268.211 27.3759 3.25991 272.549 27.1158 3.33450 276.957 26.8607 3.41079 281.437 26.6073 3.48884 285.989 26.3551 3.56866 290.615 26.1079 3.65032 295.315 25.8595 3.71100 300.092 25.5901 3.76393 304.945 25.2976 3.81761 309.878 24.9806 3.87206 314.890 24.6145 3.94683 319.983 24.2490 4.05944 325.158 23.8804 4.17526 330.418 23.4858 4.29439 335.762 23.0628 4.44011 341.192 22.6186 4.59923 346.711 22.1357 4.76406 352.319 21.5504 4.95455 358.017 20.9646 5.29574 363.808 20.3843 5.66044 369.692 19.6738 6.09833 375.672 19.0320 6.74145 381.748 18.4807 7.45237 387.922 17.9892 8.23830 394.197 17.5964 9.10709 400.573 17.3692 9.96364 407.052 17.1081 10.7223 413.635 16.8322 11.5388 420.326 16.5744 12.4174 427.124 16.3567 13.3629 434.032 16.1948 14.3804 441.052 16.1167 15.4754 448.186 16.2427 16.5978 455.435 16.4046 17.6458 462.802 16.6183 18.7601 470.287 17.0773 19.8822 477.894 17.5251 20.7810 485.623 17.9774 21.7204 493.478 18.5592 22.7023 501.459 19.3878 23.5348 509.570 20.0710 24.0582 517.812 20.6459 24.5933 526.187 21.1832 25.1402 534.698 21.7102 25.6993 543.346 22.2516 26.2709 552.134 22.8431 26.8239 561.065 23.4059 27.3139 570.139 23.9502 27.8128 579.361 24.4958 28.3208 588.732 25.0527 28.8381 598.254 25.6596 29.3648 607.930 26.2715 29.8296 617.763 26.8710 30.3007 627.755 27.4802 30.7792 637.908 28.1085 31.2652 648.226 28.7699 31.7589 658.711 29.4665 32.2344 669.365 30.1872 32.7043 680.191 30.9428 33.1810 691.193 31.7564 33.6648 702.372 32.7088 34.1555 713.733 33.8649 34.4772 725.277 34.8705 34.4907 737.008 35.7512 34.5040 748.928 36.5921 34.5174 761.042 37.4042 34.4960 773.351 38.1663 34.4502 785.859 38.8935 34.4044 798.570 39.6382 34.3587 811.486 40.3504 34.2252 824.611 40.9857 34.0729 837.949 41.5646 33.9212 851.502 42.0879 33.7703 865.274 42.5219 33.6200 879.269 42.9075 33.5996 893.491 43.3207 33.6267 907.943 43.6903 33.6537 922.628 44.0661 33.8284 937.551 44.5481 34.0634 952.715 45.1061 34.2999 968.124 45.7302 34.5381 983.783 46.3943 34.7779 999.695 47.6408 34.7525 1015.86 47.5038 33.6774 1032.29 47.8184 35.3195 1048.99 49.4540 36.0186 1065.96 50.8204 35.5931 1083.20 51.8150 35.1715 1100.72 52.6619 34.7547 1118.52 53.4175 34.3426 1136.61 54.1068 33.9345 1155. 54.7436 33.5309 1173.68 55.3358 33.1315 1192.66 55.8882 32.7364 1211.95 56.4025 32.3454 1231.55 56.8707 31.9585 1251.47 57.2976 31.6084 1271.72 57.6977 31.2971 1292.29 58.1176 31.0316 1313.19 58.5515 30.7677 1334.43 58.9899 30.5058 1356.01 59.4313 30.2458 1377.94 59.8758 29.9868 1400.23 60.3254 29.7295 1422.88 60.7846 29.4739 1445.89 61.2629 29.2194 1469.28 61.7807 28.9429 1493.04 62.3435 28.6327 1517.19 62.8643 28.1765 1541.73 63.3105 27.7065 1566.67 63.6986 27.2432 1592.01 64.0524 26.7866 1617.76 64.3778 26.3374 1643.92 64.6798 25.8955 1670.51 64.9616 25.4601 1697.53 65.2253 25.0313 1724.99 65.4802 24.6088 1752.89 65.7182 24.1779 1781.24 65.9339 23.7489 1810.05 66.1286 23.3227 1839.32 66.3028 22.9037 1869.07 66.4601 22.4920 1899.30 66.6021 22.0876 1930.02 66.7292 21.6894 1961.24 66.8418 21.2978 1992.96 66.9369 20.9127 2025.20 67.0323 20.5447 2057.95 67.1165 20.1620 2091.24 67.1790 19.7838 2125.06 67.2258 19.4107 2159.43 67.2563 19.0412 2194.36 67.2708 18.6771 2229.85 67.2692 18.3171 2265.92 67.2508 17.9617 2302.57 67.2141 17.6104 2339.81 67.1599 17.2651 2377.66 67.0871 16.9233 2416.11 66.9937 16.5860 2455.19 66.8793 16.2539 2494.90 66.7421 15.9259 2535.26 66.5800 15.6026 2576.26 66.3913 15.2842 2617.93 66.1728 14.9701 2660.27 65.9225 14.6617 2703.30 65.6358 14.3563 2747.03 65.3071 14.0557 2791.46 64.9308 13.7599 2836.61 64.4989 13.4686 2882.49 64.0006 13.1814 2929.11 63.4220 12.8988 2976.48 62.7432 12.6205 3024.63 61.9359 12.3466 3073.55 60.9568 12.0768 3123.26 59.7346 11.8112 3173.78 58.1396 11.5498 3225.11 55.8904 11.2926 3277.27 52.1296 11.0393 3330.28 33.8696 10.7902 3331.90 19.1619 10.7828 3332.10 19.1655 27.0414 3384.15 50.8010 26.3508 3438.88 52.7535 25.6546 3490.70 34.0551 25.0221 3490.90 34.0729 35.8594 3494.50 46.1550 35.8020 3551.02 57.4700 34.9213 3608.46 61.1429 34.0640 3666.82 63.5805 33.2280 3726.13 65.3867 32.4142 3786.40 66.7683 31.6218 3847.64 67.8055 30.8503 3909.87 68.4935 30.0973 3973.11 68.6647 29.3631 4037.38 66.5315 28.6489 4046. 59.9057 28.5553 4046.20 59.9150 33.3085 4102.68 70.2408 32.6206 4169.03 72.2070 31.8418 4236.46 73.5601 31.0826 4304.98 74.6318 30.3421 4374.62 75.5223 29.6196 4445.37 76.2758 28.9150 4517.27 76.9155 28.2282 4590.33 77.4462 27.5554 4664.58 77.8581 26.9018 4740.03 78.0976 26.2621 4816.69 77.6797 25.6400 4830.30 75.4531 25.5321 4830.50 75.4541 27.0007 4894.60 78.8115 26.5061 4973.77 79.5383 25.9163 5054.21 80.0164 25.3407 5135.96 80.3499 24.7778 5182.20 78.8630 24.4688 5182.40 78.8692 25.4871 5219.03 80.6756 25.2322 5303.44 81.5016 24.6609 5389.22 82.0768 24.0997 5476.39 82.5565 23.5485 5564.97 82.9764 23.0072 5654.98 83.3516 22.4760 5746.44 83.6906 21.9544 5839.39 83.9987 21.4430 5933.83 84.2798 20.9411 6029.81 84.5370 20.4495 6127.33 84.7726 19.9672 6226.44 84.9883 19.4945 6327.15 85.1857 19.0315 6429.48 85.3664 18.5782 6533.48 85.5315 18.1340 6639.15 85.6821 17.6993 6746.54 85.8192 17.2739 6855.65 85.9436 16.8576 6966.54 86.0564 16.4502 7079.22 86.1579 16.0514 7193.72 86.2489 15.6617 7310.07 86.3302 15.2804 7428.31 86.4019 14.9078 7548.45 86.4650 14.5435 7670.54 86.5199 14.1876 7794.61 86.5670 13.8394 7920.68 86.6066 13.4997 8048.79 86.6394 13.1674 8178.98 86.6654 12.8430 8311.26 86.6852 12.5259 8445.69 86.6988 12.2164 8582.29 86.7068 11.9144 8721.11 86.7095 11.6192 8862.16 86.7070 11.3314 9005.50 86.6999 11.0503 9151.16 86.6881 10.7757 9299.17 86.6719 10.5081 9449.58 86.6517 10.2468 9602.42 86.6278 9.99178 9757.73 86.6006 9.74298 9915.55 86.5739 9.50008 10075.9 86.5438 9.25400 10238.9 86.5022 9.01400 10404.5 86.4557 8.77994 10572.8 86.4039 8.55174 10743.8 86.3470 8.32931 10917.6 86.2853 8.11255 11094.2 86.2187 7.90135 11273.6 86.1472 7.69561 11455.9 86.0707 7.49525 11641.2 85.9893 7.30014 11829.5 85.9026 7.11019 12020.8 85.8105 6.92530 12215.3 85.7126 6.74537 12412.8 85.6085 6.57029 12613.6 85.4978 6.39997 12817.6 85.3797 6.23430 13025.0 85.2535 6.07318 13235.6 85.1183 5.91652 13449.7 84.9726 5.76421 13667.2 84.8148 5.61616 13888.3 84.6428 5.47228 14112.9 84.4537 5.33246 14341.2 84.2436 5.19661 14573.1 84.0068 5.06464 14808.9 83.7351 4.93646 15048.4 83.4155 4.81198 15291.8 83.0264 4.69110 15539.1 82.5264 4.57375 15790.4 81.8214 4.45982 16045.8 80.6049 4.34925 16300.2 66.5374 4.24352 16300.4 66.5378 9.91722 16305.4 73.6404 9.91196 16569.1 80.8937 9.63817 16837.1 82.1404 9.37194 17109.4 82.8362 9.11308 17386.1 83.2870 8.86137 17667.4 83.5886 8.61661 17953.1 83.7804 8.37862 18243.5 83.8778 8.14721 18538.6 83.8804 7.92220 18838.4 83.7682 7.70341 19143.1 83.4795 7.49066 19452.7 82.7837 7.28380 19693.1 75.5630 7.12931 19693.3 75.5636 10.1128 19767.4 81.6750 10.0579 20087.1 82.9986 9.82623 20412.0 83.3209 9.59991 20472.0 83.7022 9.55906 20472.2 83.7052 10.9926 20742.1 84.6589 10.7767 21077.6 85.3344 10.5181 21418.5 85.8354 10.2645 21765.0 86.2400 10.0160 22117.0 86.5802 9.77259 22474.7 86.8731 9.53414 22838.2 87.1293 9.30062 23207.6 87.3559 9.07200 23583.0 87.5577 8.84821 23964.4 87.7385 8.62923 24352.0 87.9013 8.41496 24745.9 88.0482 8.20538 25146.2 88.1811 8.00040 25552.9 88.3015 7.79997 25966.2 88.4108 7.60402 26386.1 88.5099 7.41248 26812.9 88.5999 7.22529 27246.6 88.6815 7.04237 27687.3 88.7555 6.86366 28135.1 88.8225 6.68909 28590.2 88.8831 6.51858 29052.6 88.9377 6.35207 29522.5 88.9868 6.18948 30000.0 89.0309 6.03074 periodictable-1.5.0/periodictable/xsf/ti.nff000066400000000000000000000325041310514471200210420ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.51668 10.1428 -9999. 1.54246 10.3068 -9999. 1.57217 10.4735 -9999. 1.60245 10.6429 -9999. 1.63331 10.8151 -9999. 1.66477 10.9900 -9999. 1.70636 11.1677 -9999. 1.75257 11.3484 -9999. 1.80003 11.5319 -9999. 1.84878 11.7184 -9999. 1.89885 11.9080 -9999. 1.95027 12.1006 -9999. 2.00309 12.2963 -9999. 2.05733 12.4952 -9999. 2.11278 12.6973 -9999. 2.16186 12.9026 -9999. 2.21207 13.1113 -9999. 2.26345 13.3234 -9999. 2.31602 13.5389 -9999. 2.36981 13.7579 -9999. 2.42485 13.9804 -9999. 2.46758 14.2065 -9999. 2.47959 14.4363 -9999. 2.49166 14.6698 -9999. 2.50379 14.9071 -9999. 2.51598 15.1482 -9999. 2.52823 15.3932 -9999. 2.54054 15.6422 -9999. 2.55291 15.8952 -9999. 2.56534 16.1523 -9999. 2.57783 16.4135 -9999. 2.59038 16.6790 -9999. 2.60299 16.9487 -9999. 2.59544 17.2229 -9999. 2.58059 17.5014 -9999. 2.56582 17.7845 -9999. 2.55113 18.0722 -9999. 2.53653 18.3645 -9999. 2.52201 18.6615 -9999. 2.50758 18.9633 -9999. 2.45238 19.2701 3.13334 2.39274 19.5817 3.16030 2.33455 19.8985 3.17754 2.27777 20.2203 3.19999 2.22238 20.5473 3.21535 2.13794 20.8797 3.21428 2.04611 21.2174 3.18130 1.95823 21.5606 3.12196 1.87411 21.9093 3.04848 1.79362 22.2637 2.96542 1.74355 22.6237 2.87785 1.72343 22.9897 2.80351 1.70354 23.3615 2.73150 1.68389 23.7394 2.65865 1.66446 24.1233 2.58363 1.64526 24.5135 2.50574 1.62628 24.9100 2.42370 1.60751 25.3129 2.33752 1.58710 25.7223 2.24465 1.56026 26.1383 2.13967 1.53387 26.5611 2.02387 1.50793 26.9907 1.89655 1.48243 27.4273 1.75560 1.45736 27.8709 1.59958 1.43271 28.3217 1.42675 1.40900 28.7797 1.23438 1.38833 29.2452 1.01964 1.36796 29.7183 0.776870 1.34790 30.1989 0.498063 1.32812 30.6874 0.170830 1.30864 31.1837 -0.227176 1.28944 31.6881 -0.749109 1.27053 32.0289 -1.29137 1.25807 32.4566 -2.00326 1.74955 32.8900 -2.44702 2.39063 33.3175 -2.62289 3.11958 33.8564 -2.53127 3.58041 34.4040 -2.44870 3.98257 34.9604 -2.78137 4.15024 35.5259 -3.26598 4.37954 36.1005 -3.77984 4.98216 36.6844 -4.23879 5.66771 37.2777 -4.71674 6.45804 37.8807 -5.10633 7.60504 38.4934 -5.31214 8.94882 39.1160 -5.21145 10.1261 39.7486 -5.08363 11.4582 40.3915 -4.78742 12.9593 41.0448 -3.58289 14.6466 41.7087 -2.09192 15.5206 42.3833 -0.752391 16.0970 43.0688 0.146311 16.6949 43.7654 1.31706 17.3150 44.4733 2.52777 17.6464 45.1926 3.66719 17.9318 45.9236 4.81243 18.2218 46.6664 6.12984 18.5165 47.4211 7.49442 18.4909 48.1881 8.81349 18.4654 48.9675 10.3751 18.4399 49.7596 12.0345 17.8046 50.5644 13.5884 16.7626 51.3822 14.8286 15.7816 52.2133 15.7053 14.4915 53.0578 16.3493 13.0599 53.9160 16.7801 11.7698 54.7880 16.9514 10.4382 55.6742 17.0390 9.25736 56.5746 16.9905 8.21006 57.4897 16.7282 6.92755 58.4195 16.0620 5.84541 59.3644 15.5128 5.40826 60.3246 15.0276 5.08121 61.3003 14.6303 4.77394 62.2918 14.3962 4.46928 63.2993 14.0865 4.07607 64.3231 13.7613 3.71746 65.3635 13.4364 3.50393 66.4207 13.1153 3.32084 67.4950 12.7939 3.14733 68.5867 12.4933 3.06314 69.6960 12.2386 2.99445 70.8233 12.0378 2.92729 71.9688 11.8356 2.86163 73.1328 11.6426 2.79745 74.3157 11.4512 2.77929 75.5177 11.2844 2.77917 76.7391 11.1426 2.77906 77.9803 11.0144 2.77894 79.2416 10.8918 2.77882 80.5233 10.7751 2.78337 81.8257 10.6692 2.81617 83.1491 10.5763 2.84935 84.4940 10.5026 2.88293 85.8606 10.4412 2.91690 87.2493 10.3902 2.95127 88.6605 10.3504 2.98605 90.0945 10.3264 3.02124 91.5517 10.3034 3.03534 93.0325 10.2827 3.04885 94.5372 10.2636 3.06243 96.0663 10.2443 3.07607 97.6201 10.2275 3.08977 99.1990 10.2132 3.10353 100.803 10.2013 3.11735 102.434 10.1920 3.13123 104.091 10.1859 3.14517 105.774 10.1817 3.15695 107.485 10.1785 3.16846 109.224 10.1756 3.18001 110.990 10.1741 3.19160 112.785 10.1736 3.20323 114.610 10.1740 3.21491 116.463 10.1749 3.22663 118.347 10.1759 3.23839 120.261 10.1759 3.25019 122.206 10.1694 3.26204 124.183 10.1681 3.29060 126.191 10.1737 3.32020 128.232 10.1842 3.35007 130.307 10.1999 3.38020 132.414 10.2206 3.41061 134.556 10.2464 3.44129 136.732 10.2789 3.47225 138.944 10.3240 3.49262 141.191 10.3612 3.50281 143.475 10.3955 3.51303 145.795 10.4290 3.52327 148.153 10.4627 3.53356 150.550 10.4970 3.54387 152.985 10.5324 3.55421 155.459 10.5690 3.56458 157.973 10.6089 3.57498 160.529 10.6563 3.58541 163.125 10.7061 3.59587 165.763 10.7567 3.58665 168.444 10.8044 3.57260 171.169 10.8451 3.55860 173.937 10.8827 3.54465 176.751 10.9183 3.53076 179.609 10.9511 3.51693 182.515 10.9819 3.50386 185.467 11.0126 3.49418 188.466 11.0446 3.48453 191.515 11.0808 3.47491 194.612 11.1194 3.46532 197.760 11.1603 3.45575 200.959 11.2082 3.42941 204.209 11.2461 3.39522 207.512 11.2771 3.36137 210.868 11.3042 3.32785 214.279 11.3296 3.29468 217.745 11.3549 3.26183 221.266 11.3769 3.21578 224.845 11.3931 3.17017 228.482 11.3992 3.12520 232.177 11.3961 3.08087 235.933 11.3882 3.03718 239.749 11.3777 3.00642 243.626 11.3673 2.97771 247.567 11.3577 2.94927 251.571 11.3478 2.92110 255.640 11.3381 2.89320 259.775 11.3286 2.86043 263.977 11.3123 2.82426 268.246 11.2916 2.78854 272.585 11.2666 2.75327 276.994 11.2371 2.71845 281.474 11.2034 2.68321 286.026 11.1651 2.64829 290.653 11.1219 2.61382 295.354 11.0736 2.57980 300.131 11.0202 2.54623 304.985 10.9613 2.51308 309.918 10.8970 2.48015 314.931 10.8259 2.44688 320.025 10.7475 2.41405 325.201 10.6614 2.38166 330.461 10.5671 2.34971 335.805 10.4638 2.31819 341.237 10.3510 2.28709 346.756 10.2284 2.25641 352.365 10.0975 2.22613 358.064 9.94867 2.18373 363.855 9.77937 2.13716 369.740 9.58573 2.09159 375.720 9.36153 2.04699 381.797 9.10532 2.00334 387.973 8.80539 1.96429 394.248 8.47157 1.93874 400.625 8.09059 1.91089 407.104 7.64272 1.88244 413.689 7.10525 1.85443 420.380 6.44314 1.82682 427.179 5.59477 1.79962 434.089 4.43993 1.77282 441.110 2.69019 1.74643 448.244 -0.736873 1.72044 453.700 -18.2714 1.70110 453.900 -18.2500 15.6413 455.494 -5.60849 15.5779 462.861 2.11285 15.2909 470.348 4.97994 15.0092 477.955 6.80646 14.7327 485.686 8.15251 14.4612 493.541 9.21552 14.1947 501.524 10.0886 13.9333 509.636 10.8223 13.6767 517.879 11.4461 13.4246 526.255 11.9770 13.1769 534.767 12.4251 12.9342 543.416 12.8242 12.6961 552.206 12.8911 12.4623 561.137 12.8719 12.6322 570.213 13.0216 12.9946 579.436 13.7220 13.3675 588.808 14.6717 13.3523 598.331 15.3636 13.0965 608.009 15.8267 12.8455 617.843 16.2526 12.5994 627.836 16.6409 12.3573 637.990 17.0025 12.1119 648.309 17.3345 11.8601 658.795 17.6343 11.6063 669.451 17.8817 11.3574 680.279 18.1022 11.1390 691.282 18.3224 10.9433 702.463 18.5692 10.7540 713.824 18.8143 10.5420 725.370 19.0335 10.3170 737.102 19.2240 10.0969 749.024 19.4031 9.88138 761.139 19.5708 9.67034 773.450 19.7301 9.46305 785.960 19.8803 9.25750 798.672 20.0195 9.05428 811.590 20.1482 8.85554 824.717 20.2691 8.66112 838.056 20.3828 8.47097 851.611 20.4903 8.28427 865.385 20.5915 8.10092 879.382 20.6863 7.92099 893.605 20.7751 7.74498 908.058 20.8592 7.57290 922.746 20.9403 7.40469 937.670 21.0175 7.23510 952.836 21.0881 7.06818 968.248 21.1528 6.90407 983.908 21.2116 6.74378 999.822 21.2660 6.58736 1015.99 21.3160 6.43471 1032.43 21.3645 6.28680 1049.13 21.4113 6.14009 1066.09 21.4537 5.99450 1083.34 21.4905 5.85239 1100.86 21.5243 5.71366 1118.66 21.5553 5.57824 1136.76 21.5835 5.44597 1155.14 21.6091 5.31687 1173.83 21.6326 5.19086 1192.81 21.6540 5.06778 1212.11 21.6736 4.94763 1231.71 21.6918 4.83034 1251.63 21.7093 4.71464 1271.88 21.7252 4.60049 1292.45 21.7385 4.48767 1313.35 21.7485 4.37762 1334.60 21.7569 4.27023 1356.18 21.7637 4.16544 1378.12 21.7689 4.06326 1400.41 21.7729 3.96358 1423.06 21.7758 3.86632 1446.07 21.7780 3.77151 1469.46 21.7799 3.67858 1493.23 21.7815 3.58726 1517.38 21.7819 3.49528 1541.93 21.7793 3.40531 1566.86 21.7750 3.31769 1592.21 21.7695 3.23231 1617.96 21.7628 3.14912 1644.13 21.7551 3.06806 1670.72 21.7465 2.98917 1697.74 21.7374 2.91228 1725.20 21.7277 2.83726 1753.11 21.7176 2.76330 1781.46 21.7063 2.69100 1810.28 21.6940 2.62044 1839.56 21.6809 2.55171 1869.31 21.6671 2.48476 1899.54 21.6527 2.41953 1930.27 21.6377 2.35602 1961.49 21.6222 2.29418 1993.21 21.6061 2.23398 2000. 21.6027 2.22143 2026. 21.5897 2.17510 2052. 21.5770 2.12930 2079. 21.5633 2.08332 2106. 21.5495 2.03884 2134. 21.5351 1.99426 2161. 21.5211 1.95267 2190. 21.5059 1.90952 2218. 21.4912 1.86921 2247. 21.4760 1.82888 2277. 21.4601 1.78854 2306. 21.4448 1.75086 2337. 21.4284 1.71192 2367. 21.4124 1.67552 2398. 21.3960 1.63914 2429. 21.3795 1.60399 2461. 21.3625 1.56893 2493. 21.3455 1.53502 2526. 21.3279 1.50126 2559. 21.3103 1.46865 2592. 21.2927 1.43711 2626. 21.2746 1.40572 2660. 21.2565 1.37541 2695. 21.2378 1.34522 2730. 21.2190 1.31608 2766. 21.1997 1.28712 2802. 21.1804 1.25912 2839. 21.1605 1.23134 2876. 21.1405 1.20453 2914. 21.1199 1.17788 2952. 21.0992 1.15217 2990. 21.0783 1.12734 3029. 21.0569 1.10269 3069. 21.0347 1.07829 3109. 21.0123 1.05472 3150. 20.9892 1.03136 3191. 20.9659 1.00881 3232. 20.9422 0.987029 3275. 20.9172 0.964954 3317. 20.8924 0.944161 3361. 20.8660 0.923078 3405. 20.8391 0.902742 3449. 20.8118 0.883098 3494. 20.7833 0.863657 3540. 20.7536 0.844503 3586. 20.7231 0.825983 3633. 20.6911 0.807714 3680. 20.6582 0.790032 3729. 20.6228 0.772257 3777. 20.5870 0.755473 3827. 20.5483 0.738526 3877. 20.5080 0.722198 3927. 20.4660 0.706450 3979. 20.4202 0.690593 4031. 20.3720 0.675269 4083. 20.3210 0.660477 4137. 20.2648 0.645682 4191. 20.2046 0.631321 4245. 20.1399 0.617483 4301. 20.0672 0.603661 4357. 19.9876 0.590258 4414. 19.8981 0.577091 4472. 19.7960 0.564173 4530. 19.6800 0.551702 4589. 19.5433 0.539415 4649. 19.3779 0.527350 4710. 19.1704 0.515511 4771. 18.9007 0.504077 4834. 18.5046 0.492674 4897. 17.8260 0.481658 4961. 15.0049 0.470848 4966.30 10.4892 0.469969 4966.50 10.4900 4.03619 5026. 17.8190 3.96727 5091. 18.7095 3.89424 5158. 19.2403 3.82074 5225. 19.6148 3.74900 5294. 19.9118 3.67692 5363. 20.1521 3.60667 5433. 20.3560 3.53724 5504. 20.5326 3.46858 5576. 20.6881 3.40073 5649. 20.8265 3.33376 5722. 20.9492 3.26852 5797. 21.0618 3.20335 5873. 21.1643 3.13912 5950. 21.2579 3.07577 6027. 21.3428 3.01417 6106. 21.4219 2.95275 6186. 21.4950 2.89229 6267. 21.5625 2.83284 6349. 21.6251 2.77436 6432. 21.6832 2.71682 6516. 21.7371 2.66032 6601. 21.7872 2.60484 6687. 21.8339 2.55038 6774. 21.8774 2.49687 6863. 21.9184 2.44372 6952. 21.9561 2.39221 7043. 21.9916 2.34116 7135. 22.0248 2.29107 7229. 22.0559 2.24148 7323. 22.0847 2.19340 7419. 22.1117 2.14578 7516. 22.1368 2.09919 7614. 22.1601 2.05355 7713. 22.1818 2.00892 7814. 22.2021 1.96482 7916. 22.2210 1.92167 8019. 22.2384 1.87954 8124. 22.2548 1.83788 8230. 22.2698 1.79717 8338. 22.2839 1.75702 8447. 22.2967 1.71781 8557. 22.3085 1.67954 8669. 22.3195 1.64186 8782. 22.3294 1.60502 8897. 22.3386 1.56885 9013. 22.3470 1.53343 9131. 22.3546 1.49866 9250. 22.3614 1.46474 9371. 22.3676 1.43145 9494. 22.3732 1.39861 9618. 22.3781 1.36666 9743. 22.3824 1.33555 9900.58 22.3870 1.29776 10060.7 22.3908 1.26095 10223.4 22.3939 1.22509 10388.8 22.3962 1.19016 10556.8 22.3980 1.15615 10727.6 22.3991 1.12303 10901.1 22.3997 1.09079 11077.4 22.3998 1.05940 11256.6 22.3993 1.02885 11438.6 22.3985 0.999118 11623.6 22.3972 0.970181 11811.7 22.3955 0.942025 12002.7 22.3934 0.914630 12196.8 22.3911 0.887979 12394.1 22.3884 0.862055 12594.6 22.3854 0.836839 12798.3 22.3822 0.812316 13005.3 22.3787 0.788467 13215.6 22.3750 0.765277 13429.4 22.3711 0.742729 13646.6 22.3670 0.720808 13867.3 22.3628 0.699498 14091.6 22.3584 0.678783 14319.5 22.3538 0.658649 14551.1 22.3492 0.639081 14786.5 22.3444 0.620064 15025.6 22.3395 0.601584 15268.7 22.3345 0.583628 15515.6 22.3295 0.566181 15766.6 22.3244 0.549232 16021.6 22.3192 0.532765 16280.7 22.3140 0.516770 16544.1 22.3088 0.501233 16811.6 22.3035 0.486143 17083.6 22.2982 0.471486 17359.9 22.2929 0.457253 17640.6 22.2875 0.443431 17926.0 22.2822 0.430009 18215.9 22.2769 0.416977 18510.5 22.2715 0.404324 18809.9 22.2662 0.392039 19114.2 22.2609 0.380113 19423.3 22.2557 0.368536 19737.5 22.2504 0.357298 20056.7 22.2452 0.346390 20381.1 22.2400 0.335802 20710.8 22.2349 0.325526 21045.7 22.2298 0.315553 21386.1 22.2247 0.305875 21732.0 22.2197 0.296483 22083.5 22.2148 0.287370 22440.7 22.2098 0.278527 22803.7 22.2050 0.269947 23172.5 22.2002 0.261622 23547.3 22.1954 0.253545 23928.2 22.1907 0.245710 24315.2 22.1860 0.238109 24708.5 22.1815 0.230735 25108.1 22.1769 0.223582 25514.2 22.1725 0.216644 25926.9 22.1681 0.209915 26346.2 22.1637 0.203388 26772.4 22.1594 0.197058 27205.4 22.1552 0.190919 27645.4 22.1510 0.184965 28092.6 22.1470 0.179191 28546.9 22.1429 0.173592 29008.7 22.1390 0.168163 29477.9 22.1352 0.162899 29954.6 22.1294 0.157795 30000.0 22.1294 0.157321 periodictable-1.5.0/periodictable/xsf/tl.nff000066400000000000000000000321111310514471200210370ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.80392 10.1617 -9999. 1.75555 10.3261 -9999. 1.69589 10.4931 -9999. 1.59546 10.6628 -9999. 1.46625 10.8353 -9999. 1.39341 11.0106 -9999. 1.31349 11.1886 -9999. 1.20783 11.3696 -9999. 1.13261 11.5535 -9999. 1.07387 11.7404 -9999. 1.03850 11.9303 -9999. 1.04678 12.1232 -9999. 1.05513 12.3193 -9999. 1.09785 12.5186 -9999. 1.15076 12.7210 -9999. 1.28282 12.9268 -9999. 1.45410 13.1359 -9999. 1.64367 13.3483 -9999. 1.87325 13.5642 -9999. 2.14093 13.7836 -9999. 2.33822 14.0066 -9999. 2.53817 14.2331 -9999. 2.75523 14.4633 -9999. 2.89712 14.6973 -9999. 2.99769 14.9350 -9999. 3.10175 15.1765 -9999. 3.18064 15.4220 -9999. 3.25475 15.6714 -9999. 3.25438 15.9249 -9999. 3.24810 16.1825 -9999. 3.24403 16.4442 -9999. 3.26317 16.7102 -9999. 3.28242 16.9805 -9999. 3.30178 17.2551 -9999. 3.32126 17.5342 -9999. 3.36412 17.8178 -9999. 3.41627 18.1060 -9999. 3.46924 18.3989 -9999. 3.52303 18.6964 -9999. 3.57765 18.9988 -9999. 3.63312 19.3061 -9999. 3.68945 19.6184 -9999. 3.74665 19.9357 -9999. 3.83874 20.2582 -9999. 3.95506 20.5858 -9999. 4.07491 20.9188 -9999. 4.19839 21.2571 -9999. 4.32562 21.6009 -9999. 4.45669 21.9503 -9999. 4.59256 22.3053 -9999. 4.76042 22.6661 -9999. 4.93442 23.0327 -9999. 5.11478 23.4053 -9999. 5.30173 23.7838 -9999. 5.49551 24.1685 -9999. 5.69638 24.5594 -9999. 5.90459 24.9566 -9999. 6.12041 25.3603 -9999. 6.34412 25.7705 -9999. 6.57600 26.1873 -9999. 6.82627 26.6109 -9999. 7.09248 27.0413 -9999. 7.36908 27.4786 -9999. 7.65647 27.9231 -9999. 7.95507 28.3747 -9999. 8.26531 28.8337 -9999. 8.58765 29.3000 -3.60735 8.90399 29.7739 -3.59085 9.22126 30.2555 -3.57211 9.54983 30.7449 -3.54353 9.89012 31.2421 -3.50301 10.2425 31.7475 -3.44740 10.6075 32.2609 -3.36083 10.9854 32.7827 -3.24606 11.3505 33.3130 -3.13365 11.6961 33.8518 -3.02081 12.0522 34.3993 -2.89864 12.4192 34.9557 -2.76144 12.7973 35.5211 -2.60355 13.1870 36.0956 -2.40940 13.5885 36.6794 -2.16997 13.9552 37.2727 -1.93767 14.2824 37.8755 -1.72466 14.6172 38.4882 -1.50558 14.9600 39.1107 -1.27642 15.3107 39.7432 -1.03422 15.6697 40.3861 -0.744304 16.0340 41.0393 -0.449328 16.3523 41.7031 -0.169505 16.6771 42.3776 0.118504 17.0082 43.0630 0.418172 17.3459 43.7595 0.734388 17.6904 44.4673 1.07312 18.0416 45.1865 1.45427 18.3999 45.9174 1.86445 18.7064 46.6600 2.26842 18.9914 47.4147 2.66665 19.2808 48.1816 3.07847 19.5746 48.9609 3.51206 19.8729 49.7528 3.99169 20.1757 50.5576 4.50584 20.4109 51.3753 5.00380 20.6080 52.2062 5.48214 20.8071 53.0506 5.96683 21.0081 53.9087 6.46576 21.2110 54.7806 7.00078 21.4159 55.6667 7.55170 21.5627 56.5670 8.09178 21.6939 57.4820 8.62719 21.8258 58.4117 9.17350 21.9586 59.3564 9.73749 22.0922 60.3165 10.3276 22.2266 61.2921 10.9554 22.3618 62.2834 11.6212 22.4979 63.2908 12.5465 22.6348 64.3145 13.4545 22.3675 65.3547 14.1420 22.0606 66.4118 14.7531 21.7578 67.4859 15.3127 21.4592 68.5775 15.8349 21.1647 69.6867 16.3290 20.8742 70.8138 16.8019 20.5878 71.9591 17.2597 20.3052 73.1230 17.7091 20.0266 74.3057 18.1600 19.7517 75.5076 18.6433 19.4807 76.7289 19.1508 19.1099 77.9699 19.5891 18.6648 79.2310 19.9416 18.2301 80.5125 20.2554 17.8055 81.8147 20.5357 17.3908 83.1380 20.7813 16.9873 84.4827 21.0108 16.6140 85.8491 21.2329 16.2488 87.2377 21.4457 15.8917 88.6487 21.6507 15.5425 90.0825 21.8638 15.2009 91.5395 22.0822 14.8415 93.0201 22.2700 14.4509 94.5246 22.4279 14.0706 96.0535 22.5694 13.7003 97.6071 22.7012 13.3397 99.1858 22.8316 12.9886 100.790 22.9928 12.6467 102.420 23.1302 12.2105 104.077 23.2093 11.7820 105.760 23.2520 11.3685 107.471 23.2720 10.9696 109.209 23.2754 10.5846 110.975 23.2643 10.2132 112.770 23.2870 9.85479 114.594 23.2899 9.42251 116.448 23.2141 8.98371 118.331 23.0911 8.56533 120.245 22.9277 8.16642 122.190 22.7129 7.78611 124.166 22.4420 7.48454 126.175 22.1940 7.27114 128.215 21.9951 7.06382 130.289 21.8033 6.86241 132.397 21.6158 6.66676 134.538 21.4332 6.47667 136.714 21.2503 6.27829 138.925 21.0540 6.07720 141.172 20.8415 5.88257 143.456 20.6164 5.69416 145.776 20.3759 5.51179 148.134 20.1201 5.33834 150.530 19.8483 5.17084 152.964 19.5576 5.00858 155.439 19.2086 4.85142 157.953 18.8428 4.76902 160.507 18.4990 4.69974 163.103 18.1467 4.63145 165.742 17.7107 4.56417 168.422 17.2654 4.62458 171.146 16.8776 4.69982 173.915 16.4750 4.77628 176.727 16.0604 4.91457 179.586 15.6700 5.08598 182.491 15.2707 5.26337 185.442 14.8614 5.50079 188.442 14.4953 5.80892 191.489 14.1826 6.13429 194.587 13.9044 6.44786 197.734 13.6338 6.75972 200.932 13.3647 7.08668 204.182 13.1055 7.42943 207.485 12.8554 7.79000 210.840 12.6175 8.16932 214.251 12.3921 8.56710 217.716 12.1811 8.98426 221.237 11.9901 9.42171 224.816 11.8202 9.87125 228.452 11.6607 10.3273 232.147 11.5119 10.8045 235.902 11.3790 11.3037 239.717 11.2675 11.8260 243.595 11.1829 12.3724 247.535 11.1481 12.9441 251.538 11.1393 13.4744 255.607 11.1295 14.0252 259.741 11.1382 14.5985 263.942 11.1758 15.1953 268.211 11.2756 15.8164 272.549 11.4408 16.4144 276.957 11.6071 16.9342 281.437 11.7525 17.4704 285.989 11.9056 18.0236 290.615 12.0781 18.5943 295.315 12.2799 19.1830 300.092 12.5409 19.7905 304.945 12.8358 20.3246 309.878 13.1172 20.8619 314.890 13.4081 21.4135 319.983 13.7261 21.9796 325.158 14.0897 22.5607 330.418 14.5435 23.1497 335.762 15.0219 23.5754 341.192 15.4426 24.0090 346.711 15.8571 24.4505 352.319 16.2792 24.9002 358.017 16.7193 25.3581 363.808 17.1989 25.8245 369.692 17.7166 26.2369 375.672 18.2225 26.6180 381.748 18.7144 27.0045 387.922 19.2187 27.3968 394.197 19.7421 27.7947 400.573 20.2933 28.1984 407.052 20.9142 28.6079 413.635 21.6132 28.9645 420.326 22.2959 29.1579 427.124 22.9090 29.3526 434.032 23.5025 29.5486 441.052 24.0902 29.7459 448.186 24.6886 29.9446 455.435 25.3113 30.1325 462.802 25.9345 30.2524 470.287 26.5249 30.3622 477.894 27.0982 30.4723 485.623 27.6670 30.5837 493.478 28.2373 30.6957 501.459 28.8140 30.8076 509.570 29.4095 30.9188 517.812 30.0299 31.0181 526.187 30.6984 31.0744 534.698 31.3615 31.0423 543.346 31.9556 30.9666 552.134 32.5154 30.8929 561.065 33.0585 30.8085 570.139 33.5839 30.7141 579.361 34.0825 30.5851 588.732 34.5372 30.4485 598.254 34.9478 30.3071 607.930 35.3107 30.1654 617.763 35.6012 30.0245 627.755 35.7849 29.9009 637.908 35.8054 29.9840 648.226 35.8843 30.3415 658.711 36.2366 30.8886 669.365 36.8620 31.4453 680.191 37.7399 31.7899 691.193 38.6649 31.9466 702.372 39.5971 31.9118 713.733 40.4693 31.7198 725.277 41.1881 31.4210 737.008 41.8012 31.1249 748.928 42.3386 30.8313 761.042 42.8057 30.5443 773.351 43.1592 30.3009 785.859 43.4750 30.1925 798.570 43.8815 30.1950 811.486 44.3649 30.1972 824.611 44.9071 30.1989 837.949 45.5249 30.2004 851.502 46.2524 30.0957 865.274 46.9821 29.8592 879.269 47.6098 29.5075 893.491 48.1566 29.1594 907.943 48.6578 28.8151 922.628 49.1211 28.4746 937.551 49.5578 28.1606 952.715 49.9893 27.8559 968.124 50.4199 27.5597 983.783 50.8563 27.2661 999.695 51.3089 26.9625 1015.86 51.7871 26.6483 1032.29 52.2509 26.2064 1048.99 52.6318 25.7701 1065.96 52.9733 25.3402 1083.20 53.2848 24.9165 1100.72 53.5706 24.4998 1118.52 53.8348 24.0898 1136.61 54.0793 23.6859 1155. 54.3055 23.2886 1173.68 54.5151 22.8976 1192.66 54.7091 22.5126 1211.95 54.8880 22.1336 1231.55 55.0528 21.7607 1251.47 55.2039 21.3936 1271.72 55.3419 21.0325 1292.29 55.4674 20.6770 1313.19 55.5807 20.3271 1334.43 55.6819 19.9828 1356.01 55.7714 19.6440 1377.94 55.8494 19.3102 1400.23 55.9158 18.9821 1422.88 55.9717 18.6594 1445.89 56.0172 18.3412 1469.28 56.0524 18.0271 1493.04 56.0781 17.7164 1517.19 56.0915 17.4018 1541.73 56.0865 17.0916 1566.67 56.0662 16.7867 1592.01 56.0312 16.4868 1617.76 55.9809 16.1920 1643.92 55.9156 15.9023 1670.51 55.8349 15.6177 1697.53 55.7384 15.3379 1724.99 55.6305 15.0625 1752.89 55.5052 14.7797 1781.24 55.3505 14.4978 1810.05 55.1690 14.2176 1839.32 54.9571 13.9426 1869.07 54.7146 13.6730 1899.30 54.4389 13.4088 1930.02 54.1264 13.1494 1961.24 53.7719 12.8948 1992.96 53.3683 12.6450 2025.20 52.9154 12.4076 2057.95 52.4022 12.1587 2091.24 51.7986 11.9122 2125.06 51.0927 11.6688 2159.43 50.2560 11.4290 2194.36 49.2467 11.1920 2229.85 47.9971 10.9583 2265.92 46.3885 10.7275 2302.57 44.1789 10.5001 2339.81 40.7209 10.2756 2377.66 32.2804 10.0544 2389.20 6.21254 9.98852 2389.40 6.21245 27.0870 2416.11 35.9075 26.6392 2455.19 38.2467 26.0060 2485. 19.5355 25.5397 2485.20 19.5618 37.3682 2494.90 37.1323 37.1569 2535.26 45.3925 36.2991 2576.26 49.2219 35.4615 2617.93 51.8694 34.6441 2660.27 53.8871 33.8466 2703.30 55.4864 33.0684 2747.03 56.7668 32.3086 2791.46 57.7734 31.5684 2836.61 58.5050 30.8453 2882.49 58.8741 30.1398 2929.11 58.4015 29.4506 2956.50 50.7116 29.0581 2956.70 50.7162 33.6655 2976.48 58.8603 33.3492 3024.63 61.4660 32.6002 3073.55 62.9593 31.8677 3123.26 64.0906 31.1518 3173.78 65.0109 30.4543 3225.11 65.7745 29.7718 3277.27 66.3968 29.1070 3330.28 66.8588 28.4563 3384.15 66.9995 27.8221 3415.60 64.4586 27.4628 3415.80 64.4611 29.0411 3438.88 67.4463 28.7615 3494.50 68.5738 28.1061 3551.02 69.2768 27.4677 3608.46 69.7929 26.8441 3666.82 70.0800 26.2344 3704. 68.6135 25.8581 3704.20 68.6150 26.8044 3726.13 70.4213 26.5959 3786.40 71.2870 26.0374 3847.64 71.8933 25.4847 3909.87 72.4094 24.9406 3973.11 72.8708 24.4042 4037.38 73.2900 23.8741 4102.68 73.6726 23.3509 4169.03 74.0245 22.8368 4236.46 74.3506 22.3311 4304.98 74.6528 21.8323 4374.62 74.9313 21.3413 4445.37 75.1893 20.8595 4517.27 75.4286 20.3855 4590.33 75.6503 19.9198 4664.58 75.8549 19.4621 4740.03 76.0440 19.0128 4816.69 76.2183 18.5718 4894.60 76.3788 18.1391 4973.77 76.5261 17.7143 5054.21 76.6609 17.2980 5135.96 76.7841 16.8898 5219.03 76.8962 16.4898 5303.44 76.9979 16.0979 5389.22 77.0896 15.7138 5476.39 77.1716 15.3376 5564.97 77.2448 14.9696 5654.98 77.3096 14.6092 5746.44 77.3661 14.2564 5839.39 77.4149 13.9112 5933.83 77.4563 13.5736 6029.81 77.4908 13.2434 6127.33 77.5186 12.9206 6226.44 77.5400 12.6048 6327.15 77.5553 12.2964 6429.48 77.5650 11.9949 6533.48 77.5690 11.7000 6639.15 77.5675 11.4121 6746.54 77.5610 11.1309 6855.65 77.5496 10.8563 6966.54 77.5335 10.5881 7079.22 77.5128 10.3260 7193.72 77.4874 10.0702 7310.07 77.4579 9.82072 7428.31 77.4243 9.57694 7548.45 77.3862 9.33922 7670.54 77.3443 9.10735 7794.61 77.2986 8.88107 7920.68 77.2489 8.66026 8048.79 77.1952 8.44462 8178.98 77.1374 8.23456 8311.26 77.0759 8.02967 8445.69 77.0103 7.82977 8582.29 76.9405 7.63486 8721.11 76.8665 7.44478 8862.16 76.7882 7.25975 9005.50 76.7055 7.07902 9151.16 76.6178 6.90326 9299.17 76.5254 6.73167 9449.58 76.4274 6.56427 9602.42 76.3237 6.40131 9757.73 76.2141 6.24246 9915.55 76.0991 6.08778 10075.9 75.9771 5.93012 10238.9 75.8404 5.77671 10404.5 75.6919 5.62747 10572.8 75.5296 5.48228 10743.8 75.3517 5.34106 10917.6 75.1552 5.20372 11094.2 74.9362 5.07016 11273.6 74.6890 4.94029 11455.9 74.4056 4.81403 11641.2 74.0733 4.69128 11829.5 73.6713 4.57196 12020.8 73.1616 4.45600 12215.3 72.4622 4.34329 12412.8 71.3355 4.23377 12613.6 68.0599 4.12734 12657.4 56.2604 4.10472 12657.6 56.2610 10.2136 12817.6 70.6878 9.98918 13025.0 72.2894 9.70969 13235.6 73.0984 9.43803 13449.7 73.5876 9.17398 13667.2 73.8811 8.91731 13888.3 74.0185 8.66783 14112.9 73.9944 8.42533 14341.2 73.7373 8.18962 14573.1 72.8677 7.96050 14697.8 65.8290 7.84150 14698.0 65.8291 10.9738 14808.9 72.8684 10.8572 15048.4 73.9928 10.6124 15291.8 73.9654 10.3730 15346.6 71.1617 10.3204 15346.8 71.1623 11.7869 15539.1 75.1270 11.5714 15790.4 75.9626 11.2996 16045.8 76.5449 11.0325 16305.4 77.0086 10.7702 16569.1 77.3971 10.5127 16837.1 77.7320 10.2599 17109.4 78.0253 10.0119 17386.1 78.2854 9.76875 17667.4 78.5178 9.53030 17953.1 78.7266 9.29659 18243.5 78.9152 9.06757 18538.6 79.0859 8.84324 18838.4 79.2410 8.62354 19143.1 79.3819 8.40844 19452.7 79.5102 8.19790 19767.4 79.6271 7.99185 20087.1 79.7336 7.79027 20412.0 79.8305 7.59309 20742.1 79.9188 7.40026 21077.6 79.9991 7.21172 21418.5 80.0720 7.02741 21765.0 80.1382 6.84728 22117.0 80.1980 6.67126 22474.7 80.2520 6.49929 22838.2 80.3005 6.33130 23207.6 80.3441 6.16723 23583.0 80.3829 6.00701 23964.4 80.4174 5.85059 24352.0 80.4478 5.69788 24745.9 80.4744 5.54882 25146.2 80.4974 5.40336 25552.9 80.5172 5.26141 25966.2 80.5339 5.12292 26386.1 80.5476 4.98780 26812.9 80.5587 4.85602 27246.6 80.5672 4.72748 27687.3 80.5734 4.60213 28135.1 80.5774 4.47990 28590.2 80.5793 4.36072 29052.6 80.5793 4.24454 29522.5 80.5775 4.13129 30000.0 80.5740 4.02090 periodictable-1.5.0/periodictable/xsf/tm.nff000066400000000000000000000321001310514471200210360ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.179178 10.1617 -9999. 0.183562 10.3261 -9999. 0.188053 10.4931 -9999. 0.192655 10.6628 -9999. 0.197369 10.8353 -9999. 0.202198 11.0106 -9999. 0.207145 11.1886 -9999. 0.212214 11.3696 -9999. 0.217406 11.5535 -9999. 0.222726 11.7404 -9999. 0.228032 11.9303 -9999. 0.233362 12.1232 -9999. 0.238816 12.3193 -9999. 0.244398 12.5186 -9999. 0.252465 12.7210 -9999. 0.260938 12.9268 -9999. 0.269695 13.1359 -9999. 0.278956 13.3483 -9999. 0.288750 13.5642 -9999. 0.298888 13.7836 -9999. 0.309381 14.0066 -9999. 0.320243 14.2331 -9999. 0.330785 14.4633 -9999. 0.341628 14.6973 -9999. 0.352827 14.9350 -9999. 0.363367 15.1765 -9999. 0.371920 15.4220 -9999. 0.380674 15.6714 -9999. 0.389635 15.9249 -9999. 0.401388 16.1825 -9999. 0.414494 16.4442 -9999. 0.428028 16.7102 -9999. 0.442004 16.9805 -9999. 0.454906 17.2551 -9999. 0.467522 17.5342 -9999. 0.480488 17.8178 -9999. 0.493146 18.1060 -9999. 0.504313 18.3989 -9999. 0.515734 18.6964 -9999. 0.528157 18.9988 -9999. 0.543557 19.3061 -9999. 0.559407 19.6184 -9999. 0.576219 19.9357 -9999. 0.596380 20.2582 -9999. 0.617248 20.5858 -9999. 0.634307 20.9188 -9999. 0.649729 21.2571 -9999. 0.665525 21.6009 -9999. 0.681582 21.9503 -9999. 0.697862 22.3053 -9999. 0.714532 22.6661 -9999. 0.731985 23.0327 -9999. 0.773361 23.4053 -9999. 0.817076 23.7838 -9999. 0.877890 24.1685 -9999. 0.973146 24.5594 -9999. 1.07964 24.9566 -9999. 1.21408 25.3603 -9999. 1.36749 25.7705 -9999. 1.71606 26.1873 -9999. 2.52512 26.6109 -9999. 2.89514 27.0413 -9999. 3.63391 27.4786 -9999. 4.25061 27.9231 -9999. 4.80946 28.3747 -9999. 5.47785 28.8337 -9999. 6.19755 29.3000 -1.83272 6.87100 29.7739 -1.59375 7.58570 30.2555 -1.18278 8.34892 30.7449 -0.632699 8.77946 31.2421 -0.176010 9.16803 31.7475 0.264100 9.49109 32.2609 0.701096 9.82237 32.7827 1.22228 10.0759 33.3130 1.65537 10.2386 33.8518 2.05797 10.4039 34.3993 2.45219 10.5534 34.9557 2.84079 10.7009 35.5211 3.25342 10.8505 36.0956 3.68788 10.9113 36.6794 4.06430 10.9433 37.2727 4.41214 10.9805 37.8755 4.76201 11.0320 38.4882 5.14352 11.0836 39.1107 5.61211 11.0591 39.7432 5.97827 10.9286 40.3861 6.28050 10.7983 41.0393 6.54689 10.6669 41.7031 6.78875 10.5366 42.3776 6.98948 10.3804 43.0630 7.12303 10.2265 43.7595 7.23244 10.1678 44.4673 7.36725 10.1178 45.1865 7.50368 10.0680 45.9174 7.62885 10.0185 46.6600 7.75385 10.0042 47.4147 7.89935 9.99430 48.1816 8.06663 9.98443 48.9609 8.28215 9.93439 49.7528 8.44301 9.83561 50.5576 8.56713 9.73780 51.3753 8.65773 9.64968 52.2062 8.74739 9.59672 53.0506 8.84136 9.54405 53.9087 8.93477 9.49166 54.7806 9.02552 9.43641 55.6667 9.10763 9.37913 56.5670 9.18133 9.32220 57.4820 9.24507 9.26561 58.4117 9.29896 9.21499 59.3564 9.34608 9.16647 60.3165 9.37880 9.11820 61.2921 9.39554 9.09211 62.2834 9.41863 9.07559 63.2908 9.43804 9.05911 64.3145 9.43618 9.04593 65.3547 9.43900 9.08196 66.4118 9.45926 9.11814 67.4859 9.48843 9.15447 68.5775 9.52063 9.19135 69.6867 9.55534 9.22974 70.8138 9.59099 9.26830 71.9591 9.62532 9.30701 73.1230 9.65283 9.34589 74.3057 9.67811 9.40529 75.5076 9.71422 9.46895 76.7289 9.75728 9.53304 77.9699 9.80552 9.59756 79.2310 9.85852 9.65567 80.5125 9.90645 9.71026 81.8147 9.94973 9.76516 83.1380 9.98655 9.82038 84.4827 10.0048 9.88424 85.8491 10.0338 9.97333 87.2377 10.0731 10.0632 88.6487 10.1146 10.1539 90.0825 10.1497 10.2454 91.5395 10.1822 10.3684 93.0201 10.2482 10.5080 94.5246 10.3566 10.6373 96.0535 10.4566 10.7170 97.6071 10.5431 10.7973 99.1858 10.6226 10.8782 100.790 10.6984 10.9598 102.420 10.7708 11.0419 104.077 10.8395 11.1247 105.760 10.9029 11.2080 107.471 10.9577 11.2920 109.209 10.9939 11.3767 110.975 10.9653 11.5042 112.770 11.0177 11.7511 114.594 11.1815 12.0033 116.448 11.4096 12.1045 118.331 11.5757 12.1624 120.245 11.6972 12.2269 122.190 11.8114 12.2982 124.166 11.9192 12.3699 126.175 12.0152 12.4420 128.215 12.1006 12.5419 130.289 12.2141 12.6580 132.397 12.3833 12.7751 134.538 12.5585 12.7857 136.714 12.6685 12.7713 138.925 12.7218 12.7568 141.172 12.6274 12.9099 143.456 12.8543 13.0743 145.776 13.0431 13.0593 148.134 13.2282 13.0442 150.530 13.3649 12.8550 152.964 13.4070 12.6556 155.439 13.4969 12.4593 157.953 13.4463 11.8315 160.507 12.8937 11.0929 163.103 11.9686 10.4729 165.742 10.3912 9.56704 168.422 7.25855 8.83252 171.146 -2.39426 12.5076 173.915 0.125351 31.9669 176.727 11.1046 29.0638 179.586 16.7436 25.5757 182.491 18.1993 22.6301 185.442 18.6800 20.5774 188.442 18.2749 19.3155 191.489 18.0141 18.8170 194.587 18.0556 18.5739 197.734 18.1419 18.3337 200.932 18.1449 18.0964 204.182 18.1549 18.0687 207.485 18.1959 18.0902 210.840 18.3088 18.1670 214.251 18.4722 18.2445 217.716 18.6575 18.3236 221.237 18.8606 18.4046 224.816 19.0780 18.4865 228.452 19.3082 18.5687 232.147 19.5532 18.6510 235.902 19.8099 18.7246 239.717 20.0799 18.7874 243.595 20.3438 18.8366 247.535 20.6065 18.8860 251.538 20.8726 18.9356 255.607 21.1475 18.9855 259.741 21.4357 19.0266 263.942 21.7402 19.0426 268.211 22.0199 19.0303 272.549 22.2844 19.0185 276.957 22.5413 19.0066 281.437 22.7950 18.9947 285.989 23.0432 18.9735 290.615 23.2841 18.9492 295.315 23.5145 18.9216 300.092 23.7357 18.8932 304.945 23.9476 18.8650 309.878 24.1512 18.8375 314.890 24.3454 18.8099 319.983 24.5283 18.7822 325.158 24.6965 18.7545 330.418 24.8422 18.7263 335.762 24.9104 18.7397 341.192 25.0249 18.8387 346.711 25.1894 18.9393 352.319 25.3723 19.0405 358.017 25.5698 19.1419 363.808 25.7798 19.2433 369.692 26.0021 19.3447 375.672 26.2352 19.4453 381.748 26.4795 19.5445 387.922 26.7378 19.6400 394.197 26.9998 19.7273 400.573 27.2677 19.8152 407.052 27.5442 19.9036 413.635 27.8340 19.9934 420.326 28.1393 20.0777 427.124 28.4736 20.1532 434.032 28.7997 20.1898 441.052 29.1194 20.2266 448.186 29.4413 20.2637 455.435 29.7757 20.3014 462.802 30.1234 20.3172 470.287 30.4716 20.3188 477.894 30.8107 20.3085 485.623 31.1492 20.2983 493.478 31.4984 20.2860 501.459 31.8567 20.2652 509.570 32.2248 20.2274 517.812 32.6084 20.1740 526.187 32.9995 20.0933 534.698 33.3853 19.9619 543.346 33.7319 19.8061 552.134 34.0579 19.6517 561.065 34.3706 19.4860 570.139 34.6663 19.3153 579.361 34.9442 19.1416 588.732 35.2090 18.9688 598.254 35.4628 18.7970 607.930 35.7081 18.6268 617.763 35.9477 18.4582 627.755 36.1882 18.2898 637.908 36.4281 18.1083 648.226 36.6585 17.9069 658.711 36.8594 17.6937 669.365 37.0310 17.4829 680.191 37.1786 17.3031 691.193 37.3345 17.1468 702.372 37.5188 16.9948 713.733 37.7109 16.8118 725.277 37.8782 16.6085 737.008 38.0273 16.4073 748.928 38.1645 16.2085 761.042 38.2934 16.0118 773.351 38.4172 15.8143 785.859 38.5336 15.6087 798.570 38.6319 15.3973 811.486 38.7151 15.1887 824.611 38.7857 14.9827 837.949 38.8452 14.7795 851.502 38.8938 14.5775 865.274 38.9310 14.3770 879.269 38.9560 14.1781 893.491 38.9690 13.9817 907.943 38.9707 13.7878 922.628 38.9621 13.5966 937.551 38.9410 13.4036 952.715 38.9061 13.2123 968.124 38.8571 13.0228 983.783 38.7945 12.8354 999.695 38.7193 12.6484 1015.86 38.6340 12.4619 1032.29 38.5258 12.2584 1048.99 38.3905 12.0560 1065.96 38.2265 11.8547 1083.20 38.0344 11.6566 1100.72 37.8130 11.4615 1118.52 37.5602 11.2694 1136.61 37.2723 11.0800 1155. 36.9458 10.8937 1173.68 36.5761 10.7106 1192.66 36.1568 10.5299 1211.95 35.6800 10.3522 1231.55 35.1361 10.1773 1251.47 34.5117 10.0049 1271.72 33.7895 9.83530 1292.29 32.9456 9.66836 1313.19 31.9460 9.50400 1334.43 30.7402 9.34231 1356.01 29.2490 9.18320 1377.94 27.3369 9.02628 1400.23 24.7448 8.87195 1422.88 20.8755 8.72024 1445.89 13.7238 8.57096 1467.60 -44.2153 8.43460 1467.80 -44.1931 42.8257 1469.28 -13.8820 42.7609 1493.04 17.4885 41.7396 1517.19 25.4206 40.7427 1541.73 30.2635 39.7697 1566.67 33.7576 38.8199 1592.01 36.4746 37.8923 1617.76 38.6758 36.9864 1643.92 40.5020 36.1017 1670.51 42.0367 35.2376 1697.53 43.3311 34.3941 1724.99 44.4168 33.5707 1752.89 45.3076 32.7667 1781.24 45.9987 31.9821 1810.05 46.4533 31.2164 1839.32 46.5451 30.4691 1869.07 45.6404 29.7395 1884.40 37.8613 29.3749 1884.60 37.8683 34.4908 1899.30 46.4076 34.0785 1930.02 48.9110 33.2426 1961.24 50.3126 32.4274 1992.96 51.3072 31.6324 2025.20 52.0236 30.8646 2057.95 52.4012 30.1089 2089.70 49.2357 29.4051 2089.90 49.2403 31.5216 2091.24 51.0690 31.4912 2125.06 53.8878 30.7384 2159.43 54.9073 30.0041 2194.36 55.6496 29.2878 2229.85 56.2642 28.5900 2265.92 56.2643 27.9089 2302.57 56.6238 28.3473 2306.70 56.7380 28.3967 2306.90 56.7542 28.4207 2339.81 57.8031 27.8706 2377.66 58.5099 27.2604 2416.11 59.0979 26.6619 2455.19 59.6158 26.0750 2494.90 60.0814 25.4984 2535.26 60.5051 24.9339 2576.26 60.8941 24.3806 2617.93 61.2520 23.8378 2660.27 61.5830 23.3065 2703.30 61.8888 22.7846 2747.03 62.1716 22.2745 2791.46 62.4341 21.7748 2836.61 62.6779 21.2854 2882.49 62.9040 20.8060 2929.11 63.1140 20.3364 2976.48 63.3084 19.8763 3024.63 63.4880 19.4261 3073.55 63.6546 18.9860 3123.26 63.8095 18.5549 3173.78 63.9523 18.1320 3225.11 64.0832 17.7186 3277.27 64.2041 17.3143 3330.28 64.3153 16.9181 3384.15 64.4172 16.5306 3438.88 64.5096 16.1507 3494.50 64.5937 15.7799 3551.02 64.6706 15.4167 3608.46 64.7392 15.0605 3666.82 64.8008 14.7131 3726.13 64.8558 14.3723 3786.40 64.9037 14.0390 3847.64 64.9454 13.7130 3909.87 64.9812 13.3940 3973.11 65.0113 13.0819 4037.38 65.0358 12.7766 4102.68 65.0550 12.4779 4169.03 65.0691 12.1856 4236.46 65.0783 11.8999 4304.98 65.0828 11.6202 4374.62 65.0827 11.3469 4445.37 65.0783 11.0793 4517.27 65.0695 10.8176 4590.33 65.0565 10.5619 4664.58 65.0395 10.3118 4740.03 65.0185 10.0671 4816.69 64.9935 9.82784 4894.60 64.9648 9.59393 4973.77 64.9324 9.36514 5054.21 64.8961 9.14144 5135.96 64.8560 8.92270 5219.03 64.8121 8.70875 5303.44 64.7645 8.49979 5389.22 64.7131 8.29526 5476.39 64.6578 8.09544 5564.97 64.5986 7.90005 5654.98 64.5352 7.70899 5746.44 64.4677 7.52232 5839.39 64.3958 7.33972 5933.83 64.3193 7.16126 6029.81 64.2380 6.98675 6127.33 64.1514 6.81608 6226.44 64.0594 6.64936 6327.15 63.9615 6.48626 6429.48 63.8571 6.32692 6533.48 63.7457 6.17090 6639.15 63.6264 6.01861 6746.54 63.4986 5.86965 6855.65 63.3610 5.72401 6966.54 63.2124 5.58163 7079.22 63.0512 5.44249 7193.72 62.8754 5.30649 7310.07 62.6824 5.17342 7428.31 62.4687 5.04336 7548.45 62.2300 4.91617 7670.54 61.9600 4.79183 7794.61 61.6498 4.67022 7920.68 61.2862 4.55132 8048.79 60.8480 4.43505 8178.98 60.2973 4.32141 8311.26 59.5582 4.21043 8445.69 58.4313 4.10195 8582.29 55.9647 3.99560 8647.90 41.5787 3.94610 8648.10 41.5800 10.9583 8721.11 56.3180 10.7878 8862.16 58.6756 10.4698 9005.50 59.6751 10.1611 9151.16 60.1876 9.86135 9299.17 60.3598 9.57055 9449.58 60.1034 9.28846 9602.42 57.7059 9.01460 9616.80 52.0592 8.98948 9617. 52.0600 12.5751 9757.73 60.6046 12.2326 9915.55 61.5434 11.8652 10075.9 61.5694 11.5113 10115.6 58.9955 11.4263 10115.8 58.9961 12.8521 10238.9 62.6389 12.6349 10404.5 63.5029 12.3524 10572.8 64.1240 12.0738 10743.8 64.6296 11.7992 10917.6 65.0605 11.5285 11094.2 65.4367 11.2621 11273.6 65.7699 10.9998 11455.9 66.0681 10.7418 11641.2 66.3368 10.4881 11829.5 66.5801 10.2387 12020.8 66.8013 9.99374 12215.3 67.0030 9.75315 12412.8 67.1873 9.51697 12613.6 67.3560 9.28521 12817.6 67.5105 9.05787 13025.0 67.6522 8.83492 13235.6 67.7820 8.61636 13449.7 67.9011 8.40218 13667.2 68.0103 8.19233 13888.3 68.1103 7.98681 14112.9 68.2018 7.78557 14341.2 68.2854 7.58858 14573.1 68.3617 7.39579 14808.9 68.4313 7.20717 15048.4 68.4944 7.02267 15291.8 68.5517 6.84224 15539.1 68.6035 6.66583 15790.4 68.6500 6.49338 16045.8 68.6918 6.32485 16305.4 68.7291 6.16017 16569.1 68.7621 5.99929 16837.1 68.7911 5.84215 17109.4 68.8165 5.68870 17386.1 68.8383 5.53886 17667.4 68.8569 5.39259 17953.1 68.8725 5.24981 18243.5 68.8851 5.11047 18538.6 68.8951 4.97451 18838.4 68.9026 4.84185 19143.1 68.9077 4.71245 19452.7 68.9106 4.58624 19767.4 68.9114 4.46315 20087.1 68.9102 4.34313 20412.0 68.9073 4.22611 20742.1 68.9026 4.11203 21077.6 68.8964 4.00082 21418.5 68.8886 3.89245 21765.0 68.8794 3.78682 22117.0 68.8690 3.68391 22474.7 68.8573 3.58363 22838.2 68.8444 3.48594 23207.6 68.8305 3.39077 23583.0 68.8156 3.29807 23964.4 68.7997 3.20779 24352.0 68.7830 3.11987 24745.9 68.7654 3.03425 25146.2 68.7471 2.95088 25552.9 68.7281 2.86972 25966.2 68.7084 2.79070 26386.1 68.6881 2.71377 26812.9 68.6672 2.63889 27246.6 68.6457 2.56601 27687.3 68.6237 2.49507 28135.1 68.6012 2.42604 28590.2 68.5783 2.35886 29052.6 68.5549 2.29348 29522.5 68.5311 2.22987 30000.0 68.5069 2.16799 periodictable-1.5.0/periodictable/xsf/u.nff000066400000000000000000000320051310514471200206660ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.62700 10.1617 -9999. 1.61282 10.3261 -9999. 1.59877 10.4931 -9999. 1.58416 10.6628 -9999. 1.56547 10.8353 -9999. 1.54700 11.0106 -9999. 1.52874 11.1886 -9999. 1.51070 11.3696 -9999. 1.49287 11.5535 -9999. 1.47526 11.7404 -9999. 1.45876 11.9303 -9999. 1.44394 12.1232 -9999. 1.42927 12.3193 -9999. 1.41475 12.5186 -9999. 1.40038 12.7210 -9999. 1.38615 12.9268 -9999. 1.37207 13.1359 -9999. 1.35814 13.3483 -9999. 1.34434 13.5642 -9999. 1.33011 13.7836 -9999. 1.31551 14.0066 -9999. 1.30107 14.2331 -9999. 1.28679 14.4633 -9999. 1.27267 14.6973 -9999. 1.25871 14.9350 -9999. 1.24489 15.1765 -9999. 1.23229 15.4220 -9999. 1.22013 15.6714 -9999. 1.20809 15.9249 -9999. 1.19617 16.1825 -9999. 1.18436 16.4442 -9999. 1.17567 16.7102 -9999. 1.17857 16.9805 -9999. 1.18147 17.2551 -9999. 1.19738 17.5342 -9999. 1.22734 17.8178 -9999. 1.26351 18.1060 -9999. 1.38802 18.3989 -9999. 1.54488 18.6964 -9999. 1.79483 18.9988 -9999. 2.45978 19.3061 -9999. 3.52381 19.6184 -9999. 5.04811 19.9357 -9999. 6.00990 20.2582 -9999. 6.93785 20.5858 -9999. 7.41969 20.9188 -9999. 7.93500 21.2571 -9999. 8.38150 21.6009 -9999. 8.80602 21.9503 -9999. 9.25204 22.3053 -9999. 9.66152 22.6661 -9999. 9.97607 23.0327 -9999. 10.3009 23.4053 -9999. 10.6362 23.7838 -9999. 10.9825 24.1685 -9999. 11.3401 24.5594 -9999. 11.6286 24.9566 -9999. 11.8448 25.3603 -9999. 12.0651 25.7705 -9999. 12.2894 26.1873 -9999. 12.5180 26.6109 -9999. 12.7507 27.0413 -9999. 12.9878 27.4786 -9999. 13.1712 27.9231 -9999. 13.2157 28.3747 -9999. 13.2603 28.8337 -9999. 13.3051 29.3000 10.5750 13.3500 29.7739 10.8811 13.3951 30.2555 11.1801 13.4403 30.7449 11.4705 13.4761 31.2421 11.7502 13.5120 31.7475 12.0226 13.5479 32.2609 12.2894 13.5840 32.7827 12.5520 13.6201 33.3130 12.8112 13.6564 33.8518 13.0681 13.6927 34.3993 13.3234 13.7291 34.9557 13.5780 13.7654 35.5211 13.8325 13.8018 36.0956 14.0879 13.8383 36.6794 14.3452 13.8749 37.2727 14.6054 13.9116 37.8755 14.8699 13.9483 38.4882 15.1405 13.9852 39.1107 15.4197 14.0222 39.7432 15.7113 14.0592 40.3861 16.0222 14.0964 41.0393 16.3798 14.1337 41.7031 16.7949 14.0635 42.3776 17.1277 13.9402 43.0630 17.4186 13.8180 43.7595 17.6901 13.6969 44.4673 17.9475 13.5768 45.1865 18.1950 13.4578 45.9174 18.4361 13.3398 46.6600 18.6771 13.2229 47.4147 18.9311 13.1070 48.1816 19.1850 12.9381 48.9609 19.4019 12.7600 49.7528 19.5991 12.5844 50.5576 19.7829 12.4111 51.3753 19.9574 12.2402 52.2062 20.1258 12.0717 53.0506 20.2924 11.9055 53.9087 20.4646 11.7416 54.7806 20.6678 11.5800 55.6667 20.8889 11.3130 56.5670 21.0308 11.0195 57.4820 21.1241 10.7337 58.4117 21.1890 10.4552 59.3564 21.2305 10.1841 60.3165 21.2522 9.91987 61.2921 21.2570 9.66255 62.2834 21.2480 9.41192 63.2908 21.2285 9.16778 64.3145 21.2097 8.92997 65.3547 21.2274 8.66886 66.4118 21.1810 8.33553 67.4859 21.0749 8.01500 68.5775 20.9334 7.70682 69.6867 20.7635 7.41047 70.8138 20.5729 7.12553 71.9591 20.3794 6.85153 73.1230 20.1610 6.52316 74.3057 19.8768 6.19680 75.5076 19.5503 5.88679 76.7289 19.1954 5.59228 77.9699 18.8490 5.31250 79.2310 18.5765 4.87428 80.5125 18.0441 4.32769 81.8147 17.3440 3.84240 83.1380 16.5116 3.35902 84.4827 15.5172 2.92900 85.8491 14.3428 2.57831 87.2377 13.0798 2.36876 88.6487 11.6824 2.17626 90.0825 10.0670 2.05790 91.5395 8.21023 1.99914 93.0201 5.95259 1.99515 94.5246 2.91261 2.12790 96.0535 -1.97819 3.51635 97.6071 -7.08175 8.09234 99.1858 -9.58304 18.6229 100.790 3.07762 24.6815 102.420 6.43030 18.4389 104.077 4.15900 13.7751 105.760 0.301717 12.8448 107.471 -4.57170 12.3641 109.209 -10.6639 12.3392 110.975 -22.3172 12.5592 112.770 -67.1152 85.1494 114.594 -32.1427 94.4911 116.448 3.38118 95.9686 118.331 28.6729 87.0976 120.245 38.7668 73.8404 122.190 44.5490 65.7776 124.166 49.2497 58.5187 126.175 52.1489 51.3202 128.215 53.5133 45.0073 130.289 53.8094 39.4711 132.397 53.1595 34.6158 134.538 50.9933 31.1950 136.714 49.9722 29.6174 138.925 49.4985 28.1196 141.172 49.2360 26.6975 143.456 49.0708 25.3473 145.776 48.9555 24.0654 148.134 48.8683 22.8484 150.530 48.8065 21.6929 152.964 48.8111 20.5527 155.439 48.7305 19.3633 157.953 48.5873 18.2427 160.507 48.4057 17.1870 163.103 48.1986 16.1923 165.742 47.9748 15.2552 168.422 47.7446 14.3724 171.146 47.5511 13.5406 173.915 47.3422 12.6314 176.727 47.0332 11.7469 179.586 46.6686 10.9244 182.491 46.2678 10.1595 185.442 45.8378 9.44810 188.442 45.3813 8.78653 191.489 44.8938 8.17131 194.587 44.3193 7.59914 197.734 43.7533 7.24255 200.932 43.2896 6.93603 204.182 42.8744 6.64249 207.485 42.4876 6.36138 210.840 42.1198 6.09215 214.251 41.7657 5.83432 217.716 41.4211 5.58740 221.237 41.0829 5.35094 224.816 40.7464 5.12448 228.452 40.4126 4.91606 232.147 40.0836 4.71802 235.902 39.7545 4.52796 239.717 39.4139 4.34556 243.595 39.0661 4.20612 247.535 38.7391 4.08651 251.538 38.4263 3.97030 255.607 38.1152 3.85740 259.741 37.7944 3.74770 263.942 37.4559 3.66731 268.211 37.1436 3.61890 272.549 36.8456 3.57113 276.957 36.5521 3.52400 281.437 36.2571 3.47749 285.989 35.9384 3.43159 290.615 35.6221 3.43678 295.315 35.3296 3.44981 300.092 35.0468 3.46290 304.945 34.7674 3.47602 309.878 34.4870 3.48920 314.890 34.1991 3.50243 319.983 33.8928 3.52807 325.158 33.5969 3.57732 330.418 33.3056 3.62725 335.762 33.0118 3.67788 341.192 32.7110 3.72922 346.711 32.3981 3.78127 352.319 32.0617 3.83405 358.017 31.6867 3.92494 363.808 31.3262 4.05508 369.692 30.9779 4.18955 375.672 30.6235 4.32847 381.748 30.2556 4.47199 387.922 29.8610 4.62028 394.197 29.4184 4.81395 400.573 28.9869 5.05973 407.052 28.5632 5.31806 413.635 28.1237 5.58958 420.326 27.6060 5.87496 427.124 27.0756 6.31162 434.032 26.6000 6.81207 441.052 26.1586 7.35218 448.186 25.7436 7.93513 455.435 25.3591 8.56083 462.802 25.0013 9.23032 470.287 24.6829 9.95215 477.894 24.4242 10.7076 485.623 24.1980 11.4899 493.478 24.0144 12.3293 501.459 23.9346 13.2301 509.570 23.9381 14.0536 517.812 23.9468 14.8772 526.187 23.9723 15.7491 534.698 24.0615 16.6721 543.346 24.2824 17.6206 552.134 24.5668 18.5457 561.065 24.9863 19.5194 570.139 25.6014 20.3875 579.361 26.2416 21.1154 588.732 27.1399 21.8465 598.254 27.9274 21.9640 607.930 28.5050 22.0820 617.763 29.1067 22.1429 627.755 29.4339 21.9385 637.908 29.3660 21.8888 648.226 29.2264 22.0330 658.711 29.0216 22.3228 669.365 28.8388 22.7453 680.191 28.5719 23.1759 691.193 28.1800 23.8702 702.372 27.9802 24.8543 713.733 27.9219 25.8819 725.277 27.9828 26.9992 737.008 28.1625 28.1647 748.928 28.4885 29.3772 761.042 28.9164 30.5788 773.351 29.4417 31.8296 785.859 30.1187 33.1315 798.570 30.9956 34.3945 811.486 31.9794 35.6068 824.611 33.1083 36.8619 837.949 34.6532 38.1612 851.502 36.2827 38.7940 865.274 37.8031 39.3702 879.269 39.4166 39.9549 893.491 41.1724 40.2501 907.943 42.7286 40.2453 922.628 44.1879 40.2405 937.551 45.5672 40.0917 952.715 46.8148 39.9107 968.124 47.8824 39.9001 983.783 49.2008 40.1576 999.695 51.0493 40.4167 1015.86 54.9983 40.6774 1032.29 54.7330 36.0780 1048.99 53.7840 35.8366 1065.96 54.3136 35.7773 1083.20 54.9350 35.4768 1100.72 55.5198 35.1633 1118.52 56.1044 34.8526 1136.61 56.6867 34.5446 1155. 57.2650 34.2394 1173.68 57.8384 33.9369 1192.66 58.4068 33.6370 1211.95 58.9713 33.3398 1231.55 59.5334 33.0451 1251.47 60.0959 32.7532 1271.72 60.6636 32.4637 1292.29 61.2463 32.1769 1313.19 61.8897 31.8925 1334.43 62.5241 31.4589 1356.01 63.0875 30.9981 1377.94 63.5902 30.5440 1400.23 64.0610 30.0966 1422.88 64.5058 29.6558 1445.89 64.9289 29.2215 1469.28 65.3334 28.7935 1493.04 65.7218 28.3717 1517.19 66.0966 27.9562 1541.73 66.4601 27.5467 1566.67 66.8149 27.1432 1592.01 67.1647 26.7456 1617.76 67.5163 26.3539 1643.92 67.8971 25.9679 1670.51 68.2738 25.4962 1697.53 68.5971 25.0005 1724.99 68.8692 24.5143 1752.89 69.1134 24.0376 1781.24 69.3338 23.5702 1810.05 69.5334 23.1119 1839.32 69.7143 22.6625 1869.07 69.8781 22.2218 1899.30 70.0260 21.7897 1930.02 70.1590 21.3660 1961.24 70.2779 20.9505 1992.96 70.3834 20.5431 2025.20 70.4762 20.1437 2057.95 70.5567 19.7520 2091.24 70.6254 19.3679 2125.06 70.6828 18.9912 2159.43 70.7293 18.6220 2194.36 70.7657 18.2598 2229.85 70.7930 17.9048 2265.92 70.8150 17.5566 2302.57 70.8319 17.2011 2339.81 70.8286 16.8393 2377.66 70.8012 16.4851 2416.11 70.7570 16.1383 2455.19 70.6962 15.7989 2494.90 70.6191 15.4666 2535.26 70.5254 15.1412 2576.26 70.4146 14.8227 2617.93 70.2859 14.5109 2660.27 70.1383 14.2057 2703.30 69.9706 13.9069 2747.03 69.7811 13.6144 2791.46 69.5678 13.3280 2836.61 69.3282 13.0476 2882.49 69.0592 12.7732 2929.11 68.7569 12.5045 2976.48 68.4130 12.2415 3024.63 68.0257 11.9906 3073.55 67.5920 11.7473 3123.26 67.0988 11.5088 3173.78 66.5456 11.2752 3225.11 65.9045 11.0188 3277.27 65.0956 10.7185 3330.28 64.0540 10.4264 3384.15 62.6818 10.1423 3438.88 60.7377 9.86597 3494.50 57.4574 9.59711 3551.02 36.8481 9.33562 3551.60 27.9841 9.33299 3551.80 27.9911 23.9176 3608.46 57.0764 22.8503 3666.82 58.7767 21.8168 3726.13 51.9404 21.1209 3727.50 45.8434 21.1052 3727.70 45.8461 28.2603 3786.40 61.4517 27.8547 3847.64 63.9774 27.4443 3909.87 65.5811 27.0398 3973.11 66.7483 26.7485 4037.38 67.7374 26.5462 4102.68 68.6142 26.3294 4169.03 69.2506 25.9461 4236.46 69.8091 25.5685 4303.30 62.6813 25.2053 4303.50 62.6905 29.1726 4304.98 65.8913 29.1600 4374.62 71.3773 28.5770 4445.37 72.9924 28.0057 4517.27 74.1697 27.4457 4590.33 75.1327 26.8669 4664.58 75.9092 26.2629 4740.03 76.4810 25.7150 4816.69 76.9832 25.3035 4894.60 77.4932 24.8986 4973.77 77.9429 24.5001 5054.21 78.3129 24.1081 5135.96 78.5724 23.7223 5182.10 76.8897 23.5099 5182.30 76.8951 24.6131 5219.03 78.9443 24.4161 5303.44 79.8351 23.9744 5389.22 80.4626 23.5407 5476.39 80.9998 23.1148 5564.97 81.4878 22.6966 5654.98 81.9557 22.2861 5746.44 82.4005 21.8283 5839.39 82.7861 21.3608 5933.83 83.1227 20.9032 6029.81 83.4256 20.4555 6127.33 83.6978 20.0174 6226.44 83.9417 19.5887 6327.15 84.1366 19.1691 6429.48 84.3059 18.8064 6533.48 84.4947 18.4729 6639.15 84.6871 18.1453 6746.54 84.8782 17.8236 6855.65 85.0669 17.5075 6966.54 85.2536 17.1971 7079.22 85.4394 16.8921 7193.72 85.6268 16.5925 7310.07 85.8185 16.2983 7428.31 86.0525 16.0093 7548.45 86.3050 15.6522 7670.54 86.4946 15.2272 7794.61 86.6260 14.8138 7920.68 86.7211 14.4117 8048.79 86.7843 14.0204 8178.98 86.7944 13.6433 8311.26 86.7896 13.3491 8445.69 86.8225 13.0613 8582.29 86.8541 12.7797 8721.11 86.9066 12.5041 8862.16 86.9603 12.1882 9005.50 86.9525 11.8288 9151.16 86.8622 11.4799 9299.17 86.6684 11.1965 9449.58 86.2926 10.9951 9602.42 86.2961 11.5634 9757.73 86.8907 11.3972 9915.55 87.0112 11.1148 10075.9 87.1235 10.8358 10238.9 87.2021 10.5627 10404.5 87.2582 10.2954 10572.8 87.2970 10.0338 10743.8 87.3216 9.77794 10917.6 87.3343 9.52764 11094.2 87.3363 9.28286 11273.6 87.3287 9.04349 11455.9 87.3121 8.80948 11641.2 87.2871 8.58072 11829.5 87.2540 8.35713 12020.8 87.2130 8.13863 12215.3 87.1642 7.92511 12412.8 87.1076 7.71652 12613.6 87.0431 7.51273 12817.6 86.9706 7.31369 13025.0 86.8896 7.11929 13235.6 86.7997 6.92944 13449.7 86.7004 6.74407 13667.2 86.5909 6.56307 13888.3 86.4701 6.38638 14112.9 86.3367 6.21389 14341.2 86.1891 6.04553 14573.1 86.0250 5.88120 14808.9 85.8414 5.72084 15048.4 85.6342 5.56434 15291.8 85.3978 5.41164 15539.1 85.1238 5.26265 15790.4 84.7993 5.11728 16045.8 84.4028 4.97547 16305.4 83.8952 4.83712 16569.1 83.1915 4.70218 16837.1 82.0438 4.57055 17109.4 78.6184 4.44217 17166.2 65.9767 4.41610 17166.4 65.9770 10.6918 17386.1 81.4419 10.4638 17667.4 83.1057 10.1830 17953.1 83.9805 9.90984 18243.5 84.5468 9.64398 18538.6 84.9377 9.38526 18838.4 85.2071 9.13348 19143.1 85.3793 8.88847 19452.7 85.4626 8.65004 19767.4 85.4514 8.41801 20087.1 85.3197 8.19221 20412.0 84.9908 7.97247 20742.1 84.1388 7.75864 20947.5 76.5744 7.63016 20947.7 76.5750 10.8162 21077.6 83.7482 10.7130 21418.5 84.9753 10.4497 21757.3 82.4206 10.1985 21757.5 82.4216 11.5813 21765.0 84.1169 11.5758 22117.0 86.2433 11.3180 22474.7 86.9581 11.0638 22838.2 87.4811 10.8132 23207.6 87.9041 10.5665 23583.0 88.2616 10.3235 23964.4 88.5713 10.0845 24352.0 88.8441 9.84944 24745.9 89.0869 9.61834 25146.2 89.3048 9.39124 25552.9 89.5013 9.16818 25966.2 89.6793 8.94915 26386.1 89.8411 8.73417 26812.9 89.9885 8.52324 27246.6 90.1230 8.31635 27687.3 90.2458 8.11349 28135.1 90.3582 7.91465 28590.2 90.4611 7.71980 29052.6 90.5564 7.52892 29522.5 90.6621 7.34197 30000.0 90.6603 7.15894 periodictable-1.5.0/periodictable/xsf/v.nff000066400000000000000000000315141310514471200206730ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.06459 10.1617 -9999. 1.11805 10.3261 -9999. 1.17419 10.4931 -9999. 1.23315 10.6628 -9999. 1.29507 10.8353 -9999. 1.36010 11.0106 -9999. 1.42839 11.1886 -9999. 1.50012 11.3696 -9999. 1.57258 11.5535 -9999. 1.63780 11.7404 -9999. 1.70572 11.9303 -9999. 1.77646 12.1232 -9999. 1.85014 12.3193 -9999. 1.92687 12.5186 -9999. 1.99571 12.7210 -9999. 2.05265 12.9268 -9999. 2.11121 13.1359 -9999. 2.17145 13.3483 -9999. 2.23341 13.5642 -9999. 2.29713 13.7836 -9999. 2.36165 14.0066 -9999. 2.42627 14.2331 -9999. 2.49265 14.4633 -9999. 2.55876 14.6973 -9999. 2.59175 14.9350 -9999. 2.62517 15.1765 -9999. 2.65901 15.4220 -9999. 2.72656 15.6714 -9999. 2.80790 15.9249 -9999. 2.89168 16.1825 -9999. 2.97795 16.4442 -9999. 3.02748 16.7102 -9999. 3.07315 16.9805 -9999. 3.11950 17.2551 -9999. 3.16654 17.5342 -9999. 3.21430 17.8178 -9999. 3.26278 18.1060 -9999. 3.27138 18.3989 -9999. 3.25767 18.6964 -9999. 3.24402 18.9988 -9999. 3.23042 19.3061 -9999. 3.21688 19.6184 -9999. 3.20340 19.9357 -9999. 3.18998 20.2582 -9999. 3.16157 20.5858 -9999. 3.09935 20.9188 -9999. 3.03835 21.2571 -9999. 2.97856 21.6009 -9999. 2.91994 21.9503 -9999. 2.85252 22.3053 -9999. 2.77514 22.6661 -9999. 2.70011 23.0327 -9999. 2.63220 23.4053 -9999. 2.56600 23.7838 -9999. 2.50147 24.1685 -9999. 2.45410 24.5594 -9999. 2.41143 24.9566 -9999. 2.36950 25.3603 -9999. 2.32636 25.7705 -9999. 2.28436 26.1873 -9999. 2.24311 26.6109 -9999. 2.20261 27.0413 -9999. 2.16284 27.4786 -9999. 2.10127 27.9231 -9999. 2.03232 28.3747 -9999. 1.96563 28.8337 -9999. 1.90113 29.3000 5.34593 1.85597 29.7739 5.25702 1.83279 30.2555 5.17173 1.80990 30.7449 5.07046 1.78835 31.2421 4.96377 1.80095 31.7475 4.86692 1.81365 32.2609 4.76006 1.82643 32.7827 4.64394 1.85448 33.3130 4.53278 1.90243 33.8518 4.42660 1.95162 34.3993 4.31744 2.00208 34.9557 4.20105 2.05384 35.5211 4.05589 2.10860 36.0956 3.90249 2.20934 36.6794 3.76549 2.31489 37.2727 3.62047 2.42549 37.8755 3.43543 2.54136 38.4882 3.22796 2.72027 39.1107 3.03960 2.94825 39.7432 2.84620 3.19535 40.3861 2.62105 3.53118 41.0393 2.45167 3.98741 41.7031 2.41724 4.50259 42.3776 2.46188 4.99383 43.0630 2.61901 5.53762 43.7595 2.88305 5.98055 44.4673 3.16390 6.37082 45.1865 3.48900 6.72872 45.9174 3.82533 7.01991 46.6600 4.18153 7.32370 47.4147 4.63608 7.59502 48.1816 5.15312 7.76336 48.9609 5.61764 7.74378 49.7528 5.98795 7.72426 50.5576 6.32329 7.70479 51.3753 6.64216 7.68537 52.2062 6.95383 7.65587 53.0506 7.25710 7.61964 53.9087 7.56202 7.58357 54.7806 7.90577 7.54768 55.6667 8.26579 7.38536 56.5670 8.54688 7.18592 57.4820 8.77045 6.99185 58.4117 8.96621 6.80303 59.3564 9.15533 6.61931 60.3165 9.32005 6.39919 61.2921 9.43236 6.18624 62.2834 9.51170 5.98039 63.2908 9.55780 5.80479 64.3145 9.59663 5.65760 65.3547 9.63381 5.52309 66.4118 9.66939 5.40679 67.4859 9.71030 5.29293 68.5775 9.74740 5.18148 69.6867 9.78008 5.07237 70.8138 9.80759 4.96556 71.9591 9.82938 4.86100 73.1230 9.84564 4.75864 74.3057 9.85380 4.65361 75.5076 9.84883 4.55006 76.7289 9.81599 4.44882 77.9699 9.76180 4.37791 79.2310 9.72161 4.35426 80.5125 9.70329 4.33074 81.8147 9.69256 4.30734 83.1380 9.68539 4.28407 84.4827 9.67917 4.26093 85.8491 9.67205 4.23790 87.2377 9.65019 4.21501 88.6487 9.62458 4.21946 90.0825 9.61894 4.23455 91.5395 9.62209 4.24969 93.0201 9.63112 4.26488 94.5246 9.64460 4.28013 96.0535 9.66165 4.29543 97.6071 9.68165 4.31079 99.1858 9.70413 4.32621 100.790 9.72866 4.34167 102.420 9.75481 4.35720 104.077 9.78221 4.37277 105.760 9.80685 4.38841 107.471 9.83196 4.41221 109.209 9.86498 4.43993 110.975 9.90322 4.46783 112.770 9.94598 4.49590 114.594 9.99333 4.52415 116.448 10.0459 4.55258 118.331 10.1049 4.58118 120.245 10.1805 4.60766 122.190 10.2585 4.60580 124.166 10.3197 4.60394 126.175 10.3791 4.60208 128.215 10.4367 4.60023 130.289 10.4930 4.59837 132.397 10.5487 4.59652 134.538 10.6040 4.59466 136.714 10.6596 4.59275 138.925 10.7150 4.58968 141.172 10.7697 4.58662 143.456 10.8244 4.58356 145.776 10.8793 4.58050 148.134 10.9344 4.57744 150.530 10.9899 4.57438 152.964 11.0462 4.57133 155.439 11.1034 4.56828 157.953 11.1618 4.56523 160.507 11.2222 4.56218 163.103 11.2850 4.55914 165.742 11.3586 4.55609 168.422 11.4339 4.53222 171.146 11.4954 4.50800 173.915 11.5545 4.48391 176.727 11.6115 4.45996 179.586 11.6670 4.43612 182.491 11.7216 4.41242 185.442 11.7757 4.38884 188.442 11.8302 4.36539 191.489 11.8867 4.34207 194.587 11.9496 4.31460 197.734 12.0096 4.27240 200.932 12.0578 4.23059 204.182 12.1025 4.18920 207.485 12.1439 4.14821 210.840 12.1825 4.10762 214.251 12.2185 4.06744 217.716 12.2524 4.02764 221.237 12.2843 3.98823 224.816 12.3143 3.94921 228.452 12.3428 3.91057 232.147 12.3700 3.87231 235.902 12.3967 3.83442 239.717 12.4245 3.79691 243.595 12.4511 3.75039 247.535 12.4708 3.70425 251.538 12.4866 3.65866 255.607 12.4992 3.61365 259.741 12.5088 3.56918 263.942 12.5157 3.52526 268.211 12.5200 3.48188 272.549 12.5217 3.43904 276.957 12.5211 3.39672 281.437 12.5183 3.35492 285.989 12.5138 3.31365 290.615 12.5093 3.27287 295.315 12.5041 3.22483 300.092 12.4909 3.17394 304.945 12.4706 3.12385 309.878 12.4451 3.07454 314.890 12.4146 3.02602 319.983 12.3790 2.97826 325.158 12.3383 2.93126 330.418 12.2925 2.88500 335.762 12.2412 2.83947 341.192 12.1844 2.79466 346.711 12.1218 2.75056 352.319 12.0537 2.70715 358.017 11.9797 2.66177 363.808 11.8963 2.61498 369.692 11.8026 2.56900 375.672 11.6989 2.52384 381.748 11.5844 2.47947 387.922 11.4581 2.43588 394.197 11.3189 2.39306 400.573 11.1652 2.35099 407.052 10.9955 2.30966 413.635 10.8088 2.26906 420.326 10.6004 2.22163 427.124 10.3608 2.17464 434.032 10.0876 2.12864 441.052 9.77452 2.08362 448.186 9.41175 2.03955 455.435 8.98640 1.99770 462.802 8.48336 1.96436 470.287 7.87842 1.93158 477.894 7.12309 1.89934 485.623 6.13361 1.86794 493.478 4.73516 1.84039 501.459 2.43847 1.81326 509.570 -3.72361 1.78653 512.000 -18.0914 1.77867 512.200 -18.0749 15.8717 517.812 0.321069 15.6628 526.187 4.59015 15.3600 534.698 6.85921 15.0633 543.346 8.41194 14.7722 552.134 9.58295 14.4866 561.065 10.4908 14.1915 570.139 11.1288 13.9247 579.361 11.6369 13.8658 588.732 12.1773 13.8610 598.254 12.7201 13.8909 607.930 13.2814 13.9210 617.763 13.8571 13.9511 627.755 14.4884 13.9736 637.908 15.1664 13.9009 648.226 15.8290 13.6893 658.711 16.3808 13.3909 669.365 16.8128 13.0991 680.191 17.1886 12.8422 691.193 17.5478 12.6122 702.372 17.8961 12.3914 713.733 18.2364 12.1551 725.277 18.5471 11.9101 737.008 18.8300 11.6697 748.928 19.0941 11.4339 761.042 19.3418 11.2027 773.351 19.5762 10.9754 785.859 19.7987 10.7472 798.570 20.0049 10.5194 811.486 20.1955 10.2965 824.611 20.3743 10.0786 837.949 20.5431 9.86543 851.502 20.7027 9.65540 865.274 20.8530 9.44854 879.269 20.9942 9.24501 893.491 21.1268 9.04578 907.943 21.2524 8.85086 922.628 21.3737 8.66015 937.551 21.4894 8.46752 952.715 21.5953 8.27764 968.124 21.6937 8.09071 983.783 21.7850 7.90796 999.695 21.8705 7.72935 1015.86 21.9508 7.55481 1032.29 22.0272 7.38414 1048.99 22.1004 7.21460 1065.96 22.1675 7.04604 1083.20 22.2279 6.88141 1100.72 22.2836 6.72063 1118.52 22.3351 6.56361 1136.61 22.3827 6.41028 1155. 22.4268 6.26051 1173.68 22.4676 6.11422 1192.66 22.5054 5.97140 1211.95 22.5407 5.83188 1231.55 22.5740 5.69560 1251.47 22.6055 5.56125 1271.72 22.6344 5.42881 1292.29 22.6602 5.29799 1313.19 22.6825 5.17025 1334.43 22.7024 5.04557 1356.01 22.7199 4.92388 1377.94 22.7355 4.80517 1400.23 22.7493 4.68929 1422.88 22.7615 4.57614 1445.89 22.7726 4.46588 1469.28 22.7829 4.35772 1493.04 22.7928 4.25132 1517.19 22.8013 4.14452 1541.73 22.8058 4.04004 1566.67 22.8084 3.93824 1592.01 22.8095 3.83887 1617.76 22.8090 3.74202 1643.92 22.8072 3.64769 1670.51 22.8044 3.55565 1697.53 22.8006 3.46595 1724.99 22.7961 3.37856 1752.89 22.7912 3.29215 1781.24 22.7847 3.20755 1810.05 22.7769 3.12482 1839.32 22.7680 3.04420 1869.07 22.7581 2.96563 1899.30 22.7474 2.88906 1930.02 22.7359 2.81448 1961.24 22.7237 2.74185 1992.96 22.7108 2.67118 2025.20 22.6976 2.60304 2057.95 22.6847 2.53546 2091.24 22.6708 2.46935 2125.06 22.6562 2.40491 2159.43 22.6410 2.34206 2194.36 22.6253 2.28078 2229.85 22.6091 2.22100 2265.92 22.5924 2.16273 2302.57 22.5754 2.10592 2339.81 22.5579 2.05053 2377.66 22.5400 1.99651 2416.11 22.5217 1.94386 2455.19 22.5031 1.89256 2494.90 22.4841 1.84254 2535.26 22.4647 1.79378 2576.26 22.4450 1.74627 2617.93 22.4249 1.69998 2660.27 22.4045 1.65485 2703.30 22.3838 1.61086 2747.03 22.3627 1.56802 2791.46 22.3413 1.52627 2836.61 22.3195 1.48559 2882.49 22.2974 1.44595 2929.11 22.2749 1.40731 2976.48 22.2519 1.36968 3024.63 22.2286 1.33303 3073.55 22.2048 1.29730 3123.26 22.1805 1.26250 3173.78 22.1558 1.22862 3225.11 22.1306 1.19561 3277.27 22.1048 1.16346 3330.28 22.0783 1.13209 3384.15 22.0512 1.10158 3438.88 22.0235 1.07186 3494.50 21.9949 1.04289 3551.02 21.9655 1.01467 3608.46 21.9352 0.987196 3666.82 21.9038 0.960439 3726.13 21.8714 0.934373 3786.40 21.8377 0.908980 3847.64 21.8026 0.884244 3909.87 21.7659 0.860151 3973.11 21.7275 0.836701 4037.38 21.6872 0.813824 4102.68 21.6447 0.791591 4169.03 21.5997 0.769884 4236.46 21.5517 0.748762 4304.98 21.5005 0.728215 4374.62 21.4455 0.708158 4445.37 21.3859 0.688645 4517.27 21.3210 0.669615 4590.33 21.2497 0.651120 4664.58 21.1706 0.633056 4740.03 21.0819 0.615488 4816.69 20.9811 0.598402 4894.60 20.8645 0.581709 4973.77 20.7269 0.565464 5054.21 20.5597 0.549642 5135.96 20.3484 0.534231 5219.03 20.0652 0.519220 5303.44 19.6446 0.504591 5389.22 18.8588 0.490341 5465. 11.4907 0.478268 5465.20 11.4913 4.00981 5476.39 16.8218 3.99813 5564.97 19.3555 3.90769 5654.98 20.1337 3.81866 5746.44 20.6185 3.73073 5839.39 20.9733 3.64405 5933.83 21.2532 3.55863 6029.81 21.4838 3.47450 6127.33 21.6793 3.39162 6226.44 21.8483 3.31010 6327.15 21.9965 3.22992 6429.48 22.1277 3.15113 6533.48 22.2450 3.07367 6639.15 22.3504 2.99756 6746.54 22.4456 2.92291 6855.65 22.5321 2.84969 6966.54 22.6108 2.77778 7079.22 22.6825 2.70728 7193.72 22.7482 2.63821 7310.07 22.8083 2.57047 7428.31 22.8634 2.50417 7548.45 22.9140 2.43925 7670.54 22.9604 2.37565 7794.61 23.0031 2.31346 7920.68 23.0424 2.25257 8048.79 23.0784 2.19300 8178.98 23.1115 2.13478 8311.26 23.1418 2.07784 8445.69 23.1697 2.02216 8582.29 23.1951 1.96779 8721.11 23.2184 1.91465 8862.16 23.2397 1.86275 9005.50 23.2591 1.81215 9151.16 23.2767 1.76262 9299.17 23.2927 1.71434 9449.58 23.3072 1.66719 9602.42 23.3202 1.62121 9757.73 23.3319 1.57638 9915.55 23.3423 1.53265 10075.9 23.3517 1.48997 10238.9 23.3599 1.44835 10404.5 23.3670 1.40777 10572.8 23.3733 1.36822 10743.8 23.3786 1.32967 10917.6 23.3831 1.29210 11094.2 23.3868 1.25550 11273.6 23.3898 1.21984 11455.9 23.3921 1.18511 11641.2 23.3938 1.15128 11829.5 23.3949 1.11834 12020.8 23.3954 1.08626 12215.3 23.3954 1.05503 12412.8 23.3949 1.02463 12613.6 23.3940 0.995038 12817.6 23.3927 0.966240 13025.0 23.3910 0.938214 13235.6 23.3889 0.910946 13449.7 23.3865 0.884416 13667.2 23.3838 0.858606 13888.3 23.3808 0.833500 14112.9 23.3775 0.809081 14341.2 23.3740 0.785334 14573.1 23.3703 0.762239 14808.9 23.3664 0.739784 15048.4 23.3623 0.717951 15291.8 23.3580 0.696726 15539.1 23.3536 0.676092 15790.4 23.3490 0.656036 16045.8 23.3444 0.636542 16305.4 23.3396 0.617596 16569.1 23.3347 0.599186 16837.1 23.3297 0.581295 17109.4 23.3247 0.563912 17386.1 23.3195 0.547023 17667.4 23.3144 0.530616 17953.1 23.3091 0.514677 18243.5 23.3039 0.499194 18538.6 23.2986 0.484155 18838.4 23.2933 0.469549 19143.1 23.2880 0.455364 19452.7 23.2826 0.441589 19767.4 23.2773 0.428212 20087.1 23.2720 0.415224 20412.0 23.2666 0.402612 20742.1 23.2613 0.390369 21077.6 23.2560 0.378481 21418.5 23.2508 0.366942 21765.0 23.2455 0.355741 22117.0 23.2403 0.344868 22474.7 23.2351 0.334315 22838.2 23.2300 0.324072 23207.6 23.2249 0.314131 23583.0 23.2198 0.304484 23964.4 23.2148 0.295123 24352.0 23.2098 0.286038 24745.9 23.2049 0.277224 25146.2 23.2000 0.268672 25552.9 23.1952 0.260374 25966.2 23.1904 0.252324 26386.1 23.1857 0.244513 26812.9 23.1811 0.236937 27246.6 23.1765 0.229588 27687.3 23.1720 0.222459 28135.1 23.1675 0.215544 28590.2 23.1631 0.208837 29052.6 23.1588 0.202332 29522.5 23.1551 0.196023 30000.0 23.1485 0.189905 periodictable-1.5.0/periodictable/xsf/w.nff000066400000000000000000000327511310514471200207000ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.92551 10.1617 -9999. 2.00949 10.3261 -9999. 2.09714 10.4931 -9999. 2.18428 10.6628 -9999. 2.26758 10.8353 -9999. 2.35405 11.0105 -9999. 2.44381 11.1886 -9999. 2.53700 11.3696 -9999. 2.63375 11.5535 -9999. 2.73418 11.7404 -9999. 2.83098 11.9303 -9999. 2.91021 12.1232 -9999. 2.99166 12.3193 -9999. 3.07538 12.5186 -9999. 3.16145 12.7210 -9999. 3.24993 12.9268 -9999. 3.34088 13.1359 -9999. 3.43438 13.3483 -9999. 3.53050 13.5642 -9999. 3.62930 13.7836 -9999. 3.73087 14.0066 -9999. 3.83529 14.2331 -9999. 3.94262 14.4633 -9999. 4.05296 14.6972 -9999. 4.16638 14.9350 -9999. 4.28299 15.1765 -9999. 4.40285 15.4220 -9999. 4.52607 15.6714 -9999. 4.62574 15.9249 -9999. 4.72544 16.1825 -9999. 4.82729 16.4442 -9999. 4.93134 16.7102 -9999. 5.03762 16.9805 -9999. 5.13464 17.2551 -9999. 5.19247 17.5342 -9999. 5.25095 17.8178 -9999. 5.31009 18.1060 -9999. 5.36990 18.3988 -9999. 5.43038 18.6964 -9999. 5.49155 18.9988 -9999. 5.55246 19.3061 4.00129 5.58231 19.6184 4.12288 5.61231 19.9357 4.24466 5.64248 20.2581 4.37043 5.67280 20.5858 4.50805 5.70330 20.9187 4.67440 5.70668 21.2571 4.82120 5.66079 21.6009 4.93090 5.61526 21.9503 5.02831 5.57010 22.3053 5.09799 5.52580 22.6661 5.16752 5.51456 23.0327 5.25484 5.50333 23.4052 5.34758 5.49213 23.7838 5.48845 5.48096 24.1685 5.63539 5.39196 24.5594 5.72448 5.26256 24.9566 5.77445 5.13626 25.3602 5.78170 5.01653 25.7704 5.77549 4.93120 26.1872 5.77356 4.84732 26.6108 5.76149 4.76486 27.0412 5.73414 4.68381 27.4786 5.69320 4.61317 27.9230 5.65137 4.55793 28.3747 5.60969 4.50335 28.8336 5.57575 4.44943 29.3000 5.54106 4.37495 29.7739 5.47773 4.27388 30.2554 5.38257 4.17515 30.7448 5.25645 4.07870 31.2421 5.09956 3.99287 31.7474 4.92262 3.92770 32.2609 4.72383 3.86360 32.7827 4.48464 3.81322 33.3129 4.22155 3.79419 33.8517 3.93916 3.77526 34.3992 3.59282 3.75642 34.9556 3.16812 3.81788 35.5210 2.73204 3.95432 36.0955 2.27710 4.09564 36.6793 1.66183 4.24200 37.2726 0.928081 4.77751 37.8754 0.337619 5.47293 38.4880 -0.147289 6.34746 39.1106 -0.475361 7.36176 39.7431 -0.835430 8.53814 40.3860 -0.695614 10.4191 41.0392 0.738605 11.8208 41.7029 2.14221 12.0453 42.3774 3.20822 12.2742 43.0629 4.22882 11.8738 43.7594 4.78000 11.3822 44.4671 4.86737 10.5092 45.1864 4.33318 10.3667 45.9172 3.87966 10.3651 46.6599 3.28163 10.7655 47.4146 2.83935 11.5068 48.1815 2.61814 12.5118 48.9608 2.69519 13.7127 49.7527 3.23926 15.0289 50.5574 4.24111 16.2240 51.3751 5.56617 16.8755 52.2061 6.91800 17.2529 53.0505 8.11956 17.1944 53.9085 9.17238 17.1361 54.7804 10.2643 16.9066 55.6665 11.1935 16.4145 56.5668 11.8679 15.9366 57.4817 12.4461 15.4727 58.4115 12.9444 15.0223 59.3562 13.3794 14.5850 60.3163 13.7626 14.1605 61.2918 14.1031 13.7483 62.2832 14.4082 13.3481 63.2906 14.6846 12.9595 64.3142 14.9557 12.5823 65.3545 15.2155 12.1777 66.4115 15.4179 11.7405 67.4857 15.5688 11.3191 68.5772 15.6849 10.9127 69.6864 15.7730 10.5209 70.8135 15.8431 10.1432 71.9588 15.9026 9.77676 73.1227 15.9371 9.36244 74.3054 15.9129 8.96567 75.5072 15.8508 8.58572 76.7285 15.7548 8.22187 77.9695 15.6253 7.87344 79.2306 15.4599 7.53977 80.5121 15.2219 7.22025 81.8143 14.9401 7.01668 83.1376 14.7189 6.83406 84.4823 14.4847 6.65620 85.8487 14.1900 6.48297 87.2373 13.8528 6.41944 88.6483 13.5949 6.39767 90.0821 13.3437 6.37597 91.5391 13.0514 6.35435 93.0197 12.7481 6.46132 94.5242 12.5343 6.57744 96.0530 12.3424 6.69565 97.6066 12.1603 6.81598 99.1853 11.9869 6.95704 100.790 11.8412 7.10582 102.420 11.7088 7.25779 104.076 11.5874 7.41301 105.760 11.4748 7.57154 107.470 11.3687 7.73347 109.208 11.2650 7.89886 110.975 11.1605 8.08209 112.770 11.0730 8.27812 114.594 10.9983 8.47891 116.447 10.9335 8.68457 118.331 10.8776 8.89521 120.245 10.8307 9.11096 122.189 10.7924 9.33195 124.166 10.7632 9.55830 126.174 10.7436 9.79013 128.215 10.7361 10.0276 130.288 10.7438 10.2622 132.396 10.7540 10.4914 134.537 10.7655 10.7258 136.713 10.7827 10.9654 138.924 10.8062 11.2103 141.171 10.8370 11.4608 143.455 10.8760 11.7168 145.775 10.9245 11.9785 148.133 10.9839 12.2461 150.529 11.0586 12.5196 152.963 11.1540 12.7855 155.438 11.2502 13.0416 157.952 11.3488 13.3029 160.506 11.4571 13.5694 163.102 11.5855 13.8412 165.740 11.7297 14.0867 168.421 11.8630 14.3324 171.145 12.0026 14.5824 173.913 12.1614 14.8368 176.726 12.3323 15.0535 179.585 12.4794 15.2684 182.489 12.6209 15.4864 185.441 12.7536 15.7076 188.440 12.8790 15.9487 191.488 13.0221 16.2006 194.585 13.1736 16.4564 197.733 13.3332 16.7162 200.931 13.5019 16.9801 204.181 13.6845 17.2482 207.483 13.8791 17.5039 210.839 14.0698 17.7602 214.249 14.2646 18.0202 217.714 14.4653 18.2840 221.236 14.6727 18.5517 224.814 14.8879 18.8233 228.450 15.1117 19.0988 232.145 15.3452 19.3784 235.900 15.5894 19.6622 239.716 15.8455 19.9500 243.593 16.1154 20.2421 247.533 16.4008 20.5384 251.536 16.7046 20.8391 255.605 17.0307 21.1442 259.739 17.3853 21.4538 263.940 17.7909 21.7678 268.209 18.2760 22.0865 272.547 18.7921 22.1984 276.955 19.2212 22.3010 281.435 19.6185 22.4041 285.987 19.9988 22.5077 290.612 20.3687 22.6118 295.313 20.7328 22.7163 300.089 21.0982 22.8214 304.943 21.4711 22.9157 309.875 21.8288 22.9921 314.887 22.1749 23.0687 319.980 22.5144 23.1456 325.156 22.8494 23.2227 330.415 23.1811 23.3002 335.759 23.5117 23.3778 341.190 23.8444 23.4485 346.708 24.1660 23.5139 352.316 24.4799 23.5795 358.014 24.7860 23.6452 363.805 25.0772 23.7111 369.689 25.3425 23.7820 375.669 25.6139 23.9201 381.745 25.9156 24.0590 387.919 26.2331 24.1987 394.193 26.5627 24.3392 400.569 26.9032 24.4806 407.048 27.2537 24.6228 413.632 27.6111 24.7657 420.322 27.9811 24.9265 427.120 28.3782 25.0905 434.029 28.8020 25.2555 441.049 29.2635 25.4217 448.182 29.7857 25.5890 455.431 30.3544 25.6513 462.797 30.9276 25.6348 470.283 31.4258 25.5791 477.889 31.8900 25.5228 485.619 32.3372 25.4664 493.473 32.7731 25.4104 501.455 33.2037 25.3555 509.565 33.6348 25.2998 517.807 34.0772 25.2376 526.182 34.5210 25.1530 534.693 34.9662 25.0250 543.341 35.3629 24.8763 552.129 35.7322 24.7302 561.060 36.0735 24.5716 570.134 36.3407 24.4232 579.356 36.6067 24.3858 588.726 36.8999 24.3779 598.248 37.2461 24.3889 607.925 37.6284 24.3999 617.757 38.0499 24.4107 627.749 38.5373 24.4150 637.902 39.0700 24.3390 648.220 39.6431 24.1450 658.704 40.0977 23.8749 669.358 40.4841 23.6077 680.185 40.8126 23.3804 691.186 41.1576 23.1836 702.366 41.5200 22.9923 713.726 41.9010 22.7619 725.270 42.2408 22.5057 737.000 42.5579 22.2525 748.921 42.8606 22.0019 761.034 43.1546 21.7535 773.343 43.4424 21.5028 785.851 43.7290 21.2376 798.562 43.9879 20.9614 811.478 44.2286 20.6886 824.603 44.4557 20.4192 837.940 44.6721 20.1532 851.493 44.8784 19.8867 865.265 45.0757 19.6195 879.260 45.2583 19.3523 893.482 45.4295 19.0886 907.933 45.5916 18.8282 922.618 45.7471 18.5711 937.541 45.8934 18.3085 952.705 46.0288 18.0471 968.114 46.1513 17.7871 983.772 46.2639 17.5307 999.684 46.3695 17.2765 1015.85 46.4694 17.0243 1032.28 46.5580 16.7608 1048.98 46.6332 16.4973 1065.95 46.6901 16.2339 1083.19 46.7320 15.9743 1100.71 46.7604 15.7187 1118.51 46.7756 15.4670 1136.60 46.7779 15.2189 1154.98 46.7672 14.9747 1173.67 46.7436 14.7343 1192.65 46.7071 14.4976 1211.94 46.6580 14.2647 1231.54 46.5978 14.0353 1251.46 46.5245 13.8026 1271.70 46.4384 13.5662 1292.27 46.3238 13.3245 1313.17 46.1841 13.0874 1334.41 46.0204 12.8543 1355.99 45.8309 12.6248 1377.93 45.6140 12.3993 1400.21 45.3675 12.1776 1422.86 45.0883 11.9599 1445.87 44.7730 11.7460 1469.26 44.4180 11.5351 1493.02 44.0159 11.3266 1517.17 43.5577 11.1181 1541.71 43.0326 10.9128 1566.65 42.4282 10.7113 1591.99 41.7273 10.5132 1617.74 40.9055 10.3185 1643.90 39.9275 10.1275 1670.49 38.7390 9.93941 1697.51 37.2501 9.75480 1724.97 35.2987 9.57377 1752.87 32.5247 9.39200 1781.22 27.8205 9.21280 1809.10 -5.97426 9.04256 1809.30 -5.97629 27.4052 1810.03 6.32169 27.3945 1839.30 25.3790 26.9707 1869.05 19.7140 26.5534 1871.50 7.04788 26.5197 1871.70 7.08657 39.3036 1899.28 32.6160 38.4902 1930. 37.7974 37.6174 1961.22 41.1784 36.7643 1992.94 43.7143 35.9303 2000. 44.1954 35.7489 2026. 45.7756 35.1030 2052. 47.1073 34.4675 2079. 48.2741 33.8286 2106. 49.2578 33.2094 2134. 50.1068 32.5882 2161. 50.7671 32.0063 2190. 51.2909 31.4014 2218. 51.5653 30.8356 2247. 51.4224 30.2673 2277. 48.9035 29.6974 2280.90 43.2632 29.6246 2281.10 43.2704 34.5246 2306. 52.5275 33.9369 2337. 54.4424 33.2277 2367. 55.6539 32.5634 2398. 56.6138 31.9010 2429. 57.3832 31.2594 2461. 58.0213 30.6189 2493. 58.5109 30.0011 2526. 58.8275 29.3837 2559. 58.6950 28.7879 2574.80 55.8033 28.5096 2575. 55.8065 30.4546 2592. 59.2502 30.1542 2626. 60.3896 29.5680 2660. 61.1071 29.0016 2695. 61.6739 28.4383 2730. 62.1165 27.8922 2766. 62.4375 27.3487 2802. 62.4707 26.8229 2819.50 60.7116 26.5733 2819.70 60.7136 27.7619 2839. 62.9230 27.5031 2876. 63.7200 27.0186 2914. 64.2912 26.5335 2952. 64.7689 26.0625 2990. 65.1894 25.6028 3029. 65.5776 25.1449 3069. 65.9400 24.6872 3109. 66.2712 24.2412 3150. 66.5826 23.7971 3191. 66.8702 23.3661 3232. 67.1358 22.9455 3275. 67.3933 22.5181 3317. 67.6264 22.1119 3361. 67.8527 21.6986 3405. 68.0625 21.2974 3449. 68.2569 20.9068 3494. 68.4415 20.5202 3540. 68.6165 20.1348 3586. 68.7781 19.7614 3633. 68.9312 19.3912 3680. 69.0729 19.0315 3729. 69.2095 18.6681 3777. 69.3333 18.3220 3827. 69.4520 17.9724 3877. 69.5614 17.6336 3927. 69.6626 17.3048 3979. 69.7592 16.9725 4031. 69.8476 16.6503 4083. 69.9285 16.3379 4137. 70.0053 16.0230 4191. 70.0751 15.7178 4245. 70.1386 15.4219 4301. 70.1982 15.1240 4357. 70.2518 14.8352 4414. 70.3006 14.5502 4472. 70.3450 14.2691 4530. 70.3842 13.9965 4589. 70.4192 13.7275 4649. 70.4501 13.4624 4710. 70.4772 13.2011 4771. 70.5000 12.9478 4834. 70.5195 12.6942 4897. 70.5349 12.4483 4961. 70.5469 12.2062 5026. 70.5555 11.9681 5091. 70.5609 11.7372 5158. 70.5631 11.5066 5225. 70.5623 11.2829 5294. 70.5583 11.0598 5363. 70.5515 10.8436 5433. 70.5418 10.6311 5504. 70.5294 10.4222 5576. 70.5143 10.2171 5649. 70.4965 10.0153 5722. 70.4763 9.82006 5797. 70.4533 9.62560 5873. 70.4278 9.43465 5950. 70.3997 9.24739 6027. 70.3696 9.06587 6106. 70.3367 8.88565 6186. 70.3014 8.70859 6267. 70.2637 8.53518 6349. 70.2235 8.36489 6432. 70.1809 8.19820 6516. 70.1358 8.03454 6601. 70.0883 7.87442 6687. 70.0384 7.71749 6774. 69.9860 7.56346 6863. 69.9302 7.41103 6952. 69.8724 7.26330 7043. 69.8112 7.11719 7135. 69.7473 6.97415 7229. 69.6797 6.83259 7323. 69.6096 6.69530 7419. 69.5355 6.55981 7516. 69.4579 6.42691 7614. 69.3765 6.29741 7713. 69.2914 6.17023 7814. 69.2008 6.04476 7916. 69.1058 5.92228 8019. 69.0057 5.80226 8124. 68.8990 5.68369 8230. 68.7860 5.56793 8338. 68.6650 5.45375 8447. 68.5361 5.34204 8557. 68.3982 5.23297 8669. 68.2487 5.12550 8782. 68.0875 5.02065 8897. 67.9109 4.91726 9013. 67.7173 4.81603 9131. 67.5014 4.71652 9250. 67.2597 4.61904 9371. 66.9828 4.52347 9494. 66.6592 4.42916 9618. 66.2737 4.33729 9743. 65.7951 4.24770 9900.58 64.9743 4.14269 10060.7 63.5971 4.04058 10206.7 49.2616 3.95105 10206.9 49.2628 10.1858 10223.4 59.3366 10.1559 10388.8 64.0994 9.86408 10556.8 65.3275 9.58067 10727.6 65.9750 9.30540 10901.1 66.3264 9.03804 11077.4 66.4483 8.77837 11256.6 66.3010 8.52616 11438.6 65.5802 8.28120 11543.9 58.6099 8.14452 11544.1 58.6113 11.4044 11623.6 65.4777 11.2733 11811.7 66.7987 10.9729 12002.7 67.0878 10.6804 12099.7 64.0134 10.5366 12099.9 64.0141 12.0866 12196.8 67.6906 11.9410 12394.1 68.7159 11.6534 12594.6 69.3706 11.3715 12798.3 69.8814 11.0950 13005.3 70.3058 10.8240 13215.6 70.6696 10.5584 13429.4 70.9872 10.2983 13646.6 71.2680 10.0435 13867.3 71.5183 9.79402 14091.6 71.7428 9.54983 14319.5 71.9451 9.31086 14551.1 72.1281 9.07704 14786.5 72.2940 8.84832 15025.6 72.4446 8.62463 15268.7 72.5816 8.40590 15515.6 72.7063 8.19207 15766.6 72.8198 7.98307 16021.6 72.9231 7.77881 16280.7 73.0171 7.57924 16544.1 73.1026 7.38427 16811.6 73.1802 7.19384 17083.6 73.2506 7.00785 17359.9 73.3144 6.82625 17640.6 73.3719 6.64895 17926.0 73.4237 6.47587 18215.9 73.4702 6.30693 18510.5 73.5117 6.14207 18809.9 73.5487 5.98119 19114.2 73.5813 5.82423 19423.3 73.6100 5.67110 19737.5 73.6350 5.52173 20056.7 73.6565 5.37605 20381.1 73.6748 5.23397 20710.8 73.6901 5.09543 21045.7 73.7026 4.96035 21386.1 73.7124 4.82864 21732.0 73.7198 4.70026 22083.5 73.7249 4.57511 22440.7 73.7278 4.45313 22803.7 73.7287 4.33424 23172.5 73.7278 4.21839 23547.3 73.7252 4.10550 23928.2 73.7209 3.99550 24315.2 73.7151 3.88832 24708.5 73.7078 3.78391 25108.1 73.6993 3.68219 25514.2 73.6895 3.58311 25926.9 73.6786 3.48660 26346.2 73.6665 3.39260 26772.4 73.6535 3.30105 27205.4 73.6396 3.21189 27645.4 73.6248 3.12506 28092.6 73.6091 3.04051 28546.9 73.5927 2.95818 29008.7 73.5756 2.87802 29477.9 73.5578 2.79997 29954.6 73.5395 2.72398 30000.0 73.5377 2.71692 periodictable-1.5.0/periodictable/xsf/xe.nff000066400000000000000000000317501310514471200210440ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.312014E-14 10.1617 -9999. 0.317061E-14 10.3261 -9999. 0.322189E-14 10.4931 -9999. 0.327400E-14 10.6628 -9999. 0.332696E-14 10.8353 -9999. 0.338077E-14 11.0106 -9999. 0.343545E-14 11.1886 -9999. 0.349102E-14 11.3696 -9999. 0.354748E-14 11.5535 -9999. 0.360486E-14 11.7404 -9999. 0.366316E-14 11.9303 -9999. 0.372241E-14 12.0000 -9999. 0.374417E-14 12.2000 -9999. 0.307739E-04 12.3193 -9999. 1.78551 12.5186 -9999. 1.86163 12.7210 -9999. 7.89998 12.9268 -9999. 9.28777 13.1359 -9999. 10.1806 13.3483 -9999. 10.8450 13.5642 -9999. 11.4783 13.7836 -9999. 11.9987 14.0066 -9999. 12.5503 14.2331 -9999. 13.1464 14.4633 -9999. 13.3356 14.6973 -9999. 13.4705 14.9350 -9999. 13.6068 15.1765 -9999. 13.7445 15.4220 -9999. 13.7867 15.6714 -9999. 13.6926 15.9249 -9999. 13.5991 16.1825 -9999. 13.5063 16.4442 -9999. 13.4141 16.7102 -9999. 13.2302 16.9805 -9999. 12.9384 17.2551 -9999. 12.6530 17.5342 -9999. 12.3738 17.8178 -9999. 12.1009 18.1060 -9999. 11.8340 18.3989 -9999. 11.5597 18.6964 -9999. 11.2620 18.9988 -9999. 10.9720 19.3061 -9999. 10.6895 19.6184 -9999. 10.4142 19.9357 -9999. 10.1460 20.2582 -9999. 9.88472 20.5858 -9999. 9.63017 20.9188 -9999. 9.38218 21.2571 -9999. 9.14057 21.6009 -9999. 8.90518 21.9503 -9999. 8.65326 22.3053 -9999. 8.24073 22.6661 -9999. 7.84788 23.0327 -9999. 7.47375 23.4053 -9999. 7.11745 23.7838 -9999. 6.77814 24.1685 -9999. 6.45500 24.5594 -9999. 6.14727 24.9566 -9999. 5.85421 25.3603 -9999. 5.57512 25.7705 -9999. 5.30934 26.1873 -9999. 5.05623 26.6109 -9999. 4.81518 27.0413 -9999. 4.58563 27.4786 -9999. 4.35879 27.9231 -9999. 4.14242 28.3747 -9999. 3.93679 28.8337 -9999. 3.74136 29.3000 9.24787 3.55564 29.7739 9.15401 3.37914 30.2555 9.05665 3.21139 30.7449 8.95659 3.05198 31.2421 8.85495 2.90047 31.7475 8.75252 2.75649 32.2609 8.66863 2.61117 32.7827 8.56578 2.44432 33.3130 8.43921 2.28813 33.8518 8.30286 2.14192 34.3993 8.15845 2.00505 34.9557 8.00686 1.87693 35.5211 7.84855 1.75699 36.0956 7.68358 1.64472 36.6794 7.50428 1.53963 37.2727 7.32127 1.45808 37.8755 7.14335 1.38499 38.4882 6.96445 1.31556 39.1107 6.77222 1.24961 39.7432 6.57704 1.20822 40.3861 6.39261 1.17650 41.0393 6.21168 1.14562 41.7031 6.02982 1.11554 42.3776 5.84214 1.08702 43.0630 5.65382 1.06731 43.7595 5.46429 1.04795 44.4673 5.27081 1.02894 45.1865 5.07147 1.01028 45.9174 4.85931 0.991962 46.6600 4.64081 0.985351 47.4147 4.41909 0.980027 48.1816 4.18957 0.974732 48.9609 3.94228 0.970576 49.7528 3.68733 0.979680 50.5576 3.42626 0.988870 51.3753 3.15172 0.998145 52.2062 2.85945 1.01157 53.0506 2.55235 1.02998 53.9087 2.22780 1.04873 54.7806 1.87892 1.06781 55.6667 1.49957 1.09067 56.5670 1.08790 1.11783 57.4820 0.635603 1.14567 58.4117 0.128885 1.17420 59.3564 -0.469527 1.20343 60.3165 -1.17074 1.27189 61.2921 -2.01898 1.35847 62.2834 -3.32953 1.54840 63.2908 -4.78492 2.60003 64.3145 -6.07324 4.36594 65.3547 -4.99111 7.33114 66.4118 -3.14174 7.31205 67.4859 -2.75421 6.32607 68.5775 -3.33890 5.47306 69.6867 -4.96733 5.26332 70.8138 -6.42927 6.13015 71.9591 -7.44364 7.13975 73.1230 -8.36901 8.31560 74.3057 -9.20709 9.68514 75.5076 -9.88767 11.2802 76.7289 -10.2734 12.9916 77.9699 -10.5619 14.7116 79.2310 -10.5638 16.6594 80.5125 -10.3859 18.4108 81.8147 -10.1979 20.2492 83.1380 -9.86862 22.2711 84.4827 -8.89494 24.3769 85.8491 -7.87394 25.9997 87.2377 -6.97134 27.7306 88.6487 -5.91492 29.5766 90.0825 -4.32097 31.5456 91.5395 -2.54196 32.9879 93.0201 -0.817933 34.3950 94.5246 1.09180 35.8621 96.0535 3.61712 37.0881 97.6071 6.04274 37.6383 99.1858 8.20609 38.1965 100.790 10.4756 38.7631 102.420 13.1326 39.1040 104.077 15.6864 38.9448 105.760 18.0665 38.7863 107.471 20.7633 38.6284 109.209 23.4217 37.6772 110.975 25.7865 36.6323 112.770 28.6833 35.6163 114.594 31.1490 33.2117 116.448 32.7183 30.9479 118.331 33.9623 28.8384 120.245 35.1408 26.8726 122.190 36.4739 24.7408 124.166 37.1409 21.9711 126.175 37.2229 19.5113 128.215 37.0163 17.3269 130.289 36.6180 15.3871 132.397 36.0981 13.6645 134.538 35.4897 12.1347 136.714 34.8270 10.7762 138.925 34.1190 9.56974 141.172 33.3983 8.51687 143.456 32.6755 7.58211 145.776 31.9591 6.74997 148.134 31.2477 6.00916 150.530 30.5484 5.34963 152.964 29.8693 4.75853 155.439 29.1829 4.20373 157.953 28.4795 3.71361 160.507 27.7506 3.30996 163.103 27.0554 3.00803 165.742 26.3968 2.73365 168.422 25.7007 2.50814 171.146 25.0692 2.42290 173.915 24.5010 2.34056 176.727 23.9171 2.29085 179.586 23.3883 2.32877 182.491 22.9277 2.36731 185.442 22.4983 2.42192 188.442 22.0995 2.48194 191.489 21.7114 2.54345 194.587 21.3291 2.64107 197.734 20.9806 2.76930 200.932 20.6692 2.90375 204.182 20.3805 3.04473 207.485 20.1117 3.19362 210.840 19.8625 3.35046 214.251 19.6316 3.51500 217.716 19.4184 3.68762 221.237 19.2267 3.86872 224.816 19.0517 4.05053 228.452 18.8896 4.24019 232.147 18.7442 4.43874 235.902 18.6171 4.64658 239.717 18.5106 4.86416 243.595 18.4460 5.09193 247.535 18.4112 5.29354 251.538 18.3738 5.47387 255.607 18.3395 5.66034 259.741 18.3173 5.85316 263.942 18.3114 6.05255 268.211 18.3514 6.25872 272.549 18.4216 6.42272 276.957 18.4756 6.54819 281.437 18.5193 6.67611 285.989 18.5652 6.80654 290.615 18.6195 6.93951 295.315 18.6897 7.07508 300.092 18.8057 7.21331 304.945 18.9234 7.26060 309.878 19.0080 7.29716 314.890 19.0713 7.33392 319.983 19.1248 7.37085 325.158 19.1713 7.40797 330.418 19.2124 7.44529 335.762 19.2493 7.48278 341.192 19.2829 7.52047 346.711 19.3138 7.55835 352.319 19.3426 7.59641 358.017 19.3701 7.63467 363.808 19.3974 7.67313 369.692 19.4263 7.71177 375.672 19.4655 7.75061 381.748 19.5031 7.76071 387.922 19.5253 7.76418 394.197 19.5345 7.76765 400.573 19.5356 7.77112 407.052 19.5294 7.77460 413.635 19.5164 7.77807 420.326 19.4972 7.78154 427.124 19.4722 7.78503 434.032 19.4422 7.78850 441.052 19.4082 7.79198 448.186 19.3783 7.79547 455.435 19.3645 7.78776 462.802 19.3252 7.71960 470.287 19.2438 7.65206 477.894 19.1344 7.58510 485.623 18.9992 7.51873 493.478 18.8383 7.45294 501.459 18.6506 7.38772 509.570 18.4343 7.32308 517.812 18.1867 7.25901 526.187 17.9046 7.19549 534.698 17.5839 7.13252 543.346 17.2149 7.07011 552.134 16.7959 7.01671 561.065 16.3253 6.96779 570.139 15.7908 6.91921 579.361 15.1775 6.87097 588.732 14.4668 6.82307 598.254 13.6367 6.77550 607.930 12.6493 6.72163 617.763 11.4392 6.65668 627.755 9.91544 6.59235 637.908 7.92458 6.52865 648.226 5.15405 6.46555 658.711 0.823389 6.40307 669.365 -8.21883 6.34119 676.300 -53.1265 6.30176 676.500 -53.0765 40.0443 680.191 -13.5912 39.7162 691.193 1.88287 38.7644 702.372 8.50978 37.8355 713.733 12.8348 36.9287 725.277 16.0447 36.0437 737.008 18.5805 35.1800 748.928 20.6559 34.3369 761.042 22.3906 33.5140 773.351 23.8460 32.7108 785.859 25.0739 31.9493 798.570 26.1402 31.2468 811.486 27.0729 30.5598 824.611 27.8731 29.8878 837.949 28.5435 29.2306 851.502 29.0794 28.5879 865.274 29.4623 27.9593 879.269 29.6403 27.3445 893.491 29.3691 26.7433 907.943 28.8453 27.1220 922.628 28.8239 27.9663 937.551 29.3445 28.8369 952.715 30.2131 29.7346 968.124 31.8753 30.4358 983.783 33.5306 29.9975 999.695 34.5075 29.5656 1015.86 35.3891 29.1399 1032.29 36.1745 28.7203 1048.99 36.8886 28.3081 1065.96 37.5503 27.9085 1083.20 38.1725 27.5145 1100.72 38.7608 27.1261 1118.52 39.3204 26.7430 1136.61 39.8555 26.3655 1155. 40.3704 25.9932 1173.68 40.8685 25.6260 1192.66 41.3542 25.2644 1211.95 41.8336 24.9077 1231.55 42.3199 24.5560 1251.47 42.8247 24.1689 1271.72 43.3132 23.7415 1292.29 43.7480 23.2653 1313.19 44.1298 22.7985 1334.43 44.4783 22.3412 1356.01 44.7999 21.8932 1377.94 45.0988 21.4540 1400.23 45.3774 21.0235 1422.88 45.6376 20.6017 1445.89 45.8813 20.1883 1469.28 46.1096 19.7834 1493.04 46.3237 19.3868 1517.19 46.5250 18.9992 1541.73 46.7150 18.6195 1566.67 46.8945 18.2476 1592.01 47.0641 17.8828 1617.76 47.2240 17.5254 1643.92 47.3755 17.1753 1670.51 47.5192 16.8318 1697.53 47.6555 16.4953 1724.99 47.7891 16.1656 1752.89 47.9166 15.8343 1781.24 48.0323 15.5070 1810.05 48.1391 15.1843 1839.32 48.2365 14.8680 1869.07 48.3262 14.5584 1899.30 48.4094 14.2557 1930.02 48.4866 13.9588 1961.24 48.5576 13.6681 1992.96 48.6218 13.3835 2025.20 48.6862 13.1109 2057.95 48.7501 12.8333 2091.24 48.8033 12.5599 2125.06 48.8512 12.2914 2159.43 48.8936 12.0278 2194.36 48.9308 11.7689 2229.85 48.9633 11.5149 2265.92 48.9913 11.2654 2302.57 49.0146 11.0201 2339.81 49.0333 10.7797 2377.66 49.0480 10.5433 2416.11 49.0581 10.3112 2455.19 49.0642 10.0837 2494.90 49.0663 9.85962 2535.26 49.0639 9.64058 2576.26 49.0580 9.42503 2617.93 49.0477 9.21347 2660.27 49.0335 9.00620 2703.30 49.0155 8.80231 2747.03 48.9935 8.60254 2791.46 48.9675 8.40617 2836.61 48.9373 8.21365 2882.49 48.9032 8.02469 2929.11 48.8648 7.83922 2976.48 48.8221 7.65729 3024.63 48.7751 7.47879 3073.55 48.7236 7.30363 3123.26 48.6674 7.13165 3173.78 48.6062 6.96295 3225.11 48.5400 6.79748 3277.27 48.4683 6.63504 3330.28 48.3909 6.47567 3384.15 48.3073 6.31930 3438.88 48.2172 6.16590 3494.50 48.1200 6.01544 3551.02 48.0151 5.86774 3608.46 47.9017 5.72276 3666.82 47.7789 5.58056 3726.13 47.6459 5.44120 3786.40 47.5013 5.30424 3847.64 47.3434 5.16996 3909.87 47.1705 5.03820 3973.11 46.9802 4.90890 4037.38 46.7695 4.78203 4102.68 46.5345 4.65756 4169.03 46.2700 4.53550 4236.46 45.9693 4.41575 4304.98 45.6222 4.29816 4374.62 45.2140 4.18271 4445.37 44.7217 4.06953 4517.27 44.1057 3.95854 4590.33 43.2884 3.84952 4664.58 42.0783 3.74260 4740.03 39.6979 3.63771 4787.10 24.7370 3.57457 4787.30 24.7388 11.2300 4816.69 38.5346 11.1152 4894.60 41.4727 10.8198 4973.77 42.3694 10.5324 5054.21 42.2444 10.2525 5107.10 35.5416 10.0749 5107.30 35.5459 13.7396 5135.96 42.2243 13.6172 5219.03 44.2811 13.2720 5303.44 45.2083 12.9357 5389.22 45.6040 12.6079 5452.70 42.4369 12.3739 5452.90 42.4412 14.2726 5476.39 45.7152 14.1809 5564.97 47.2510 13.8442 5654.98 48.1223 13.5140 5746.44 48.7967 13.1897 5839.39 49.3585 12.8715 5933.83 49.8423 12.5592 6029.81 50.2667 12.2530 6127.33 50.6436 11.9527 6226.44 50.9812 11.6584 6327.15 51.2854 11.3700 6429.48 51.5609 11.0876 6533.48 51.8112 10.8106 6639.15 52.0390 10.5397 6746.54 52.2471 10.2746 6855.65 52.4372 10.0151 6966.54 52.6112 9.76125 7079.22 52.7706 9.51281 7193.72 52.9165 9.26990 7310.07 53.0501 9.03234 7428.31 53.1725 8.80037 7548.45 53.2846 8.57347 7670.54 53.3871 8.35171 7794.61 53.4806 8.13507 7920.68 53.5660 7.92366 8048.79 53.6438 7.71695 8178.98 53.7145 7.51516 8311.26 53.7786 7.31810 8445.69 53.8364 7.12583 8582.29 53.8887 6.93824 8721.11 53.9356 6.75508 8862.16 53.9776 6.57633 9005.50 54.0148 6.40187 9151.16 54.0477 6.23183 9299.17 54.0765 6.06593 9449.58 54.1015 5.90408 9602.42 54.1229 5.74633 9757.73 54.1409 5.59257 9915.55 54.1559 5.44270 10075.9 54.1681 5.29650 10238.9 54.1775 5.15401 10404.5 54.1843 5.01514 10572.8 54.1888 4.87979 10743.8 54.1910 4.74792 10917.6 54.1911 4.61942 11094.2 54.1892 4.49423 11273.6 54.1856 4.37228 11455.9 54.1802 4.25349 11641.2 54.1732 4.13778 11829.5 54.1648 4.02508 12020.8 54.1549 3.91534 12215.3 54.1438 3.80846 12412.8 54.1315 3.70439 12613.6 54.1180 3.60307 12817.6 54.1035 3.50441 13025.0 54.0880 3.40837 13235.6 54.0716 3.31487 13449.7 54.0543 3.22386 13667.2 54.0363 3.13527 13888.3 54.0175 3.04904 14112.9 53.9980 2.96511 14341.2 53.9779 2.88344 14573.1 53.9572 2.80395 14808.9 53.9360 2.72660 15048.4 53.9142 2.65133 15291.8 53.8919 2.57808 15539.1 53.8692 2.50682 15790.4 53.8461 2.43748 16045.8 53.8225 2.37001 16305.4 53.7986 2.30437 16569.1 53.7743 2.24052 16837.1 53.7497 2.17840 17109.4 53.7247 2.11796 17386.1 53.6995 2.05918 17667.4 53.6739 2.00199 17953.1 53.6480 1.94636 18243.5 53.6218 1.89225 18538.6 53.5952 1.83962 18838.4 53.5684 1.78843 19143.1 53.5413 1.73864 19452.7 53.5138 1.69021 19767.4 53.4861 1.64311 20087.1 53.4579 1.59730 20412.0 53.4294 1.55275 20742.1 53.4005 1.50942 21077.6 53.3711 1.46727 21418.5 53.3413 1.42629 21765.0 53.3110 1.38643 22117.0 53.2801 1.34767 22474.7 53.2486 1.30998 22838.2 53.2165 1.27332 23207.6 53.1836 1.23767 23583.0 53.1499 1.20300 23964.4 53.1153 1.16929 24352.0 53.0796 1.13650 24745.9 53.0428 1.10462 25146.2 53.0047 1.07361 25552.9 52.9651 1.04346 25966.2 52.9238 1.01414 26386.1 52.8805 0.985625 26812.9 52.8350 0.957896 27246.6 52.7870 0.930929 27687.3 52.7358 0.904706 28135.1 52.6812 0.879202 28590.2 52.6223 0.854402 29052.6 52.5584 0.830283 29522.5 52.4904 0.806827 30000.0 52.4028 0.784016 periodictable-1.5.0/periodictable/xsf/y.nff000066400000000000000000000316321310514471200206770ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 1.91773 10.1617 -9999. 1.94593 10.3261 -9999. 1.97456 10.4931 -9999. 2.00360 10.6628 -9999. 2.03307 10.8353 -9999. 2.06298 11.0106 -9999. 2.08995 11.1886 -9999. 2.09147 11.3696 -9999. 2.09299 11.5535 -9999. 2.09452 11.7404 -9999. 2.09604 11.9303 -9999. 2.09757 12.1232 -9999. 2.09910 12.3193 -9999. 2.07380 12.5186 -9999. 2.04269 12.7210 -9999. 2.01204 12.9268 -9999. 1.98186 13.1359 -9999. 1.95212 13.3483 -9999. 1.92283 13.5642 -9999. 1.89326 13.7836 -9999. 1.82864 14.0066 -9999. 1.76622 14.2331 -9999. 1.70594 14.4633 -9999. 1.64771 14.6973 -9999. 1.58943 14.9350 -9999. 1.53225 15.1765 -9999. 1.47713 15.4220 -9999. 1.42399 15.6714 -9999. 1.37276 15.9249 -9999. 1.32265 16.1825 -9999. 1.27374 16.4442 -9999. 1.22665 16.7102 -9999. 1.18129 16.9805 -9999. 1.13761 17.2551 -9999. 1.10152 17.5342 -9999. 1.07044 17.8178 -9999. 1.04024 18.1060 -9999. 1.01089 18.3989 -9999. 0.982368 18.6964 -9999. 0.954653 18.9988 -9999. 0.942543 19.3061 -9999. 0.937272 19.6184 -9999. 0.932031 19.9357 -9999. 0.926820 20.2582 -9999. 0.921637 20.5858 -9999. 0.922103 20.9188 -9999. 0.936428 21.2571 -9999. 0.950975 21.6009 -9999. 0.965748 21.9503 -9999. 0.987730 22.3053 -9999. 1.02598 22.6661 -9999. 1.06571 23.0327 -9999. 1.10698 23.4053 -9999. 1.15127 23.7838 -9999. 1.23259 24.1685 -9999. 1.31966 24.5594 -9999. 1.41288 24.9566 -9999. 1.51268 25.3603 -9999. 1.65754 25.7705 -9999. 1.93279 26.1873 -9999. 2.25377 26.6109 -9999. 2.62804 27.0413 -9999. 3.30060 27.4786 -9999. 4.83125 27.9231 -9999. 7.07175 28.3747 -9999. 10.3513 28.8337 -9999. 14.3124 29.3000 -5.81131 15.2941 29.7739 -4.33537 16.3432 30.2555 -2.91511 17.4642 30.7449 -1.09221 18.2054 31.2421 0.362823 18.5804 31.7475 1.73328 18.9631 32.2609 3.19011 19.3538 32.7827 4.75193 19.3689 33.3130 6.09217 19.2585 33.8518 7.42152 19.1487 34.3993 8.94012 18.9752 34.9557 10.2630 18.1654 35.5211 11.2402 17.3902 36.0956 12.0398 16.6480 36.6794 12.7167 15.9376 37.2727 13.3002 15.2574 37.8755 13.8095 14.6063 38.4882 14.2590 13.9830 39.1107 14.6605 13.3863 39.7432 15.0245 12.8150 40.3861 15.3620 12.2681 41.0393 15.6867 11.7446 41.7031 16.0259 11.2434 42.3776 16.4604 10.7039 43.0630 16.7656 9.92317 43.7595 16.9142 9.19944 44.4673 16.9731 8.52848 45.1865 16.9764 7.90646 45.9174 16.9383 7.32981 46.6600 16.8684 6.79521 47.4147 16.7738 6.29961 48.1816 16.6598 5.84014 48.9609 16.5309 5.41421 49.7528 16.3904 5.01931 50.5576 16.2413 4.65324 51.3753 16.0863 4.31385 52.2062 15.9287 3.99923 53.0506 15.7749 3.70474 53.9087 15.6115 3.41263 54.7806 15.4366 3.14356 55.6667 15.2555 2.89569 56.5670 15.0712 2.66738 57.4820 14.8850 2.45706 58.4117 14.6976 2.26333 59.3564 14.5090 2.08488 60.3165 14.3187 1.92049 61.2921 14.1240 1.76906 62.2834 13.9138 1.64162 63.2908 13.7254 1.55336 64.3145 13.5542 1.46983 65.3547 13.3930 1.39080 66.4118 13.2381 1.31602 67.4859 13.0874 1.24525 68.5775 12.9395 1.17830 69.6867 12.7928 1.11494 70.8138 12.6433 1.05499 71.9591 12.4902 1.01148 73.1230 12.3483 0.976329 74.3057 12.2124 0.942397 75.5076 12.0764 0.909647 76.7289 11.9309 0.881537 77.9699 11.7946 0.877539 79.2310 11.6706 0.873560 80.5125 11.5522 0.869598 81.8147 11.4370 0.865655 83.1380 11.3231 0.861730 84.4827 11.2069 0.857822 85.8491 11.0864 0.864246 87.2377 10.9755 0.878229 88.6487 10.8698 0.892439 90.0825 10.7671 0.906879 91.5395 10.6664 0.921552 93.0201 10.5667 0.936463 94.5246 10.4668 0.951615 96.0535 10.3651 0.970106 97.6071 10.2665 0.991478 99.1858 10.1698 1.01332 100.790 10.0739 1.03565 102.420 9.97899 1.05846 104.077 9.88635 1.08108 105.760 9.79160 1.09817 107.471 9.69320 1.11553 109.209 9.59148 1.13316 110.975 9.48646 1.15107 112.770 9.37724 1.16950 114.594 9.26462 1.18957 116.448 9.14829 1.20998 118.331 9.02732 1.23074 120.245 8.90084 1.25186 122.190 8.76750 1.27334 124.166 8.62502 1.29756 126.175 8.47683 1.32478 128.215 8.32065 1.35258 130.289 8.15178 1.38153 132.397 7.97311 1.41935 134.538 7.78327 1.45820 136.714 7.57191 1.49812 138.925 7.34255 1.56207 141.172 7.10432 1.63525 143.456 6.83081 1.72469 145.776 6.55359 1.86657 148.134 6.32371 2.05420 150.530 6.11114 2.19636 152.964 5.87024 2.29515 155.439 5.54845 2.38907 157.953 5.16028 2.55826 160.507 4.75829 2.80212 163.103 4.34515 3.08702 165.742 3.86740 3.47201 168.422 3.45308 3.98833 171.146 3.13702 4.57353 173.915 2.85995 5.16459 176.727 2.62273 5.83202 179.586 2.50523 6.58572 182.491 2.46748 7.24273 185.442 2.45511 7.94585 188.442 2.53544 8.71724 191.489 2.82368 9.41805 194.587 3.07377 9.97403 197.734 3.31658 10.5119 200.932 3.59031 11.0702 204.182 4.00603 11.5651 207.485 4.32951 11.9037 210.840 4.59975 12.2521 214.251 4.85185 12.6108 217.716 5.10083 12.9799 221.237 5.35835 13.3599 224.816 5.64865 13.7484 228.452 5.94021 14.0861 232.147 6.22556 14.4322 235.902 6.51712 14.7867 239.717 6.83829 15.1499 243.595 7.19041 15.4625 247.535 7.51985 15.7510 251.538 7.83364 16.0449 255.607 8.14976 16.3443 259.741 8.48081 16.6485 263.942 8.81499 16.9372 268.211 9.14971 17.2309 272.549 9.49260 17.5297 276.957 9.84803 17.8337 281.437 10.2212 18.1429 285.989 10.6383 18.4547 290.615 11.0614 18.7182 295.315 11.4812 18.9854 300.092 11.9151 19.2565 304.945 12.3785 19.5314 309.878 12.9082 19.7745 314.890 13.4052 19.9436 319.983 13.8835 20.1140 325.158 14.3605 20.2859 330.418 14.8441 20.4593 335.762 15.3409 20.6342 341.192 15.8581 20.8106 346.711 16.4535 20.9667 352.319 17.0262 21.0384 358.017 17.5702 21.1104 363.808 18.1182 21.1827 369.692 18.6803 21.2551 375.672 19.2673 21.3279 381.748 19.9808 21.3658 387.922 20.6426 21.2475 394.197 21.2373 21.1299 400.573 21.8245 21.0130 407.052 22.4716 20.8967 413.635 23.1403 20.6341 420.326 23.6932 20.2882 427.124 24.1712 19.9481 434.032 24.6012 19.6137 441.052 24.9932 19.2849 448.186 25.3528 18.9617 455.435 25.6829 18.6438 462.802 25.9690 18.3313 470.287 26.2407 18.0647 477.894 26.5150 17.8055 485.623 26.7830 17.5500 493.478 27.0431 17.2982 501.459 27.2950 17.0500 509.570 27.5391 16.8053 517.812 27.7760 16.5642 526.187 28.0067 16.3265 534.698 28.2350 16.0923 543.346 28.4544 15.8501 552.134 28.6635 15.6116 561.065 28.8639 15.3766 570.139 29.0573 15.1453 579.361 29.2445 14.9174 588.732 29.4262 14.6929 598.254 29.6032 14.4718 607.930 29.7762 14.2540 617.763 29.9462 14.0395 627.755 30.1143 13.8282 637.908 30.2823 13.6202 648.226 30.4512 13.4152 658.711 30.6555 13.2036 669.365 30.8356 12.9426 680.191 30.9810 12.6867 691.193 31.1121 12.4359 702.372 31.2316 12.1900 713.733 31.3413 11.9490 725.277 31.4425 11.7128 737.008 31.5361 11.4812 748.928 31.6228 11.2542 761.042 31.7032 11.0317 773.351 31.7778 10.8136 785.859 31.8470 10.6000 798.570 31.9115 10.3907 811.486 31.9714 10.1856 824.611 32.0273 9.98451 837.949 32.0795 9.78739 851.502 32.1282 9.59417 865.274 32.1740 9.40476 879.269 32.2176 9.21909 893.491 32.2594 9.03709 907.943 32.3080 8.85868 922.628 32.3539 8.66626 937.551 32.3856 8.47165 952.715 32.4079 8.28141 968.124 32.4233 8.09544 983.783 32.4328 7.91365 999.695 32.4369 7.73593 1015.86 32.4360 7.56222 1032.29 32.4302 7.39240 1048.99 32.4193 7.22179 1065.96 32.4014 7.06587 1083.20 32.3815 6.91330 1100.72 32.3608 6.76403 1118.52 32.3375 6.61799 1136.61 32.3113 6.47510 1155. 32.2822 6.33529 1173.68 32.2499 6.19850 1192.66 32.2146 6.06467 1211.95 32.1759 5.93372 1231.55 32.1340 5.80561 1251.47 32.0885 5.68025 1271.72 32.0395 5.55761 1292.29 31.9867 5.43761 1313.19 31.9300 5.32021 1334.43 31.8692 5.20534 1356.01 31.8041 5.09295 1377.94 31.7342 4.98299 1400.23 31.6594 4.87539 1422.88 31.5792 4.77013 1445.89 31.4931 4.66713 1469.28 31.4004 4.56636 1493.04 31.2998 4.46777 1517.19 31.1896 4.37444 1541.73 31.0740 4.28732 1566.67 30.9531 4.20193 1592.01 30.8238 4.11824 1617.76 30.6848 4.03622 1643.92 30.5345 3.95583 1670.51 30.3711 3.87704 1697.53 30.1924 3.79982 1724.99 29.9958 3.72414 1752.89 29.7781 3.64997 1781.24 29.5350 3.57727 1810.05 29.2608 3.50602 1839.32 28.9523 3.43619 1869.07 28.5942 3.35901 1899.30 28.1623 3.27801 1930.02 27.6327 3.19896 1961.24 26.9634 3.12181 1992.96 26.0698 3.04653 2025.20 24.7492 2.97306 2057.95 22.2099 2.90137 2079.90 7.98032 2.85492 2080.10 7.98382 11.1239 2091.24 20.3061 10.9941 2125.06 23.2493 10.6130 2155.40 18.1013 10.2874 2155.60 18.1127 14.0289 2159.43 22.3519 14.0069 2194.36 25.9700 13.8098 2229.85 27.4629 13.6156 2265.92 28.5215 13.4240 2302.57 29.3144 13.1476 2339.81 29.7635 12.8233 2372.40 27.7086 12.5501 2372.60 27.7169 14.1143 2377.66 29.5078 14.0784 2416.11 31.0850 13.8104 2455.19 31.9055 13.5475 2494.90 32.5559 13.2896 2535.26 33.1126 13.0367 2576.26 33.6054 12.7885 2617.93 34.0506 12.5451 2660.27 34.4590 12.3063 2703.30 34.8386 12.0720 2747.03 35.1952 11.8422 2791.46 35.5539 11.6168 2836.61 35.9049 11.3588 2882.49 36.2085 11.0670 2929.11 36.4707 10.7827 2976.48 36.7046 10.5058 3024.63 36.9155 10.2359 3073.55 37.1066 9.97297 3123.26 37.2803 9.71678 3173.78 37.4384 9.46718 3225.11 37.5824 9.22400 3277.27 37.7130 8.98707 3330.28 37.8300 8.75619 3384.15 37.9362 8.53690 3438.88 38.0358 8.32518 3494.50 38.1294 8.11869 3551.02 38.2163 7.91736 3608.46 38.2969 7.72099 3666.82 38.3718 7.52950 3726.13 38.4416 7.34276 3786.40 38.5081 7.16064 3847.64 38.5712 6.97781 3909.87 38.6261 6.79509 3973.11 38.6717 6.61716 4037.38 38.7106 6.44388 4102.68 38.7425 6.27517 4169.03 38.7635 6.11086 4236.46 38.7817 5.96692 4304.98 38.8043 5.82638 4374.62 38.8269 5.68915 4445.37 38.8487 5.55515 4517.27 38.8695 5.42429 4590.33 38.8892 5.29653 4664.58 38.9080 5.17178 4740.03 38.9261 5.04996 4816.69 38.9442 4.93102 4894.60 38.9643 4.81486 4973.77 38.9854 4.69328 5054.21 39.0006 4.57003 5135.96 39.0096 4.45001 5219.03 39.0157 4.33313 5303.44 39.0192 4.21934 5389.22 39.0205 4.10853 5476.39 39.0199 4.00062 5564.97 39.0175 3.89556 5654.98 39.0136 3.79325 5746.44 39.0082 3.69363 5839.39 39.0016 3.59663 5933.83 38.9938 3.50217 6029.81 38.9849 3.41020 6127.33 38.9751 3.32064 6226.44 38.9643 3.23343 6327.15 38.9528 3.14852 6429.48 38.9405 3.06583 6533.48 38.9277 2.98531 6639.15 38.9143 2.90651 6746.54 38.9000 2.82978 6855.65 38.8851 2.75509 6966.54 38.8697 2.68236 7079.22 38.8539 2.61155 7193.72 38.8376 2.54261 7310.07 38.8210 2.47549 7428.31 38.8041 2.41015 7548.45 38.7871 2.34653 7670.54 38.7699 2.28459 7794.61 38.7529 2.22428 7920.68 38.7361 2.16557 8048.79 38.7215 2.10841 8178.98 38.7081 2.04884 8311.26 38.6912 1.98689 8445.69 38.6714 1.92681 8582.29 38.6499 1.86854 8721.11 38.6271 1.81204 8862.16 38.6031 1.75725 9005.50 38.5783 1.70412 9151.16 38.5525 1.65258 9299.17 38.5258 1.60262 9449.58 38.4983 1.55415 9602.42 38.4699 1.50716 9757.73 38.4398 1.46159 9915.55 38.4085 1.41895 10075.9 38.3778 1.37929 10238.9 38.3476 1.34073 10404.5 38.3173 1.30324 10572.8 38.2867 1.26678 10743.8 38.2558 1.23133 10917.6 38.2243 1.19687 11094.2 38.1923 1.16336 11273.6 38.1596 1.13079 11455.9 38.1260 1.09912 11641.2 38.0916 1.06833 11829.5 38.0562 1.03839 12020.8 38.0196 1.00929 12215.3 37.9818 0.981004 12412.8 37.9424 0.953504 12613.6 37.9014 0.926771 12817.6 37.8585 0.900784 13025.0 37.8134 0.875521 13235.6 37.7657 0.850965 13449.7 37.7151 0.827094 13667.2 37.6611 0.803890 13888.3 37.6031 0.781334 14112.9 37.5402 0.759408 14341.2 37.4716 0.738096 14573.1 37.3959 0.717378 14808.9 37.3113 0.697241 15048.4 37.2156 0.677666 15291.8 37.1053 0.658639 15539.1 36.9754 0.640144 15790.4 36.8176 0.622165 16045.8 36.6180 0.604690 16305.4 36.3486 0.587703 16569.1 35.9421 0.571190 16837.1 35.1423 0.555139 17038.3 27.4822 0.543547 17038.5 27.4824 3.73384 17109.4 34.1839 3.71062 17386.1 35.8664 3.62228 17667.4 36.5150 3.53536 17953.1 36.9304 3.44989 18243.5 37.2372 3.36588 18538.6 37.4801 3.28334 18838.4 37.6803 3.20228 19143.1 37.8499 3.12271 19452.7 37.9963 3.04464 19767.4 38.1243 2.96805 20087.1 38.2374 2.89296 20412.0 38.3381 2.81936 20742.1 38.4284 2.74724 21077.6 38.5096 2.67659 21418.5 38.5831 2.60741 21765.0 38.6497 2.53969 22117.0 38.7102 2.47341 22474.7 38.7653 2.40857 22838.2 38.8155 2.34514 23207.6 38.8614 2.28312 23583.0 38.9032 2.22248 23964.4 38.9415 2.16321 24352.0 38.9765 2.10530 24745.9 39.0084 2.04872 25146.2 39.0375 1.99345 25552.9 39.0641 1.93948 25966.2 39.0883 1.88679 26386.1 39.1104 1.83536 26812.9 39.1304 1.78516 27246.6 39.1486 1.73617 27687.3 39.1650 1.68839 28135.1 39.1798 1.64177 28590.2 39.1931 1.59631 29052.6 39.2050 1.55197 29522.5 39.2156 1.50875 30000.0 39.2250 1.46662 periodictable-1.5.0/periodictable/xsf/yb.nff000066400000000000000000000321051310514471200210350ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 0.217342 10.1617 -9999. 0.218636 10.3261 -9999. 0.219937 10.4931 -9999. 0.221246 10.6628 -9999. 0.222563 10.8353 -9999. 0.223887 11.0106 -9999. 0.225220 11.1886 -9999. 0.226560 11.3696 -9999. 0.228863 11.5535 -9999. 0.233785 11.7404 -9999. 0.238813 11.9303 -9999. 0.243949 12.1232 -9999. 0.249195 12.3193 -9999. 0.255924 12.5186 -9999. 0.264222 12.7210 -9999. 0.272790 12.9268 -9999. 0.281636 13.1359 -9999. 0.290768 13.3483 -9999. 0.300196 13.5642 -9999. 0.309930 13.7836 -9999. 0.319980 14.0066 -9999. 0.330356 14.2331 -9999. 0.340404 14.4633 -9999. 0.350428 14.6973 -9999. 0.360747 14.9350 -9999. 0.371369 15.1765 -9999. 0.382305 15.4220 -9999. 0.393563 15.6714 -9999. 0.405092 15.9249 -9999. 0.416304 16.1825 -9999. 0.427825 16.4442 -9999. 0.439666 16.7102 -9999. 0.451834 16.9805 -9999. 0.464340 17.2551 -9999. 0.477190 17.5342 -9999. 0.490641 17.8178 -9999. 0.504601 18.1060 -9999. 0.518958 18.3989 -9999. 0.533723 18.6964 -9999. 0.548909 18.9988 -9999. 0.564527 19.3061 -9999. 0.580206 19.6184 -9999. 0.592067 19.9357 -9999. 0.604170 20.2582 -9999. 0.616521 20.5858 -9999. 0.629124 20.9188 -9999. 0.641985 21.2571 -9999. 0.655109 21.6009 -9999. 0.671889 21.9503 -9999. 0.691055 22.3053 -9999. 0.710768 22.6661 -9999. 0.731122 23.0327 -9999. 0.753819 23.4053 -9999. 0.777220 23.7838 -9999. 0.801348 24.1685 -9999. 0.858733 24.5594 -9999. 0.942698 24.9566 -9999. 1.04941 25.3603 -9999. 1.19421 25.7705 -9999. 1.35899 26.1873 -9999. 1.87353 26.6109 -9999. 2.26245 27.0413 -9999. 3.32280 27.4786 -9999. 4.88216 27.9231 -9999. 6.60420 28.3747 -9999. 8.21357 28.8337 -9999. 9.79776 29.3000 -7.21765 10.9300 29.7739 -6.31581 11.4763 30.2555 -5.62496 12.0459 30.7449 -4.91262 12.6379 31.2421 -4.17366 13.1291 31.7475 -3.40908 13.6321 32.2609 -2.57554 14.0106 32.7827 -1.68872 14.3371 33.3130 -0.753729 14.4480 33.8518 0.553145E-01 14.4160 34.3993 0.803437 14.3264 34.9557 1.40798 14.0979 35.5211 1.88638 13.9801 36.0956 2.40036 13.8724 36.6794 2.89561 13.7401 37.2727 3.36949 13.5908 37.8755 3.84796 13.4360 38.4882 4.29509 13.1244 39.1107 4.62161 12.8200 39.7432 4.83909 12.5226 40.3861 4.99178 12.3279 41.0393 5.19168 12.1784 41.7031 5.40153 12.0307 42.3776 5.62132 11.8556 43.0630 5.80016 11.6363 43.7595 5.90350 11.4364 44.4673 5.98688 11.2962 45.1865 6.08046 11.1576 45.9174 6.14512 11.0208 46.6600 6.18050 10.9407 47.4147 6.24312 10.8850 48.1816 6.31779 10.8295 48.9609 6.39083 10.7743 49.7528 6.45032 10.7208 50.5576 6.50755 10.7024 51.3753 6.58577 10.6840 52.2062 6.66766 10.6656 53.0506 6.75706 10.6473 53.9087 6.84959 10.6172 54.7806 6.92873 10.5790 55.6667 6.99692 10.5409 56.5670 7.03893 10.5030 57.4820 7.06138 10.5007 58.4117 7.11139 10.5323 59.3564 7.18152 10.5639 60.3165 7.27755 10.5956 61.2921 7.38628 10.5865 62.2834 7.46321 10.5709 63.2908 7.52990 10.5553 64.3145 7.58340 10.5473 65.3547 7.63544 10.5515 66.4118 7.69063 10.5558 67.4859 7.74192 10.5571 68.5775 7.78038 10.5515 69.6867 7.79514 10.5459 70.8138 7.74345 10.5410 71.9591 7.68596 10.7236 73.1230 7.76202 10.9094 74.3057 7.92332 11.0983 75.5076 8.19139 11.1446 76.7289 8.37015 11.0890 77.9699 8.48327 11.0336 79.2310 8.56571 10.9786 80.5125 8.62044 10.9238 81.8147 8.64233 10.8693 83.1380 8.62841 10.8541 84.4827 8.62358 10.8470 85.8491 8.59253 10.8399 87.2377 8.51996 10.8328 88.6487 8.42516 10.9606 90.0825 8.39519 11.0952 91.5395 8.38922 11.2315 93.0201 8.39842 11.3695 94.5246 8.41879 11.5092 96.0535 8.44813 11.6505 97.6071 8.48497 11.7936 99.1858 8.52842 11.9385 100.790 8.57769 12.0852 102.420 8.63234 12.2336 104.077 8.69192 12.3839 105.760 8.75617 12.5360 107.471 8.82482 12.6900 109.209 8.89772 12.8459 110.975 8.97468 13.0037 112.770 9.05562 13.1634 114.594 9.14029 13.3251 116.448 9.22855 13.4888 118.331 9.32050 13.6557 120.245 9.41705 13.8248 122.190 9.51780 13.9960 124.166 9.62275 14.1693 126.175 9.73187 14.3448 128.215 9.84527 14.5224 130.289 9.96298 14.7022 132.397 10.0852 14.8842 134.538 10.2118 15.0685 136.714 10.3433 15.2551 138.925 10.4796 15.4440 141.172 10.6210 15.6353 143.456 10.7677 15.8289 145.776 10.9201 16.0248 148.134 11.0784 16.2233 150.530 11.2433 16.4242 152.964 11.4150 16.6275 155.439 11.5945 16.8334 157.953 11.7827 17.0419 160.507 11.9812 17.2529 163.103 12.1935 17.4665 165.742 12.4270 17.6828 168.422 12.6882 17.8602 171.146 12.9249 18.0227 173.915 13.1558 18.1867 176.727 13.3855 18.3522 179.586 13.6160 18.5192 182.491 13.8488 18.6877 185.442 14.0848 18.8577 188.442 14.3246 19.0293 191.489 14.5691 19.2025 194.587 14.8190 19.3772 197.734 15.0749 19.5535 200.932 15.3379 19.7314 204.182 15.6089 19.9110 207.485 15.8892 20.0921 210.840 16.1803 20.2750 214.251 16.4846 20.4595 217.716 16.8054 20.6456 221.237 17.1478 20.8335 224.816 17.5435 21.0230 228.452 18.0216 21.1229 232.147 18.4073 21.1519 235.902 18.7589 21.1810 239.717 19.0935 21.2101 243.595 19.4158 21.2393 247.535 19.7287 21.2685 251.538 20.0340 21.2978 255.607 20.3328 21.3270 259.741 20.6256 21.3564 263.942 20.9119 21.3857 268.211 21.1898 21.4151 272.549 21.4597 21.4598 276.957 21.7381 21.5097 281.437 22.0196 21.5597 285.989 22.3031 21.6099 290.615 22.5881 21.6601 295.315 22.8748 21.7105 300.092 23.1632 21.7610 304.945 23.4536 21.8116 309.878 23.7462 21.8623 314.890 24.0415 21.9131 319.983 24.3398 21.9641 325.158 24.6417 22.0151 330.418 24.9480 22.0663 335.762 25.2594 22.1176 341.192 25.5775 22.1691 346.711 25.9044 22.2206 352.319 26.2472 22.2723 358.017 26.6204 22.3241 363.808 26.9992 22.3006 369.692 27.3455 22.2717 375.672 27.6781 22.2430 381.748 28.0027 22.2142 387.922 28.3221 22.1855 394.197 28.6379 22.1568 400.573 28.9511 22.1281 407.052 29.2629 22.0995 413.635 29.5740 22.0709 420.326 29.8854 22.0424 427.124 30.1982 22.0139 434.032 30.5136 21.9854 441.052 30.8339 21.9570 448.186 31.1636 21.9286 455.435 31.5177 21.8919 462.802 31.8616 21.8047 470.287 32.1843 21.7178 477.894 32.4957 21.6313 485.623 32.8007 21.5451 493.478 33.1013 21.4592 501.459 33.3987 21.3737 509.570 33.6941 21.2886 517.812 33.9885 21.2037 526.187 34.2831 21.1193 534.698 34.5792 21.0351 543.346 34.8785 20.9513 552.134 35.1838 20.8678 561.065 35.5003 20.7847 570.139 35.8462 20.7019 579.361 36.2174 20.5444 588.732 36.5404 20.3594 598.254 36.8341 20.1750 607.930 37.1142 19.9921 617.763 37.3859 19.8111 627.755 37.6578 19.6303 637.908 37.9265 19.4338 648.226 38.1901 19.2142 658.711 38.4167 18.9808 669.365 38.6116 18.7499 680.191 38.7715 18.5536 691.193 38.9505 18.3836 702.372 39.1502 18.2197 713.733 39.3658 18.0278 725.277 39.5555 17.8177 737.008 39.7305 17.6101 748.928 39.8964 17.4047 761.042 40.0568 17.2010 773.351 40.2134 16.9954 785.859 40.3687 16.7784 798.570 40.5027 16.5529 811.486 40.6218 16.3299 824.611 40.7295 16.1099 837.949 40.8281 15.8926 851.502 40.9176 15.6745 865.274 40.9986 15.4554 879.269 41.0655 15.2358 893.491 41.1208 15.0189 907.943 41.1660 14.8049 922.628 41.2038 14.5939 937.551 41.2308 14.3768 952.715 41.2449 14.1605 968.124 41.2441 13.9455 983.783 41.2307 13.7332 999.695 41.2067 13.5224 1015.86 41.1727 13.3129 1032.29 41.1219 13.0917 1048.99 41.0514 12.8710 1065.96 40.9572 12.6508 1083.20 40.8412 12.4341 1100.72 40.7036 12.2208 1118.52 40.5430 12.0108 1136.61 40.3582 11.8042 1155. 40.1476 11.6010 1173.68 39.9086 11.4011 1192.66 39.6382 11.2039 1211.95 39.3328 11.0101 1231.55 38.9880 10.8195 1251.47 38.5984 10.6321 1271.72 38.1570 10.4482 1292.29 37.6557 10.2678 1313.19 37.0827 10.0902 1334.43 36.4228 9.91559 1356.01 35.6549 9.74396 1377.94 34.7492 9.57481 1400.23 33.6611 9.40837 1422.88 32.3197 9.24456 1445.89 30.6023 9.08349 1469.28 28.2649 8.92356 1493.04 24.6755 8.76393 1517.19 16.8146 8.60715 1527.70 -12.2656 8.54057 1527.90 -12.2632 27.9673 1541.73 17.6863 27.5146 1566.67 20.7066 26.7267 1592.01 21.1665 32.7737 1617.76 28.0058 38.1199 1643.92 33.0863 37.2924 1670.51 36.2941 36.4825 1697.53 38.7124 35.6898 1724.99 40.6462 34.9138 1752.89 42.2350 34.1552 1781.24 43.5534 33.4131 1810.05 44.6397 32.6868 1839.32 45.5061 31.9766 1869.07 46.1309 31.2819 1899.30 46.4147 30.6022 1930.02 45.8822 29.9371 1949.70 37.9874 29.5242 1949.90 37.9959 34.5861 1961.24 45.9966 34.2777 1992.96 48.9427 33.4388 2025.20 50.5083 32.6289 2057.95 51.6357 31.8316 2091.24 52.4820 31.0545 2125.06 53.0551 30.2966 2159.43 53.0529 29.5580 2172.90 50.2206 29.2767 2173.10 50.2250 31.2685 2194.36 54.0527 30.8226 2229.85 55.2904 30.1017 2265.92 56.1324 29.3987 2302.57 56.7874 28.7127 2339.81 57.2337 28.0441 2377.66 57.2892 27.7995 2398. 56.5232 27.6706 2398.20 56.5371 28.2347 2416.11 58.0660 27.9491 2455.19 58.9589 27.3430 2494.90 59.6138 26.7486 2535.26 60.1734 26.1654 2576.26 60.6707 25.5926 2617.93 61.1210 25.0311 2660.27 61.5322 24.4800 2703.30 61.9113 23.9401 2747.03 62.2605 23.4098 2791.46 62.5836 22.8906 2836.61 62.8830 22.3812 2882.49 63.1611 21.8823 2929.11 63.4188 21.3930 2976.48 63.6585 20.9139 3024.63 63.8806 20.4440 3073.55 64.0870 19.9843 3123.26 64.2782 19.5336 3173.78 64.4557 19.0928 3225.11 64.6209 18.6608 3277.27 64.7730 18.2366 3330.28 64.9135 17.8221 3384.15 65.0427 17.4160 3438.88 65.1617 17.0190 3494.50 65.2714 16.6303 3551.02 65.3719 16.2490 3608.46 65.4628 15.8758 3666.82 65.5461 15.5113 3726.13 65.6212 15.1532 3786.40 65.6881 14.8035 3847.64 65.7483 14.4618 3909.87 65.8018 14.1268 3973.11 65.8487 13.7990 4037.38 65.8892 13.4781 4102.68 65.9237 13.1644 4169.03 65.9525 12.8573 4236.46 65.9757 12.5568 4304.98 65.9937 12.2629 4374.62 66.0065 11.9754 4445.37 66.0144 11.6942 4517.27 66.0176 11.4193 4590.33 66.0162 11.1501 4664.58 66.0103 10.8872 4740.03 66.0002 10.6299 4816.69 65.9858 10.3783 4894.60 65.9674 10.1322 4973.77 65.9449 9.89160 5054.21 65.9185 9.65646 5135.96 65.8882 9.42647 5219.03 65.8540 9.20169 5303.44 65.8161 8.98187 5389.22 65.7743 8.76690 5476.39 65.7287 8.55681 5564.97 65.6792 8.35148 5654.98 65.6259 8.15069 5746.44 65.5685 7.95443 5839.39 65.5070 7.76255 5933.83 65.4413 7.57506 6029.81 65.3713 7.39164 6127.33 65.2965 7.21242 6226.44 65.2169 7.03740 6327.15 65.1324 6.86626 6429.48 65.0423 6.69891 6533.48 64.9464 6.53528 6639.15 64.8440 6.37539 6746.54 64.7347 6.21916 6855.65 64.6178 6.06658 6966.54 64.4925 5.91726 7079.22 64.3576 5.77125 7193.72 64.2120 5.62873 7310.07 64.0540 5.48919 7428.31 63.8817 5.35295 7548.45 63.6927 5.21985 7670.54 63.4836 5.08953 7794.61 63.2501 4.96237 7920.68 62.9867 4.83811 8048.79 62.6846 4.71641 8178.98 62.3311 4.59745 8311.26 61.9065 4.48134 8445.69 61.3757 4.36767 8582.29 60.6689 4.25673 8721.11 59.6096 4.14817 8862.16 57.4628 4.04219 8943.50 42.7846 3.98306 8943.70 42.7860 10.9084 9005.50 56.9482 10.7698 9151.16 59.5880 10.4537 9299.17 60.6463 10.1470 9449.58 61.1980 9.84905 9602.42 61.4217 9.55964 9757.73 61.2884 9.27924 9915.55 60.2409 9.00674 9978.10 53.0959 8.90217 9978.30 53.0966 12.4525 10075.9 61.0503 12.2317 10238.9 62.2606 11.8764 10404.5 62.5320 11.5313 10486.3 59.2909 11.3666 10486.5 59.2916 13.0348 10572.8 63.1842 12.8757 10743.8 64.2747 12.5699 10917.6 64.9814 12.2696 11094.2 65.5375 11.9750 11273.6 66.0022 11.6859 11455.9 66.4025 11.4025 11641.2 66.7533 11.1246 11829.5 67.0645 10.8522 12020.8 67.3428 10.5854 12215.3 67.5933 10.3240 12412.8 67.8195 10.0680 12613.6 68.0247 9.81737 12817.6 68.2113 9.57207 13025.0 68.3811 9.33202 13235.6 68.5360 9.09717 13449.7 68.6774 8.86745 13667.2 68.8065 8.64279 13888.3 68.9244 8.42314 14112.9 69.0321 8.20841 14341.2 69.1303 7.99854 14573.1 69.2198 7.79345 14808.9 69.3013 7.59308 15048.4 69.3754 7.39733 15291.8 69.4427 7.20615 15539.1 69.5036 7.01945 15790.4 69.5585 6.83714 16045.8 69.6080 6.65917 16305.4 69.6523 6.48544 16569.1 69.6919 6.31587 16837.1 69.7270 6.15040 17109.4 69.7579 5.98894 17386.1 69.7850 5.83141 17667.4 69.8084 5.67773 17953.1 69.8285 5.52783 18243.5 69.8454 5.38163 18538.6 69.8593 5.23906 18838.4 69.8705 5.10004 19143.1 69.8791 4.96449 19452.7 69.8852 4.83234 19767.4 69.8891 4.70351 20087.1 69.8909 4.57794 20412.0 69.8907 4.45555 20742.1 69.8887 4.33627 21077.6 69.8849 4.22003 21418.5 69.8795 4.10677 21765.0 69.8726 3.99640 22117.0 69.8643 3.88888 22474.7 69.8547 3.78413 22838.2 69.8438 3.68208 23207.6 69.8318 3.58268 23583.0 69.8188 3.48586 23964.4 69.8047 3.39156 24352.0 69.7897 3.29971 24745.9 69.7738 3.21027 25146.2 69.7571 3.12317 25552.9 69.7397 3.03835 25966.2 69.7215 2.95576 26386.1 69.7027 2.87534 26812.9 69.6833 2.79705 27246.6 69.6632 2.72082 27687.3 69.6427 2.64661 28135.1 69.6216 2.57436 28590.2 69.6000 2.50403 29052.6 69.5780 2.43557 29522.5 69.5555 2.36892 30000.0 69.5327 2.30405 periodictable-1.5.0/periodictable/xsf/zn.nff000066400000000000000000000315521310514471200210570ustar00rootroot00000000000000E(eV) f1 f2 10.0000 -9999. 2.21675 10.1617 -9999. 2.11915 10.3261 -9999. 2.02585 10.4931 -9999. 1.93665 10.6628 -9999. 1.85138 10.8353 -9999. 1.76986 11.0106 -9999. 1.69194 11.1886 -9999. 1.63293 11.3696 -9999. 1.57784 11.5535 -9999. 1.52460 11.7404 -9999. 1.47317 11.9303 -9999. 1.41678 12.1232 -9999. 1.35880 12.3193 -9999. 1.30320 12.5186 -9999. 1.29898 12.7210 -9999. 1.30061 12.9268 -9999. 1.30258 13.1359 -9999. 1.31477 13.3483 -9999. 1.32707 13.5642 -9999. 1.33949 13.7836 -9999. 1.35171 14.0066 -9999. 1.36387 14.2331 -9999. 1.37615 14.4633 -9999. 1.38853 14.6973 -9999. 1.40102 14.9350 -9999. 1.41363 15.1765 -9999. 1.42635 15.4220 -9999. 1.43918 15.6714 -9999. 1.45213 15.9249 -9999. 1.46519 16.1825 -9999. 1.49662 16.4442 -9999. 1.52989 16.7102 -9999. 1.56390 16.9805 -9999. 1.59867 17.2551 -9999. 1.63422 17.5342 -9999. 1.67055 17.8178 -9999. 1.70769 18.1060 -9999. 1.74565 18.3989 -9999. 1.78446 18.6964 -9999. 1.82414 18.9988 -9999. 1.86469 19.3061 -9999. 1.90615 19.6184 -9999. 1.94852 19.9357 -9999. 1.99185 20.2582 -9999. 2.04253 20.5858 -9999. 2.09481 20.9188 -9999. 2.14843 21.2571 -9999. 2.20343 21.6009 -9999. 2.25983 21.9503 -9999. 2.31768 22.3053 -9999. 2.37700 22.6661 -9999. 2.43784 23.0327 -9999. 2.50025 23.4053 -9999. 2.56425 23.7838 -9999. 2.62988 24.1685 -9999. 2.69720 24.5594 -9999. 2.76624 24.9566 -9999. 2.83705 25.3603 -9999. 2.90967 25.7705 -9999. 2.98415 26.1873 -9999. 3.06053 26.6109 -9999. 3.14002 27.0413 -9999. 3.22160 27.4786 -9999. 3.30531 27.9231 -9999. 3.39119 28.3747 -9999. 3.47930 28.8337 -9999. 3.56970 29.3000 -0.776021 3.66245 29.7739 -0.773223 3.75761 30.2555 -0.768501 3.85525 30.7449 -0.761632 3.95541 31.2421 -0.752332 4.05818 31.7475 -0.740234 4.16363 32.2609 -0.724803 4.27181 32.7827 -0.705148 4.38280 33.3130 -0.679227 4.49668 33.8518 -0.641458 4.60456 34.3993 -0.610078 4.70598 34.9557 -0.580116 4.80963 35.5211 -0.549776 4.91556 36.0956 -0.518270 5.02382 36.6794 -0.485088 5.13448 37.2727 -0.449802 5.24757 37.8755 -0.412036 5.36314 38.4882 -0.371393 5.48127 39.1107 -0.327445 5.60199 39.7432 -0.279697 5.72538 40.3861 -0.227567 5.85148 41.0393 -0.170310 5.98036 41.7031 -0.106943 6.11208 42.3776 -0.360293E-01 6.24670 43.0630 0.445447E-01 6.38429 43.7595 0.142962 6.52490 44.4673 0.279376 6.64850 45.1865 0.395691 6.72805 45.9174 0.494574 6.80854 46.6600 0.587305 6.89000 47.4147 0.676510 6.97243 48.1816 0.763621 7.05586 48.9609 0.849518 7.14028 49.7528 0.934855 7.22570 50.5576 1.02011 7.31215 51.3753 1.10570 7.39964 52.2062 1.19198 7.48817 53.0506 1.27933 7.57775 53.9087 1.36810 7.66842 54.7806 1.45870 7.76017 55.6667 1.55164 7.85301 56.5670 1.64759 7.94696 57.4820 1.74753 8.04204 58.4117 1.85504 8.13826 59.3564 1.98045 8.22295 60.3165 2.09242 8.29284 61.2921 2.19732 8.36333 62.2834 2.29996 8.43442 63.2908 2.40119 8.50610 64.3145 2.50160 8.57840 65.3547 2.60157 8.65132 66.4118 2.70142 8.72484 67.4859 2.80139 8.79900 68.5775 2.90170 8.87380 69.6867 3.00257 8.94922 70.8138 3.10427 9.02528 71.9591 3.20713 9.10200 73.1230 3.31207 9.17936 74.3057 3.42206 9.25724 75.5076 3.53130 9.32497 76.7289 3.63643 9.39320 77.9699 3.73952 9.46193 79.2310 3.84104 9.53116 80.5125 3.94093 9.60090 81.8147 4.03877 9.67114 83.1380 4.13273 9.74191 84.4827 4.21540 9.81362 85.8491 4.30144 9.91179 87.2377 4.39863 10.0109 88.6487 4.50187 10.1111 90.0825 4.60971 10.2122 91.5395 4.72168 10.3144 93.0201 4.83756 10.4176 94.5246 4.95735 10.5218 96.0535 5.08112 10.6270 97.6071 5.20911 10.7333 99.1858 5.34159 10.8407 100.790 5.47905 10.9491 102.420 5.62221 11.0587 104.077 5.77232 11.1693 105.760 5.93214 11.2810 107.471 6.11215 11.3867 109.209 6.28638 11.4667 110.975 6.45467 11.5474 112.770 6.62137 11.6286 114.594 6.78920 11.7104 116.448 6.95957 11.7927 118.331 7.13395 11.8757 120.245 7.31437 11.9592 122.190 7.50484 12.0433 124.166 7.71899 12.1280 126.175 7.97487 12.1589 128.215 8.17143 12.1318 130.289 8.32718 12.1048 132.397 8.44808 12.0779 134.538 8.52180 12.0510 136.714 8.46565 12.0242 138.925 8.38133 12.2805 141.172 8.47360 12.6256 143.456 8.69958 12.9805 145.776 9.17969 13.2730 148.134 9.58846 13.2870 150.530 9.89741 13.3010 152.964 10.1781 13.3150 155.439 10.4431 13.3290 157.953 10.6986 13.3430 160.507 10.9483 13.3571 163.103 11.1947 13.3712 165.742 11.4399 13.3853 168.422 11.6854 13.3993 171.146 11.9331 13.4135 173.915 12.1849 13.4276 176.727 12.4440 13.4417 179.586 12.7177 13.4559 182.491 13.0284 13.4390 185.442 13.3103 13.3832 188.442 13.5693 13.3275 191.489 13.8214 13.2721 194.587 14.0695 13.2170 197.734 14.3163 13.1621 200.932 14.5642 13.1074 204.182 14.8169 13.0529 207.485 15.0804 12.9986 210.840 15.3763 12.9446 214.251 15.6953 12.8045 217.716 15.9603 12.6274 221.237 16.1810 12.4527 224.816 16.3781 12.2804 228.452 16.5425 12.1105 232.147 16.6996 11.9778 235.902 16.8612 11.8471 239.717 17.0205 11.7177 243.595 17.1762 11.5898 247.535 17.3281 11.4633 251.538 17.4762 11.3382 255.607 17.6206 11.2144 259.741 17.7616 11.0920 263.942 17.8993 10.9709 268.211 18.0341 10.8511 272.549 18.1661 10.7327 276.957 18.2957 10.6155 281.437 18.4232 10.4996 285.989 18.5490 10.3850 290.615 18.6737 10.2717 295.315 18.7983 10.1595 300.092 18.9256 10.0486 304.945 19.0576 9.92718 309.878 19.1795 9.79825 314.890 19.2922 9.67098 319.983 19.4002 9.54537 325.158 19.5045 9.42140 330.418 19.6055 9.29903 335.762 19.7039 9.17825 341.192 19.8001 9.05904 346.711 19.8946 8.94138 352.319 19.9879 8.82525 358.017 20.0807 8.71063 363.808 20.1741 8.59749 369.692 20.2694 8.48582 375.672 20.3696 8.37561 381.748 20.4961 8.25075 387.922 20.6004 8.09404 394.197 20.6813 7.94030 400.573 20.7527 7.78948 407.052 20.8164 7.64153 413.635 20.8739 7.49639 420.326 20.9260 7.35400 427.124 20.9737 7.21433 434.032 21.0176 7.07729 441.052 21.0586 6.94287 448.186 21.0978 6.81100 455.435 21.1375 6.68163 462.802 21.1887 6.54388 470.287 21.2241 6.38945 477.894 21.2422 6.23865 485.623 21.2519 6.09142 493.478 21.2541 5.94765 501.459 21.2495 5.80729 509.570 21.2387 5.67023 517.812 21.2218 5.53642 526.187 21.1988 5.40575 534.698 21.1695 5.27817 543.346 21.1327 5.15360 552.134 21.0828 5.03197 561.065 21.0327 4.93231 570.139 20.9823 4.83383 579.361 20.9323 4.74119 588.732 20.8817 4.65153 598.254 20.8305 4.56431 607.930 20.7776 4.47866 617.763 20.7226 4.39466 627.755 20.6662 4.31200 637.908 20.6073 4.22781 648.226 20.5433 4.14084 658.711 20.4695 4.05279 669.365 20.3844 3.96658 680.191 20.2884 3.89183 691.193 20.1910 3.82593 702.372 20.0962 3.76353 713.733 19.9984 3.69825 725.277 19.8926 3.63144 737.008 19.7785 3.56582 748.928 19.6559 3.50143 761.042 19.5248 3.43806 773.351 19.3853 3.37406 785.859 19.2341 3.30526 798.570 19.0629 3.23298 811.486 18.8712 3.16227 824.611 18.6577 3.09309 837.949 18.4196 3.02541 851.502 18.1529 2.95935 865.274 17.8525 2.89479 879.269 17.5114 2.83170 893.491 17.1200 2.77006 907.943 16.6648 2.70974 922.628 16.1244 2.65071 937.551 15.4734 2.60046 952.715 14.6664 2.55306 968.124 13.6188 2.50819 983.783 12.1504 2.46410 999.695 9.77174 2.42102 1015.86 3.76919 2.37892 1021.70 -15.4199 2.36407 1021.90 -15.4118 17.2327 1032.29 6.78343 17.1037 1048.99 11.5047 16.9012 1065.96 13.9824 16.7012 1083.20 15.7067 16.5025 1100.72 17.0460 16.3064 1118.52 18.1518 16.1129 1136.61 19.1008 15.9216 1155. 19.9384 15.7325 1173.68 20.6939 15.5457 1192.66 21.3889 15.3612 1211.95 22.0414 15.1788 1231.55 22.6773 14.9985 1251.47 23.3018 14.7734 1271.72 23.9032 14.5006 1292.29 24.4216 14.1709 1313.19 24.8733 13.8488 1334.43 25.2792 13.5340 1356.01 25.6482 13.2265 1377.94 25.9862 12.9259 1400.23 26.2971 12.6321 1422.88 26.5843 12.3449 1445.89 26.8507 12.0644 1469.28 27.0988 11.7896 1493.04 27.3304 11.5203 1517.19 27.5455 11.2544 1541.73 27.7449 10.9942 1566.67 27.9302 10.7400 1592.01 28.1031 10.4916 1617.76 28.2645 10.2490 1643.92 28.4157 10.0120 1670.51 28.5577 9.78048 1697.53 28.6913 9.55431 1724.99 28.8210 9.33336 1752.89 28.9428 9.11024 1781.24 29.0539 8.89009 1810.05 29.1556 8.67363 1839.32 29.2485 8.46234 1869.07 29.3341 8.25614 1899.30 29.4130 8.05493 1930.02 29.4859 7.85868 1961.24 29.5532 7.66730 1992.96 29.6146 7.48068 2025.20 29.6757 7.30176 2057.95 29.7333 7.12066 2091.24 29.7840 6.94307 2125.06 29.8299 6.76946 2159.43 29.8714 6.59974 2194.36 29.9092 6.43388 2229.85 29.9429 6.27136 2265.92 29.9731 6.11279 2302.57 30.0002 5.95786 2339.81 30.0241 5.80606 2377.66 30.0449 5.65807 2416.11 30.0630 5.51334 2455.19 30.0783 5.37202 2494.90 30.0912 5.23407 2535.26 30.1019 5.09933 2576.26 30.1103 4.96775 2617.93 30.1165 4.83924 2660.27 30.1208 4.71406 2703.30 30.1233 4.59161 2747.03 30.1241 4.47218 2791.46 30.1231 4.35568 2836.61 30.1207 4.24205 2882.49 30.1168 4.13114 2929.11 30.1116 4.02294 2976.48 30.1051 3.91741 3024.63 30.0973 3.81450 3073.55 30.0885 3.71411 3123.26 30.0785 3.61621 3173.78 30.0676 3.52074 3225.11 30.0557 3.42769 3277.27 30.0429 3.33695 3330.28 30.0294 3.24849 3384.15 30.0150 3.16229 3438.88 29.9999 3.07827 3494.50 29.9841 2.99636 3551.02 29.9678 2.91654 3608.46 29.9507 2.83873 3666.82 29.9332 2.76294 3726.13 29.9151 2.68908 3786.40 29.8965 2.61709 3847.64 29.8775 2.54695 3909.87 29.8580 2.47863 3973.11 29.8381 2.41202 4037.38 29.8178 2.34720 4102.68 29.7971 2.28400 4169.03 29.7761 2.22246 4236.46 29.7547 2.16251 4304.98 29.7331 2.10414 4374.62 29.7111 2.04722 4445.37 29.6888 1.99183 4517.27 29.6662 1.93789 4590.33 29.6434 1.88530 4664.58 29.6202 1.83415 4740.03 29.5968 1.78428 4816.69 29.5731 1.73575 4894.60 29.5491 1.68848 4973.77 29.5248 1.64246 5054.21 29.5002 1.59766 5135.96 29.4753 1.55398 5219.03 29.4501 1.51146 5303.44 29.4246 1.47005 5389.22 29.3987 1.42974 5476.39 29.3724 1.39045 5564.97 29.3456 1.35225 5654.98 29.3185 1.31507 5746.44 29.2910 1.27882 5839.39 29.2628 1.24350 5933.83 29.2342 1.20914 6029.81 29.2049 1.17569 6127.33 29.1750 1.14312 6226.44 29.1443 1.11136 6327.15 29.1129 1.08048 6429.48 29.0806 1.05044 6533.48 29.0473 1.02112 6639.15 29.0129 0.992600 6746.54 28.9773 0.964826 6855.65 28.9404 0.937786 6966.54 28.9019 0.911450 7079.22 28.8618 0.885808 7193.72 28.8197 0.860833 7310.07 28.7754 0.836517 7428.31 28.7285 0.812835 7548.45 28.6788 0.789772 7670.54 28.6257 0.767321 7794.61 28.5687 0.745456 7920.68 28.5070 0.724156 8048.79 28.4398 0.703408 8178.98 28.3659 0.683209 8311.26 28.2838 0.663533 8445.69 28.1913 0.644378 8582.29 28.0858 0.625712 8721.11 27.9628 0.607531 8862.16 27.8162 0.589828 9005.50 27.6352 0.572591 9151.16 27.4010 0.555792 9299.17 27.0735 0.539425 9449.58 26.5430 0.523484 9602.42 25.1991 0.507960 9658.50 18.4095 0.502440 9658.70 18.4099 3.89191 9757.73 25.9194 3.83265 9915.55 27.0089 3.74123 10075.9 27.5766 3.65173 10238.9 27.9665 3.56370 10404.5 28.2638 3.47717 10572.8 28.5036 3.39214 10743.8 28.7037 3.30863 10917.6 28.8747 3.22663 11094.2 29.0231 3.14617 11273.6 29.1537 3.06723 11455.9 29.2695 2.98982 11641.2 29.3730 2.91394 11829.5 29.4660 2.83957 12020.8 29.5500 2.76672 12215.3 29.6261 2.69537 12412.8 29.6952 2.62552 12613.6 29.7582 2.55716 12817.6 29.8156 2.49026 13025.0 29.8681 2.42482 13235.6 29.9160 2.36082 13449.7 29.9599 2.29824 13667.2 30.0001 2.23707 13888.3 30.0368 2.17730 14112.9 30.0705 2.11889 14341.2 30.1012 2.06184 14573.1 30.1293 2.00612 14808.9 30.1550 1.95172 15048.4 30.1784 1.89861 15291.8 30.1997 1.84677 15539.1 30.2191 1.79618 15790.4 30.2366 1.74682 16045.8 30.2525 1.69867 16305.4 30.2668 1.65170 16569.1 30.2796 1.60590 16837.1 30.2911 1.56124 17109.4 30.3014 1.51771 17386.1 30.3104 1.47527 17667.4 30.3184 1.43391 17953.1 30.3253 1.39361 18243.5 30.3313 1.35434 18538.6 30.3364 1.31608 18838.4 30.3406 1.27882 19143.1 30.3441 1.24252 19452.7 30.3469 1.20718 19767.4 30.3490 1.17276 20087.1 30.3504 1.13926 20412.0 30.3513 1.10664 20742.1 30.3516 1.07489 21077.6 30.3514 1.04398 21418.5 30.3507 1.01391 21765.0 30.3496 0.984646 22117.0 30.3481 0.956173 22474.7 30.3463 0.928472 22838.2 30.3440 0.901523 23207.6 30.3415 0.875310 23583.0 30.3386 0.849815 23964.4 30.3355 0.825020 24352.0 30.3322 0.800908 24745.9 30.3286 0.777463 25146.2 30.3248 0.754667 25552.9 30.3207 0.732505 25966.2 30.3166 0.710960 26386.1 30.3122 0.690017 26812.9 30.3078 0.669660 27246.6 30.3032 0.649875 27687.3 30.2984 0.630648 28135.1 30.2936 0.611962 28590.2 30.2887 0.593805 29052.6 30.2839 0.576163 29522.5 30.2805 0.559022 30000.0 30.2686 0.542369 periodictable-1.5.0/periodictable/xsf/zr.nff000066400000000000000000000441321310514471200210610ustar00rootroot00000000000000E(eV) f1 f2 1.00000 -9999. 0.187064 1.01486 -9999. 0.190511 1.02994 -9999. 0.194022 1.04524 -9999. 0.197598 1.06077 -9999. 0.201239 1.07653 -9999. 0.204991 1.09252 -9999. 0.208845 1.10875 -9999. 0.212770 1.12523 -9999. 0.216770 1.14195 -9999. 0.220845 1.15891 -9999. 0.224996 1.17613 -9999. 0.229225 1.19360 -9999. 0.233534 1.21134 -9999. 0.237924 1.22934 -9999. 0.242397 1.24760 -9999. 0.246953 1.26614 -9999. 0.251595 1.28495 -9999. 0.256324 1.30404 -9999. 0.261558 1.32341 -9999. 0.267735 1.34308 -9999. 0.274057 1.36303 -9999. 0.280529 1.38328 -9999. 0.287154 1.40383 -9999. 0.293935 1.42469 -9999. 0.300876 1.44586 -9999. 0.307981 1.46734 -9999. 0.315254 1.48914 -9999. 0.322698 1.51127 -9999. 0.330319 1.53372 -9999. 0.338119 1.55651 -9999. 0.346104 1.57963 -9999. 0.354277 1.60310 -9999. 0.362643 1.62692 -9999. 0.371106 1.65109 -9999. 0.379747 1.67562 -9999. 0.388588 1.70052 -9999. 0.397635 1.72578 -9999. 0.406892 1.75142 -9999. 0.416365 1.77744 -9999. 0.426059 1.80385 -9999. 0.435978 1.83065 -9999. 0.446129 1.85785 -9999. 0.456515 1.88546 -9999. 0.467144 1.91347 -9999. 0.478020 1.94190 -9999. 0.489149 1.97075 -9999. 0.500537 2.00003 -9999. 0.511518 2.02974 -9999. 0.522347 2.05990 -9999. 0.533405 2.09051 -9999. 0.544696 2.12157 -9999. 0.556227 2.15309 -9999. 0.568002 2.18508 -9999. 0.580026 2.21754 -9999. 0.592304 2.25049 -9999. 0.604843 2.28392 -9999. 0.617647 2.31786 -9999. 0.630721 2.35229 -9999. 0.644073 2.38724 -9999. 0.657707 2.42271 -9999. 0.671630 2.45871 -9999. 0.684788 2.49524 -9999. 0.696838 2.53231 -9999. 0.709100 2.56993 -9999. 0.721578 2.60812 -9999. 0.734275 2.64687 -9999. 0.747196 2.68619 -9999. 0.760345 2.72610 -9999. 0.773724 2.76660 -9999. 0.787340 2.80771 -9999. 0.801194 2.84942 -9999. 0.815293 2.89176 -9999. 0.829639 2.93472 -9999. 0.844238 2.97833 -9999. 0.859094 3.02258 -9999. 0.874211 3.06748 -9999. 0.889595 3.11306 -9999. 0.905249 3.15931 -9999. 0.921178 3.20625 -9999. 0.937388 3.25389 -9999. 0.953884 3.30223 -9999. 0.970668 3.35129 -9999. 0.987749 3.40108 -9999. 1.00329 3.45162 -9999. 1.01820 3.50290 -9999. 1.03333 3.55494 -9999. 1.04868 3.60776 -9999. 1.06426 3.66136 -9999. 1.08007 3.71576 -9999. 1.09612 3.77097 -9999. 1.11241 3.82699 -9999. 1.12893 3.88385 -9999. 1.14571 3.94156 -9999. 1.16273 4.00012 -9999. 1.18000 4.05955 -9999. 1.19754 4.11986 -9999. 1.21533 4.18107 -9999. 1.23338 4.24319 -9999. 1.25171 4.30624 -9999. 1.27031 4.37022 -9999. 1.28918 4.43515 -9999. 1.32117 4.50104 -9999. 1.35964 4.56791 -9999. 1.39922 4.63578 -9999. 1.43995 4.70466 -9999. 1.48188 4.77456 -9999. 1.52502 4.84549 -9999. 1.56941 4.91749 -9999. 1.61511 4.99055 -9999. 1.66212 5.06469 -9999. 1.71215 5.13994 -9999. 1.76908 5.21631 -9999. 1.82792 5.29381 -9999. 1.88870 5.37246 -9999. 1.95151 5.45228 -9999. 2.01641 5.53329 -9999. 2.08347 5.61550 -9999. 2.15275 5.69893 -9999. 2.22434 5.78360 -9999. 2.29831 5.86953 -9999. 2.37474 5.95674 -9999. 2.45371 6.04524 -9999. 2.53531 6.13506 -9999. 2.61962 6.22621 -9999. 2.69698 6.31871 -9999. 2.75883 6.41259 -9999. 2.82209 6.50787 -9999. 2.88681 6.60456 -9999. 2.95302 6.70268 -9999. 3.02074 6.80227 -9999. 3.09001 6.90333 -9999. 3.16087 7.00590 -9999. 3.23336 7.10999 -9999. 3.30751 7.21562 -9999. 3.38336 7.32283 -9999. 3.46095 7.43163 -9999. 3.54032 7.54204 -9999. 3.62151 7.65410 -9999. 3.69522 7.76782 -9999. 3.76019 7.88323 -9999. 3.82631 8.00035 -9999. 3.89359 8.11922 -9999. 3.96206 8.23985 -9999. 4.03172 8.36227 -9999. 4.10262 8.48651 -9999. 4.17475 8.61260 -9999. 4.23941 8.74056 -9999. 4.28244 8.87042 -9999. 4.32590 9.00221 -9999. 4.36981 9.13596 -9999. 4.41416 9.27170 -9999. 4.45896 9.40945 -9999. 4.50421 9.54925 -9999. 4.54993 9.69113 -9999. 4.59611 9.83512 -9999. 4.64276 9.98124 -9999. 4.68362 10.1295 -9999. 4.72345 10.2800 -9999. 4.76363 10.4328 -9999. 4.80414 10.5878 -9999. 4.84500 10.7451 -9999. 4.88620 10.9047 -9999. 4.92776 11.0667 -9999. 4.96966 11.2312 -9999. 5.00525 11.3980 -9999. 5.02611 11.5674 -9999. 5.04706 11.7392 -9999. 5.06809 11.9136 -9999. 5.08921 12.0907 -9999. 5.11042 12.2703 -9999. 5.10947 12.4526 -9999. 5.10224 12.6376 -9999. 5.09504 12.8254 -9999. 5.08783 13.0159 -9999. 5.08064 13.2093 -9999. 5.07346 13.4056 -9999. 5.06629 13.6047 -9999. 5.05021 13.8069 -9999. 4.97147 14.0120 -9999. 4.89396 14.2202 -9999. 4.81765 14.4315 -9999. 4.74254 14.6459 -9999. 4.66860 14.8635 -9999. 4.59580 15.0843 -9999. 4.49013 15.3084 -9999. 4.31258 15.5359 -9999. 4.14205 15.7667 -9999. 3.97826 16.0009 -9999. 3.82094 16.2387 -9999. 3.66985 16.4799 -9999. 3.52474 16.7248 -9999. 3.38536 16.9733 -9999. 3.25149 17.2254 -9999. 3.12292 17.4814 -9999. 2.99943 17.7411 -9999. 2.88082 18.0047 -9999. 2.76690 18.2722 -9999. 2.65749 18.5437 -9999. 2.55241 18.8192 -9999. 2.45147 19.0988 5.13449 2.35453 19.3825 5.04369 2.26143 19.6705 4.94569 2.17201 19.9628 4.84027 2.08612 20.2594 4.72704 2.00363 20.5604 4.60555 1.92440 20.8658 4.47513 1.84830 21.1758 4.33493 1.77521 21.4905 4.18381 1.70501 21.8098 4.01783 1.63759 22.1338 3.83530 1.57706 22.4626 3.64323 1.53539 22.7964 3.44648 1.49483 23.1351 3.23745 1.45534 23.4788 3.01219 1.41690 23.8276 2.76652 1.37946 24.1817 2.49525 1.34302 24.5409 2.19097 1.30754 24.9056 1.83983 1.27300 25.2756 1.43303 1.26328 25.6511 0.972209 1.26113 26.0322 0.364745 1.25899 26.4190 -0.386541 1.38976 26.8115 -1.60492 1.68359 27.2099 -2.60944 3.22237 27.6141 -2.25008 4.58631 28.0244 -1.82408 5.05101 28.4408 -1.78224 5.56277 28.8633 -1.68230 6.03228 29.2922 -1.63400 6.39680 29.7274 -1.65964 6.78335 30.1690 -1.72277 7.19325 30.6173 -1.81695 7.62792 31.0722 -1.99296 8.08886 31.5338 -2.25309 8.65881 32.0023 -2.48291 9.53423 32.4778 -2.54597 10.4982 32.9603 -2.48688 11.5596 33.4500 -2.26951 12.7283 33.9470 -1.83832 14.0152 34.4514 -1.01169 15.4322 34.9632 0.423102 16.4497 35.4827 1.79749 16.7706 36.0099 2.81072 17.0977 36.5449 3.89580 17.4313 37.0879 5.00310 17.4699 37.6389 5.94484 17.4896 38.1981 6.84816 17.5094 38.7656 7.77770 17.5292 39.3416 8.74361 17.4024 39.9261 9.62356 17.2006 40.5193 10.4440 17.0011 41.1213 11.2798 16.8040 41.7323 12.2055 16.5349 42.3523 13.0802 16.0378 42.9816 13.7828 15.5555 43.6202 14.4574 15.0878 44.2682 15.2493 14.6342 44.9259 16.0678 13.9075 45.5934 16.6049 12.9990 46.2708 16.9531 12.1498 46.9583 17.1914 11.3561 47.6560 17.3495 10.6143 48.3640 17.4469 9.92088 49.0826 17.4954 9.27279 49.8118 17.5055 8.66704 50.5519 17.4839 8.10086 51.3030 17.4373 7.57166 52.0652 17.3705 7.07704 52.8388 17.2891 6.61472 53.6238 17.1997 6.18261 54.4205 17.1100 5.76349 55.2291 16.9988 5.34567 56.0496 16.8565 4.95814 56.8824 16.7017 4.59871 57.7275 16.5377 4.26534 58.5852 16.3667 3.95613 59.4556 16.1908 3.66934 60.3390 16.0113 3.40334 61.2354 15.8296 3.15662 62.1452 15.6461 2.92778 63.0686 15.4618 2.71554 64.0056 15.2768 2.51868 64.9566 15.0914 2.33609 65.9216 14.9053 2.16674 66.9011 14.7180 2.00967 67.8950 14.5289 1.86398 68.9038 14.3201 1.72885 69.9275 14.1099 1.64583 70.9665 13.9386 1.57267 72.0208 13.7760 1.50277 73.0909 13.6205 1.43598 74.1768 13.4695 1.37215 75.2789 13.3206 1.31116 76.3973 13.1688 1.25288 77.5324 13.0138 1.21307 78.6843 12.8705 1.18447 79.8534 12.7362 1.15654 81.0398 12.6016 1.12928 82.2438 12.4697 1.12188 83.4658 12.3519 1.11494 84.7058 12.2408 1.10804 85.9644 12.1345 1.10119 87.2416 12.0318 1.09437 88.5377 11.9318 1.08739 89.8532 11.8335 1.08046 91.1882 11.7362 1.07357 92.5430 11.6389 1.06672 93.9179 11.5404 1.05992 95.3133 11.4352 1.05467 96.7294 11.3301 1.06483 98.1666 11.2350 1.07509 99.6251 11.1413 1.08545 101.105 11.0470 1.09591 102.607 10.9508 1.10842 104.132 10.8561 1.13213 105.679 10.7680 1.15635 107.249 10.6833 1.18109 108.843 10.6013 1.20636 110.460 10.5223 1.23217 112.101 10.4463 1.25742 113.766 10.3713 1.27867 115.457 10.2953 1.30028 117.172 10.2224 1.32225 118.913 10.1500 1.33782 120.680 10.0717 1.35198 122.473 9.99084 1.36628 124.292 9.90751 1.38074 126.139 9.82167 1.39535 128.013 9.73316 1.41011 129.915 9.64177 1.42503 131.845 9.54709 1.44011 133.804 9.44884 1.45561 135.792 9.34712 1.47207 137.810 9.24188 1.48871 139.857 9.13250 1.50554 141.935 9.01852 1.52256 144.044 8.89942 1.53977 146.184 8.77469 1.55718 148.356 8.64371 1.57478 150.560 8.50583 1.59258 152.797 8.36112 1.61059 155.067 8.20802 1.62680 157.371 8.04308 1.64154 159.709 7.86515 1.65641 162.082 7.67268 1.67141 164.490 7.46327 1.68655 166.934 7.23352 1.70182 169.414 6.97833 1.71724 171.931 6.68915 1.73279 174.486 6.34986 1.74848 176.293 6.00044 1.75953 178.776 5.65958 2.15126 181.432 5.41425 2.18213 184.128 4.95997 2.21345 186.863 4.41834 2.48950 189.640 3.94975 2.84521 192.457 3.57440 3.20582 195.317 3.16811 3.46668 198.219 2.39094 3.74876 201.164 1.56844 4.56748 204.152 1.02749 5.65136 207.186 0.858427 6.99245 210.264 1.18531 8.07342 213.388 1.66911 8.88459 216.558 2.02039 9.29434 219.776 2.19169 9.72296 223.041 2.25393 10.1714 226.355 2.27307 10.7262 229.718 2.33900 11.3758 233.131 2.44787 12.0646 236.595 2.63874 12.8901 240.110 3.10756 13.8079 243.677 3.84401 14.3512 247.298 4.45142 14.6251 250.972 4.83647 14.9043 254.701 5.19179 15.2519 258.485 5.57293 15.6166 262.325 5.96969 15.9900 266.223 6.46719 16.3646 270.178 6.97004 16.5783 274.192 7.38425 16.7947 278.266 7.82181 17.0140 282.400 8.24696 17.1245 286.596 8.59223 17.2159 290.854 8.86235 17.3077 295.175 9.02620 17.4106 299.561 9.18296 17.7415 304.012 9.44285 18.0788 308.529 9.82569 18.4224 313.112 10.2237 18.6037 317.764 10.4895 18.7493 322.486 10.5885 18.8960 327.277 10.6254 19.4502 332.139 10.9148 20.1610 337.074 11.4772 20.8977 342.082 12.4309 21.6613 347.165 13.5853 21.6984 352.323 14.4317 21.5390 357.557 15.0593 21.3808 362.870 15.5972 21.2237 368.261 16.0519 21.0678 373.732 16.3925 20.9131 379.285 16.6650 20.9336 384.920 17.0041 21.0207 390.639 17.4043 21.1081 396.443 17.8283 21.1959 402.333 18.3099 21.2840 408.311 18.8145 21.3021 414.377 19.2856 21.2919 420.534 19.7483 21.2818 426.782 20.2140 21.2716 433.123 20.6882 21.2615 439.558 21.2379 21.2514 446.088 21.7996 21.1108 452.716 22.2707 20.9280 459.442 22.7014 20.7467 466.268 23.0990 20.5671 473.196 23.4707 20.3980 480.226 23.8342 20.2504 487.361 24.1977 20.1038 494.602 24.5575 19.9583 501.951 24.9149 19.8138 509.409 25.2715 19.6705 516.977 25.6303 19.5281 524.658 25.9954 19.3867 532.453 26.3740 19.2464 540.364 26.8175 19.0898 548.392 27.2459 18.8048 556.540 27.5804 18.5240 564.809 27.8913 18.2474 573.200 28.1798 17.9750 581.717 28.4499 17.7066 590.359 28.7043 17.4423 599.131 28.9447 17.1819 608.032 29.1727 16.9253 617.066 29.3892 16.6726 626.234 29.5949 16.4237 635.538 29.7888 16.1785 644.981 29.9733 15.9434 654.564 30.1537 15.7134 664.289 30.3294 15.4868 674.158 30.4996 15.2635 684.174 30.6648 15.0433 694.340 30.8252 14.8264 704.656 30.9813 14.6125 715.125 31.1336 14.4018 725.750 31.2826 14.1941 736.533 31.4291 13.9894 747.476 31.5745 13.7876 758.581 31.7222 13.5888 769.852 31.8741 13.3806 781.290 32.0165 13.1621 792.898 32.1452 12.9472 804.678 32.2688 12.7358 816.634 32.3887 12.5279 828.767 32.5067 12.3234 841.080 32.6274 12.1222 853.576 32.7616 11.9233 866.258 32.8907 11.6746 879.129 32.9872 11.4312 892.190 33.0679 11.1927 905.446 33.1358 10.9593 918.898 33.1919 10.7307 932.551 33.2321 10.5069 946.406 33.2632 10.3090 960.467 33.3005 10.1191 974.737 33.3398 9.93277 989.219 33.3787 9.74983 1003.92 33.4177 9.57024 1018.83 33.4585 9.39397 1033.97 33.5104 9.21395 1049.33 33.5535 9.00815 1064.92 33.5689 8.80695 1080.74 33.5673 8.61024 1096.80 33.5520 8.44279 1113.10 33.5465 8.29281 1129.63 33.5529 8.14550 1146.42 33.5661 8.00081 1163.45 33.5829 7.84548 1180.74 33.5943 7.69067 1198.28 33.6136 7.53892 1216.08 33.6355 7.36979 1234.15 33.6390 7.18601 1252.49 33.6279 7.00681 1271.10 33.6120 6.82832 1289.98 33.5824 6.63951 1309.15 33.5253 6.45593 1328.60 33.4456 6.28390 1348.34 33.3621 6.15791 1368.37 33.2941 6.03440 1388.70 33.2288 5.91333 1409.33 33.1634 5.79462 1430.27 33.0967 5.67831 1451.52 33.0280 5.56448 1473.09 32.9570 5.45263 1494.97 32.8829 5.34284 1517.18 32.8051 5.23417 1539.73 32.7225 5.12763 1562.60 32.6350 5.02317 1585.82 32.5423 4.92083 1609.38 32.4437 4.82057 1633.29 32.3389 4.72255 1657.56 32.2274 4.62643 1682.18 32.1083 4.53214 1707.18 31.9809 4.43993 1732.54 31.8444 4.34950 1758.28 31.6974 4.25969 1784.41 31.5377 4.17149 1810.92 31.3636 4.08485 1837.82 31.1733 3.99998 1865.13 30.9640 3.91687 1892.84 30.7327 3.83555 1920.96 30.4751 3.75591 1949.50 30.1857 3.67792 1978.47 29.8567 3.60153 2000. 29.5841 3.54648 2026. 29.2165 3.48326 2052. 28.7953 3.41986 2079. 28.2813 3.35592 2106. 27.6587 3.29381 2134. 26.8395 3.23128 2161. 25.7634 3.17275 2190. 23.9117 3.11164 2218. 18.3423 3.05439 2222.20 8.21880 3.04595 2222.40 8.22078 11.4966 2247. 22.7924 11.2807 2277. 24.1749 11.0261 2306. 20.5713 10.7885 2306.60 18.0745 10.7837 2306.80 18.0818 14.8502 2337. 26.3744 14.5865 2367. 27.9197 14.3325 2398. 28.9696 14.0783 2429. 29.7293 13.8316 2461. 30.2895 13.5849 2493. 30.6012 13.3454 2526. 30.0697 13.1064 2531.50 27.7869 13.0672 2531.70 27.7908 14.9250 2559. 31.5603 14.7028 2592. 32.5026 14.4418 2626. 33.2011 14.1792 2660. 33.7723 13.9227 2695. 34.2760 13.6654 2730. 34.7180 13.4144 2766. 35.1224 13.1625 2802. 35.4854 12.9171 2839. 35.8228 12.6716 2876. 36.1297 12.4327 2914. 36.4171 12.1933 2952. 36.6799 11.9606 2990. 36.9216 11.7347 3029. 37.1499 11.5082 3069. 37.3655 11.2830 3109. 37.5641 11.0634 3150. 37.7520 10.8453 3191. 37.9259 10.6329 3232. 38.0866 10.4262 3275. 38.2424 10.2163 3317. 38.3834 10.0165 3361. 38.5197 9.81349 3405. 38.6463 9.61716 3449. 38.7638 9.42589 3494. 38.8746 9.23527 3540. 38.9794 9.04757 3586. 39.0764 8.86427 3633. 39.1678 8.68352 3680. 39.2527 8.50785 3729. 39.3343 8.33009 3777. 39.4080 8.16137 3827. 39.4787 7.99097 3877. 39.5438 7.82582 3927. 39.6038 7.66572 3979. 39.6611 7.50438 4031. 39.7137 7.34806 4083. 39.7618 7.19651 4137. 39.8075 7.04414 4191. 39.8492 6.89658 4245. 39.8872 6.75353 4301. 39.9230 6.60989 4357. 39.9554 6.47085 4414. 39.9851 6.33379 4472. 40.0123 6.19877 4530. 40.0367 6.06812 4589. 40.0588 5.93942 4649. 40.0787 5.81278 4710. 40.0965 5.68810 4771. 40.1121 5.56751 4834. 40.1259 5.44694 4897. 40.1377 5.33034 4961. 40.1478 5.21576 5026. 40.1562 5.10322 5091. 40.1630 4.99429 5158. 40.1684 4.88568 5225. 40.1722 4.78059 5294. 40.1746 4.67604 5363. 40.1758 4.57491 5433. 40.1758 4.47573 5504. 40.1745 4.37838 5576. 40.1722 4.28298 5649. 40.1688 4.18952 5722. 40.1644 4.09901 5797. 40.1589 4.00922 5873. 40.1526 3.92134 5950. 40.1455 3.83524 6027. 40.1377 3.75199 6106. 40.1289 3.66946 6186. 40.1195 3.58865 6267. 40.1094 3.50970 6349. 40.0986 3.43229 6432. 40.0871 3.35668 6516. 40.0751 3.28284 6601. 40.0626 3.21047 6687. 40.0496 3.13980 6774. 40.0360 3.07080 6863. 40.0219 3.00253 6952. 40.0076 2.93656 7043. 39.9926 2.87148 7135. 39.9773 2.80783 7229. 39.9615 2.74514 7323. 39.9456 2.68447 7419. 39.9291 2.62477 7516. 39.9125 2.56637 7614. 39.8955 2.50937 7713. 39.8782 2.45388 7814. 39.8606 2.39911 7916. 39.8428 2.34582 8019. 39.8249 2.29376 8124. 39.8065 2.24243 8230. 39.7879 2.19247 8338. 39.7690 2.14333 8447. 39.7500 2.09553 8557. 39.7309 2.04880 8669. 39.7115 2.00288 8782. 39.6919 1.95817 8897. 39.6720 1.91429 9013. 39.6520 1.87153 9131. 39.6318 1.82952 9250. 39.6114 1.78863 9371. 39.5908 1.74847 9494. 39.5699 1.70908 9618. 39.5489 1.67074 9743. 39.5278 1.63344 9887.76 39.5034 1.59183 10034.7 39.4788 1.55125 10183.8 39.4539 1.51169 10335.1 39.4286 1.47312 10488.6 39.4030 1.43551 10644.4 39.3771 1.39885 10802.6 39.3508 1.36310 10963.1 39.3240 1.32825 11126.0 39.2969 1.29428 11291.3 39.2692 1.26116 11459.0 39.2410 1.22887 11629.3 39.2123 1.19739 11802.1 39.1829 1.16670 11977.4 39.1529 1.13678 12155.4 39.1221 1.10762 12336.0 39.0905 1.07918 12519.2 39.0580 1.05147 12705.2 39.0244 1.02444 12894.0 38.9898 0.998102 13085.6 38.9538 0.972422 13280.0 38.9165 0.947387 13477.3 38.8775 0.922981 13677.5 38.8368 0.899189 13880.8 38.7940 0.875995 14087.0 38.7488 0.853384 14296.3 38.7010 0.831341 14508.7 38.6501 0.809851 14724.3 38.5956 0.788901 14943.0 38.5368 0.768477 15165.0 38.4729 0.748566 15390.3 38.4029 0.729155 15619.0 38.3255 0.710230 15851.1 38.2389 0.691780 16086.6 38.1404 0.673793 16325.6 38.0266 0.656256 16568.1 37.8918 0.639158 16814.3 37.7275 0.622488 17064.1 37.5180 0.606236 17317.6 37.2322 0.590390 17574.9 36.7916 0.574939 17836.1 35.8632 0.559875 17995.8 28.3833 0.550960 17996.0 28.3835 3.75925 18101.1 35.5338 3.72566 18370.0 36.8921 3.64188 18642.9 37.4953 3.55948 18919.9 37.8923 3.47847 19201.0 38.1892 3.39885 19486.3 38.4259 3.32063 19775.8 38.6221 3.24380 20069.6 38.7890 3.16835 20367.8 38.9335 3.09429 20670.4 39.0604 3.02161 20977.5 39.1728 2.95030 21289.2 39.2733 2.88036 21605.5 39.3636 2.81177 21926.5 39.4452 2.74453 22252.3 39.5192 2.67862 22582.9 39.5865 2.61403 22918.4 39.6480 2.55075 23258.9 39.7041 2.48877 23604.5 39.7556 2.42807 23955.2 39.8028 2.36864 24311.1 39.8460 2.31046 24672.3 39.8858 2.25351 25038.9 39.9223 2.19778 25410.9 39.9559 2.14326 25788.4 39.9868 2.08992 26171.6 40.0151 2.03775 26560.4 40.0411 1.98672 26955.0 40.0650 1.93684 27355.5 40.0869 1.88806 27761.9 40.1069 1.84039 28174.4 40.1252 1.79379 28593.0 40.1419 1.74825 29017.8 40.1571 1.70376 29448.9 40.1709 1.66029 29886.5 40.1834 1.61783 30000.0 40.1864 1.60707 periodictable-1.5.0/release.sh000077500000000000000000000064201310514471200163020ustar00rootroot00000000000000#!/bin/bash # Usage: ./release.sh [sync|test|doc|notes|web|pypi] # # Build an official elements package release # # Releasing this package requires some setup in your local environment # nosetests and coverage package # sphinx and latex # reflectometry.org server key for updating docs # ~/.pypirc should be defined # # Adapt the following to your own username/password for pypi, and get yourself # added to the periodictable package. # == ~/.pyirc == # [distutils] # index-servers = # pypi # # [pypi] # username:... # password:... # Set the python processor to use for the build tests # Note: you may need to change this for your own environment #PYTHON33=python3.3 #PYTHON27=python2.7 #PYTHON26=python2.6 PYTHON33=~/anaconda/envs/bumps3x/bin/python PYTHON27=~/anaconda/envs/bumps/bin/python PYTHON26=~/anaconda/envs/bumps26/bin/python #BROWSER=firefox # linux #PDFREADER=evince # linux #RST2HTML=rst2html # linux BROWSER=open # OSX PDFREADER=open # OSX RST2HTML=rst2html.py case "$1" in sync) step=0;; test) step=1;; doc) step=2;; notes) step=3;; web) step=4;; pypi) step=5;; *) step=0;; esac function ready() { stepname=$1; shift echo -n "$* [y/n] " read ans && test "$ans" != "y" \ && echo Restart with ./release.sh $stepname && exit } if [ $step -le 0 ]; then echo === Version control status === set -x git pull git status set +x ready sync Is the repository up to date? fi if [ $step -le 1 ]; then echo === Tests === set -x $PYTHON27 test.py -q --with-coverage $PYTHON26 test.py -q $PYTHON33 test.py -q set +x if false; then echo # Ask hudson build server if package is working on all platforms hudson_server="localhost:8080" elements_job="elements" url="http://$hudson_server/job/$elements_job/lastBuild" jsonurl="$url/api/json?depth=0" if curl --silent $jsonurl | grep -q SUCCESS ; then echo latest hudson build was successful else echo **** latest hudson build failed ... see $url $BROWSER $url & fi fi ready test Are the tests okay? fi if [ $step -le 2 ]; then echo === Documentation === (cd doc/sphinx && make clean html pdf) $BROWSER doc/sphinx/_build/html/index.html >/dev/null 2>&1 & $PDFREADER doc/sphinx/_build/latex/PeriodicTable.pdf >/dev/null 2>&1 & ready doc Does the documentation build correctly? fi if [ $step -le 3 ]; then echo === Release notes === $RST2HTML README.rst > /tmp/README.html $BROWSER /tmp/README.html >/dev/null 2>&1 & git log --format="%Cred%ad%Creset %s %Cred%an%Creset" --date=short version=$(grep __version__ periodictable/__init__.py | sed -e's/^.*= *//;s/"//g') echo *** Version is $version ready notes Are the release notes shown in the browser up to date? fi if [ $step -le 4 ]; then ready web: Push docs to the web? ssh reflectometry.org rm -r web/danse/docs/elements find doc/sphinx/_build/html | xargs chmod ug+rw find doc/sphinx/_build/html -type d | xargs chmod g+x (cd doc/sphinx/_build && scp -r html reflectometry.org:web/danse/docs/elements) ready web Documentation upload successful? fi if [ $step -le 5 ]; then ready Push package to pypi? git tag -a v$version -m "Release $version" git push --tags python setup.py sdist upload ready pypi Package upload successful? fi echo == All done! == periodictable-1.5.0/rtd-requirements000066400000000000000000000000311310514471200175500ustar00rootroot00000000000000periodictable numpy>=1.0 periodictable-1.5.0/setup.py000077500000000000000000000027401310514471200160410ustar00rootroot00000000000000#!/usr/bin/env python import sys import os from setuptools import setup, find_packages #import fix_setuptools_chmod import periodictable if len(sys.argv) == 1: sys.argv.append('install') dist = setup( name = 'periodictable', version = periodictable.__version__, author='Paul Kienzle', author_email='pkienzle@gmail.com', license='public domain', url='http://www.reflectometry.org/danse/elements.html', description='Extensible periodic table of the elements', long_description=open('README.rst').read() if os.path.exists('README.rst') else None, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Intended Audience :: Science/Research', 'License :: Public Domain', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'Topic :: Scientific/Engineering :: Chemistry', 'Topic :: Scientific/Engineering :: Physics', ], packages = find_packages(), include_package_data = True, package_data = { # NOTE: be sure to include files in MANIFEST.in as well 'periodictable' : ['activate.dat', 'xsf/*.nff', 'xsf/f0_WaasKirf.dat', 'xsf/read.me'], }, #data_files = periodictable.data_files(), install_requires = ['pyparsing', 'numpy'], ) # End of file periodictable-1.5.0/test.py000077500000000000000000000031221310514471200156530ustar00rootroot00000000000000#!/usr/bin/env python """ Usage: ./test.py - run all tests ./test.py --with-coverage - run all tests with coverage report """ import os, sys import nose # Check that we are running from the root. path = os.getcwd() assert os.path.exists(os.path.join(path,'periodictable','nsf.py')) # Make sure that we have a private version of mplconfig mplconfig = os.path.join(os.getcwd(),'.mplconfig') os.environ['MPLCONFIGDIR'] = mplconfig os.putenv('MPLCONFIGDIR',mplconfig) if not os.path.exists(mplconfig): os.mkdir(mplconfig) # Run the source tests with periodictable on the path. By manipulating # the path in this way, we can test without having to build and install. # We are adding doc/sphinx to the path because the periodic table extension # doctests need to be able to find the example extensions. sys.path.insert(0,path) sys.path.insert(1,os.path.join(path,'doc','sphinx')) nose_args = [__file__,'-v','--with-doctest','--doctest-extension=.rst', '--cover-package=periodictable'] nose_args += sys.argv[1:] # allow coverage arguments nose_args += ['test','periodictable','doc/sphinx/guide'] if not nose.run(argv=nose_args): sys.exit(1) # Run isolated tests in their own environment. In this case we will have # to set the PYTHONPATH environment variable before running since it is # happening in a separate process. if 'PYTHONPATH' in os.environ: PYTHONPATH = path + ":" + os.environ['PYTHONPATH'] else: PYTHONPATH = path os.putenv('PYTHONPATH', PYTHONPATH) for p in ("nsfd2o", ): ret = os.system(" ".join( (sys.executable, "test/test_%s.py"%p) )) if ret != 0: sys.exit() periodictable-1.5.0/test/000077500000000000000000000000001310514471200153005ustar00rootroot00000000000000periodictable-1.5.0/test/test_core.py000066400000000000000000000041271310514471200176450ustar00rootroot00000000000000from periodictable import H, O, Fe, helium, elements, data_files def test(): # Check that we can access element properties assert H.name == "hydrogen" assert H.symbol == "H" assert H.number == 1 assert helium.symbol == 'He' # Check that isotopes work and produce the correct strings and symbols O.add_isotope(18) assert H[2].symbol == 'D' assert H[3].symbol == 'T' assert O[18].symbol == 'O' assert str(H[2]) == 'D' assert str(H[3]) == 'T' assert str(O[18]) == '18-O' try: Fe[12] except KeyError as msg: assert msg.args[0] == '12 is not an isotope of Fe' # Check that "for el in elements" works and for iso in el works els = tuple(el for el in elements) assert els[0].number == 0 assert els[1].number == 1 isotopes = tuple(iso for iso in O) assert isotopes[0].isotope == 12 # 12 is the first oxygen isotope listed # Check that table lookup works and fails appropriately Fe.add_isotope(56) assert elements.symbol('Fe') == Fe assert elements.name('iron') == Fe assert elements.isotope('Fe') == Fe assert elements.isotope('56-Fe') == Fe[56] assert elements.isotope('D') == H[2] try: elements.symbol('Qu') except ValueError as msg: assert str(msg) == "unknown element Qu" try: elements.name('Qu') except ValueError as msg: assert str(msg) == "unknown element Qu" try: elements.isotope('Qu') except ValueError as msg: assert str(msg) == "unknown element Qu" try: elements.isotope('4-D') except ValueError as msg: assert str(msg) == "unknown element 4-D" # Check that ions work assert Fe.ion[2].charge == 2 assert Fe.ions == (-4, -2, -1, 1, 2, 3, 4, 5, 6, 7) assert str(Fe.ion[2]) == "Fe{2+}" assert str(O.ion[-2]) == "O{2-}" try: Fe.ion[-3] raise Exception("accepts invalid ions") except ValueError as msg: assert str(msg) == "-3 is not a valid charge for Fe" assert data_files()[0][0] == "periodictable-data/xsf" if __name__ == "__main__": test() periodictable-1.5.0/test/test_covalent_radius.py000066400000000000000000000004501310514471200220720ustar00rootroot00000000000000from periodictable import elements def test(): #assert elements.Po.covalent_radius == 1.53 assert elements.Po.covalent_radius == 1.40 assert elements.Po.covalent_radius_uncertainty == 0.04 assert elements.Po.covalent_radius_units == 'angstrom' if __name__ == "__main__": test() periodictable-1.5.0/test/test_crystal_structure.py000066400000000000000000000004201310514471200225060ustar00rootroot00000000000000from periodictable import elements import periodictable.crystal_structure def test(): xtal = elements.Hg.crystal_structure assert xtal['symmetry'] == 'Rhombohedral' assert xtal['a'] == 2.99 assert xtal['alpha'] == 70.45 if __name__ == "__main__": test() periodictable-1.5.0/test/test_density.py000066400000000000000000000014341310514471200203720ustar00rootroot00000000000000from periodictable import elements def test(): assert elements.Cm.density == 13.51 assert elements.Cm.density_caveat == "calculated" assert elements.Cm.density_units == "g/cm^3" assert elements.D.density == elements.H.density * elements.D.mass/elements.H.mass # check number density and unit cell width assert abs(elements.Ca.interatomic_distance - 3.50166387163) < 1e-10 assert abs(elements.Fe.number_density - 8.4910635606518029e+22) < 1e12 assert elements.Ca.interatomic_distance_units == "angstrom" assert elements.Fe.number_density_units == "1/cm^3" #elements.list('symbol','density','density_caveat', format="%3s %10s %s") #import mass #mass.init() #elements.list('symbol','interatomic_distance') if __name__ == "__main__": test() periodictable-1.5.0/test/test_formulas.py000066400000000000000000000201511310514471200205400ustar00rootroot00000000000000from __future__ import division from copy import deepcopy from pickle import loads, dumps from periodictable import Ca, C, O, H, Fe, Ni, Si, D, Na, Cl, Co, Ti from periodictable import formula, mix_by_weight, mix_by_volume def test(): ikaite = formula() # Note: this should be a tuple of tuples ikaite.structure = ((1, Ca), (1, C), (3, O), (6, ((2, H), (1, O)))) # Test print assert str(ikaite) == "CaCO3(H2O)6" # Test constructors assert ikaite == formula([(1, Ca), (1, C), (3, O), (6, [(2, H), (1, O)])]) assert ikaite == formula(ikaite) assert ikaite is not formula(ikaite) assert ikaite.structure is formula(ikaite).structure # Test parsers assert formula("Ca") == formula([(1, Ca)]) assert formula("Ca") == formula(Ca) assert formula("CaCO3") == formula([(1, Ca), (1, C), (3, O)]) assert ikaite == formula("CaCO3+6H2O") assert ikaite == formula("(CaCO3+6H2O)1") assert ikaite == formula("CaCO3 6H2O") assert ikaite == formula("CaCO3(H2O)6") assert ikaite == formula("(CaCO3(H2O)6)1") assert ikaite.hill == formula("CCaO3(H2O)6").hill assert str(ikaite.hill) == "CH12CaO9" assert formula([(0.75, Fe), (0.25, Ni)]) == formula("Fe0.75Ni0.25") # Test composition #print formula("CaCO3") + 6*formula("H2O") assert ikaite == formula("CaCO3") + 6*formula("H2O") f = formula('') assert not (3*f).structure f = formula('H2O') assert id((1*f).structure) == id(f.structure) # Check atom count assert formula("Fe2O4+3H2O").atoms == {Fe: 2, O: 7, H: 6} # Check charge assert formula("P{5+}O{2-}4").charge == -3 try: formula("P{18-}") raise Exception("No exception raised for invalid charge") except ValueError: pass assert formula("Na{+}Cl{-}").charge == 0 Na_frac = Na.ion[1].mass/(Na.ion[1].mass+Cl.ion[-1].mass) assert abs(formula("Na{+}Cl{-}").mass_fraction[Na.ion[1]] - Na_frac) < 1e-14 # Check the mass calculator assert formula('H2O').mass == 2*H.mass+O.mass assert formula("Fe2O4+3H2O").mass == 2*Fe.mass+7*O.mass+6*H.mass assert (formula("Fe2O[18]4+3H2O").mass == 2*Fe.mass+4*O[18].mass+3*O.mass+6*H.mass) # Check natural density support assert (formula('D2O', natural_density=1).density == (2*D.mass + O.mass)/(2*H.mass + O.mass)) D2O = formula('D2O', natural_density=1) D2Os = formula('D2O') D2Os.natural_density = 1 assert abs(D2O.density - D2Os.density) < 1e-14 assert abs(D2O.natural_density - 1) < 1e-14 assert abs(D2Os.natural_density - 1) < 1e-14 # Test isotopes; make sure this is last since it changes ikaite! assert ikaite != formula("CaCO[18]3+6H2O") assert formula("O[18]").mass == O[18].mass # Check x-ray and neutron sld rho, mu, inc = formula('Si', Si.density).neutron_sld(wavelength=4.5) rhoSi, muSi, incSi = Si.neutron.sld(wavelength=4.5) assert abs(rho - rhoSi) < 1e-14 assert abs(mu - muSi) < 1e-14 assert abs(inc - incSi) < 1e-14 rho, mu = formula('Si', Si.density).xray_sld(wavelength=1.54) rhoSi, muSi = Si.xray.sld(wavelength=1.54) assert abs(rho - rhoSi) < 1e-14 assert abs(mu - muSi) < 1e-14 # Check that names work permalloy = formula('Ni8Fe2', 8.692, name='permalloy') assert str(permalloy) == 'permalloy' # Check that get/restore state works assert deepcopy(permalloy).__dict__ == permalloy.__dict__ # Check that copy constructor works #print permalloy.__dict__ #print formula(permalloy).__dict__ assert formula(permalloy).__dict__ == permalloy.__dict__ assert formula('Si', name='Silicon').__dict__ != formula('Si').__dict__ H2O = formula('H2O', natural_density=1) D2O = formula('D2O', natural_density=1) fm = mix_by_weight(H2O, 3, D2O, 2) fv = mix_by_volume(H2O, 3, D2O, 2) # quantity of H+D should stay in 2:1 ratio with O assert abs(fv.atoms[H]+fv.atoms[D] - 2*fv.atoms[O]) < 1e-14 assert abs(fm.atoms[H]+fm.atoms[D] - 2*fm.atoms[O]) < 1e-14 # H:D ratio should match H2O:D2O ratio when mixing by volume, but should # be skewed toward the lighter H when mixing by mass. assert abs(fv.atoms[H]/fv.atoms[D] - 1.5) < 1e-14 assert abs(fm.atoms[H]/fm.atoms[D] - 1.5*D2O.density/H2O.density) < 1e-14 # Mass densities should average according to H2O:D2O ratio when # mixing by volume but be skewed toward toward the more plentiful # H2O when mixing by mass H2O_fraction = 0.6 assert abs(fv.density - (H2O.density*H2O_fraction + D2O.density*(1-H2O_fraction))) < 1e-14 H2O_fraction = (3/H2O.density) / (3/H2O.density + 2/D2O.density) assert abs(fm.density - (H2O.density*H2O_fraction + D2O.density*(1-H2O_fraction))) < 1e-14 # Make sure we are independent of unit cell size H2O = formula('3.2H2O', natural_density=1) D2O = formula('4.1D2O', natural_density=1) fm = mix_by_weight(H2O, 3, D2O, 2) fv = mix_by_volume(H2O, 3, D2O, 2) # quantity of H+D should stay in 2:1 ratio with O assert abs(fv.atoms[H]+fv.atoms[D] - 2*fv.atoms[O]) < 1e-14 assert abs(fm.atoms[H]+fm.atoms[D] - 2*fm.atoms[O]) < 1e-14 # H:D ratio should match H2O:D2O ratio when mixing by volume, but should # be skewed toward the lighter H when mixing by mass. assert abs(fv.atoms[H]/fv.atoms[D] - 1.5) < 1e-14 assert abs(fm.atoms[H]/fm.atoms[D] - 1.5*D2O.density/H2O.density) < 1e-14 # Mass densities should average according to H2O:D2O ratio when # mixing by volume but be skewed toward toward the more plentiful # H2O when mixing by mass H2O_fraction = 0.6 assert abs(fv.density - (H2O.density*H2O_fraction + D2O.density*(1-H2O_fraction))) < 1e-14 H2O_fraction = (3/H2O.density) / (3/H2O.density + 2/D2O.density) assert abs(fm.density - (H2O.density*H2O_fraction + D2O.density*(1-H2O_fraction))) < 1e-14 # Pickle test assert loads(dumps(fm)) == fm ion = Fe[56].ion[2] assert id(loads(dumps(ion))) == id(ion) # zero quantities tests in mixtures f = mix_by_weight(H2O, 0, D2O, 2) assert f == D2O f = mix_by_weight(H2O, 2, D2O, 0) assert f == H2O f = mix_by_weight(H2O, 0, D2O, 0) assert f == formula() f = mix_by_volume(H2O, 0, D2O, 2) assert f == D2O f = mix_by_volume(H2O, 2, D2O, 0) assert f == H2O f = mix_by_volume(H2O, 0, D2O, 0) assert f == formula() # mix by weight with unknown component density # can't do mix by volume without component densities glass = mix_by_weight('SiO2', 75, 'Na2O', 15, 'CaO', 10, density=2.52) # layers and mixtures check_formula(formula('1mm Fe // 1mm Ni'), formula('50%vol Fe // Ni')) check_formula(formula('50%vol Co // Ti'), formula('2mL Co // 2mL Ti')) check_formula(formula('50%wt Co // Ti'), formula('2g Co // 2g Ti')) check_formula(formula('2mL Co // 2mL Ti'), formula(((1.5922466356368357, Co), (1, Ti)))) check_formula(formula('2g Co // 2g Ti'), formula(((1, Co), (1.231186412350889, Ti)))) check_formula(formula('5g NaCl // 50mL H2O@1'), formula('5g NaCl // 50g H2O')) check_formula(formula('5g NaCl // 50mL H2O@1'), formula(((1, Na), (1, Cl), (32.4407, ((2, H), (1, O))))), tol=1e-5) assert abs(formula('1mm Fe // 1mm Ni').thickness - 0.002) < 0.002*1e014 assert abs(formula('2g Co // 2g Ti').total_mass - 4) < 4*1e-14 check_mass(formula('2mL Co // 2mL Ti'), mass=2*(Co.density+Ti.density)) check_mass(formula("50 g (49 mL H2O@1 // 1 g NaCl) // 20 mL D2O@1n"), mass=50 + 20*D2O.density) check_mass(formula("50 mL (45 mL H2O@1 // 5 g NaCl)@1.0707 // 20 mL D2O@1n"), mass=50*1.0707 + 20*D2O.density) # fasta check_formula(formula('aa:A'), formula('C3H5NO')) def check_mass(f1, mass, tol=1e-14): """Check that the total mass of f1 is as expected.""" assert abs(f1.total_mass - mass) < mass*tol def check_formula(f1, f2, tol=1e-14): """Check that the number of atoms in f1 and f2 are about equal.""" f2_atoms = f2.atoms for atom, count in f1.atoms.items(): if atom not in f2_atoms or abs(f2_atoms[atom] - count) > tol*count: raise RuntimeError("Formulas differ: %s and %s"%(f1, f2)) if __name__ == "__main__": test() periodictable-1.5.0/test/test_magnetic_ff.py000066400000000000000000000003541310514471200211550ustar00rootroot00000000000000from periodictable import elements def test(): A,a,B,b,C,c,D = elements.Fe.magnetic_ff[2].j0 assert b == 15.9435 ion = elements.Fe.ion[2] assert ion.magnetic_ff[ion.charge].j0[3] == b if __name__ == "__main__": test() periodictable-1.5.0/test/test_mass.py000066400000000000000000000030501310514471200176520ustar00rootroot00000000000000import periodictable def test(): assert periodictable.Be[12].mass == 12.026921 assert periodictable.Be.mass == 9.012182 assert abs(periodictable.Be[12].ion[2].mass - (12.026921 - 2*periodictable.constants.electron_mass))<1e-12 assert abs(periodictable.Be.ion[2].mass - (9.012182 - 2*periodictable.constants.electron_mass))<1e-12 assert periodictable.Pb[206].abundance == 24.1 assert periodictable.Pb[209].abundance == 0 assert periodictable.Pb.mass == 207.2 assert periodictable.n.mass == 1.00866491597 # Check abundance totals to 0% or 100% for el in periodictable.elements: abundance=0 for iso in el: if iso.abundance == None: print("%s abundance=None"%iso) else: abundance += iso.abundance assert abs(abundance-100) < 1e-4 or abundance==0,\ "total abundance for %s is %.15g%%"%(el.symbol,abundance) # Check average mass corresponds to abundance information # Note: should check that this is true within uncertainty, but # uncertainties are not being loaded. for el in periodictable.elements: abundance=0 mass=0 for iso in el: if iso.abundance == None: print("%s abundance=None"%iso) else: abundance += iso.abundance mass += iso.mass*iso.abundance/100. assert abundance==0 or abs(mass - el.mass)/el.mass < 1e-3,\ "avg mass for %s is %g != %g"%(el.symbol,el.mass,mass) if __name__ == "__main__": test() periodictable-1.5.0/test/test_nsf.py000066400000000000000000000240511310514471200175010ustar00rootroot00000000000000import numpy import periodictable from periodictable import elements, formula, nsf from periodictable.nsf import neutron_scattering, neutron_sld from math import sqrt, pi def test(): H,He,D,O = elements.H,elements.He,elements.D,elements.O assert H.neutron.absorption == 0.3326 assert H.neutron.total == 82.02 assert H.neutron.incoherent == 80.26 assert H.neutron.coherent == 1.7568 assert elements.Ru[101].neutron.bp == None assert H[1].nuclear_spin == '1/2' assert H[2].nuclear_spin == '1' assert not H[6].neutron.has_sld() assert He[3].neutron.b_c_i == -1.48 assert He[3].neutron.bm_i == -5.925 Nb = elements.Nb assert Nb.neutron.absorption == Nb[93].neutron.absorption # Check that b_c values match abundance-weighted values # Note: Currently they do not for match within 5% for Ar,V,Sm or Gd for el in elements: if not hasattr(el,'neutron'): continue b_c = 0 complete = True for iso in el: if iso.neutron != None: if iso.neutron.b_c == None: complete = False else: b_c += iso.neutron.b_c*iso.neutron.abundance/100. if complete and b_c != 0 and abs((b_c-el.neutron.b_c)/b_c) > 0.05: err = abs((b_c-el.neutron.b_c)/b_c) ## Printing suppressed for the release version #print("%2s %.3f % 7.3f % 7.3f"%(el.symbol,err,b_c,el.neutron.b_c)) # Check neutron_sld and neutron_xs against NIST calculator # Note that we are using different tables, so a general comparison with # NIST numbers is not possible, but ^30Si and ^18O are the same in both. M = formula('Si[30]O[18]2',density=2.2) sld,xs,depth = neutron_scattering(M,wavelength=4.75) sld2 = neutron_sld(M,wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) #_summarize(M) #_summarize(formula('O2',density=1.14)) # Alan's numbers: assert abs(sld[0] - 3.27) < 0.01 assert abs(sld[1] - 0) < 0.01 #assert abs(xs[2] - 0.00292) < 0.00001 # TODO fix test assert abs(xs[1] - 0.00569) < 0.00001 #assert abs(depth - 4.329) < 0.001 # TODO fix test # Cu/Mo K-alpha = 1.89e-5 + 2.45e-7i / 1.87e-5 + 5.16e-8i Ni,Si = elements.Ni, elements.Si # Make sure molecular calculation corresponds to direct calculation sld = neutron_sld('Si',density=Si.density,wavelength=4.75) sld2 = Si.neutron.sld(wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) sld,_,_ = Si.neutron.scattering(wavelength=4.75) sld2 = Si.neutron.sld(wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) sld,xs,depth = neutron_scattering('Si',density=Si.density,wavelength=4.75) sld2,xs2,depth2 = Si.neutron.scattering(wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) assert all(abs(v-w)<1e-10 for v,w in zip(xs,xs2)) assert abs(depth-depth2) < 1e-14 # incoherent cross sections for Ni[62] used to be negative sld,xs,depth = neutron_scattering('Ni[62]',density=Ni[62].density, wavelength=4.75) assert sld[2] == 0 and xs[2] == 0 sld,xs,depth = Ni[62].neutron.scattering(wavelength=4.75) assert sld[2] == 0 and xs[2] == 0 assert Ni[62].neutron.sld()[2] == 0 # Test call from periodictable sld,xs,depth = periodictable.neutron_scattering('H2O',density=1,wavelength=4.75) sld2,xs2,depth2 = neutron_scattering('H2O',density=1,wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) assert all(abs(v-w)<1e-10 for v,w in zip(xs,xs2)) assert depth==depth2 sld = periodictable.neutron_sld('H2O',density=1,wavelength=4.75) assert all(abs(v-w)<1e-10 for v,w in zip(sld,sld2)) # Check empty formula sld,xs,depth = neutron_scattering('',density=0,wavelength=4.75) assert all(v == 0 for v in sld) assert all(v == 0 for v in xs) assert numpy.isinf(depth) # Check density == 0 works sld,xs,depth = neutron_scattering('Si',density=0,wavelength=4.75) assert all(v == 0 for v in sld) assert all(v == 0 for v in xs) assert numpy.isinf(depth) # Test natural density D2O_density = (2*D.mass + O.mass)/(2*H.mass + O.mass) sld,xs,depth = neutron_scattering('D2O',natural_density=1,wavelength=4.75) sld2,xs2,depth2 = neutron_scattering('D2O',density=D2O_density,wavelength=4.75) assert all(abs(v-w)<1e-14 for v,w in zip(sld,sld2)) assert all(abs(v-w)<1e-14 for v,w in zip(xs,xs2)) assert abs(depth-depth2)<1e-14 # Test that sld depends on density not on the size of the unit cell D2O_density = (2*D.mass + O.mass)/(2*H.mass + O.mass) sld,xs,depth = neutron_scattering('D2O',natural_density=1,wavelength=4.75) sld2,xs2,depth2 = neutron_scattering('2D2O',natural_density=1,wavelength=4.75) assert all(abs(v-w)<1e-14 for v,w in zip(sld,sld2)) assert all(abs(v-w)<1e-14 for v,w in zip(xs,xs2)) assert abs(depth-depth2)<1e-14 # Test energy <=> velocity <=> wavelength assert abs(nsf.neutron_wavelength_from_velocity(2200) - 1.7981972618436388) < 1e-14 assert abs(nsf.neutron_wavelength(25) - 1.8) < 0.1 assert abs(nsf.neutron_energy(nsf.neutron_wavelength(25)) - 25) < 1e-14 # Confirm scattering functions accept energy and wavelength sld,xs,depth = neutron_scattering('H2O',density=1,wavelength=4.75) sld2,xs2,depth2 = neutron_scattering('H2O',density=1,energy=nsf.neutron_energy(4.75)) assert all(abs(v-w)<1e-14 for v,w in zip(sld,sld2)) assert all(abs(v-w)<1e-14 for v,w in zip(xs,xs2)) assert abs(depth-depth2)<1e-14 def test_formula(): M = formula('B4C', density=2.52) sld,xs,depth = neutron_scattering(M,wavelength=4.75) # Compare to Alan Munter's numbers: # SLD=7.65e-6 - 2.34e-7i /A^2 # inc,abs XS = 0.193, 222.4 / cm # 1/e = 0.004483 cm # Cu/Mo K-alpha = 2.02e-5 + 1.93e-8i / 2.01e-5 + 4.64e-9i # Using lambda=1.798 rather than 1.8 # abs XS => 222.6 # 1/e => 0.004478 assert abs(sld[0]-7.649)<0.001 assert abs(sld[1]-0.234)<0.001 assert abs(xs[1]-222.6)<0.1 #assert abs(xs[2]-0.193)<0.001 # TODO: fix test #assert abs(depth-0.004478)<0.000001 # TODO: fix test # Check that sld_inc and coh_xs are consistent # cell_volume = (molar_mass/density) / N_A * 1e24 # number_density = num_atoms/cell_volume # sigma_i = inc_xs/number_density # sld_inc = number_density * sqrt ( 100/(4*pi) * sigma_i ) * 10 # sld_re = number_density * b_c * 10 # sigma_c = 4*pi/100*b_c**2 # coh_xs = sigma_c * number_density Nb = 0.13732585020640778 sld_inc = Nb*sqrt(100/(4*pi)*xs[2]/Nb)*10 coh_xs = Nb*4*pi/100*(sld[0]/(10*Nb))**2 assert abs(sld[2] - sld_inc) < 1e-14 assert abs(xs[0] - coh_xs) < 1e-14 def test_composite(): from periodictable.nsf import neutron_composite_sld calc = neutron_composite_sld([formula(s) for s in ('HSO4','H2O','CCl4')], wavelength=4.75) sld = calc(numpy.array([3,1,2]),density=1.2) sld2 = neutron_sld('3HSO4+1H2O+2CCl4',density=1.2,wavelength=4.75) #print(sld) #print(sld2) assert all(abs(v-w)<1e-14 for v,w in zip(sld,sld2)) def time_composite(): from periodictable.nsf import neutron_composite_sld import time calc = neutron_composite_sld([formula(s) for s in ('HSO4','H2O','CCl4')], wavelength=4.75) q = numpy.array([3,1,2]) N = 1000 bits = [formula(s) for s in ('HSO4','H2O','CCl4')] tic = time.time() for i in range(N): sld = calc(q,density=1.2) toc = time.time()-tic print("composite %.1f us"%(toc/N*1e6)) tic = time.time() for i in range(N): sld = neutron_sld(q[0]*bits[0]+q[1]*bits[1]+q[2]*bits[2], density=1.2,wavelength=4.75) toc = time.time()-tic print("direct %.1f us"%(toc/N*1e6)) def test_abundance(): # Check abundance totals to 0% or 100% for el in elements: if not hasattr(el,'neutron'): continue abundance=0 for iso in el: if iso.neutron == None: continue if not hasattr(iso.neutron,'abundance'): print("abundance missing for %s"%iso) if iso.neutron.abundance == None: print("%s abundance=None"%iso) else: abundance += iso.neutron.abundance # TODO: abundance tables are not very good assert abs(abundance-100) < 1.1 or abundance==0,\ "total abundance for %s is %.15g%%"%(el.symbol,abundance) def _summarize(M): from periodictable.nsf import neutron_sld, neutron_xs sld = neutron_sld(M,wavelength=4.75) xs = neutron_xs(M,wavelength=4.75) print("%s sld %s"%(M,sld)) print("%s xs %s 1/e %s"%(M,xs,1/sum(xs))) #return for el in list(M.atoms.keys()): print("%s density %s"%(el,el.density)) print("%s sld %s"%(el,el.neutron.sld(wavelength=4.75))) print("%s xs"%el + " %.15g %.15g %.15g"%el.neutron.xs(wavelength=4.75)) print("%s 1/e %s"%(el,1./sum(el.neutron.xs(wavelength=4.75)))) def molecule_table(): # Table of scattering length densities for various molecules print("SLDS for some molecules") for molecule,density in [('SiO2',2.2),('B4C',2.52)]: atoms = formula(molecule).atoms rho,mu,inc = neutron_sld(atoms,density,wavelength=4.75) print("%s(%g g/cm**3) rho=%.4g mu=%.4g inc=%.4g" %(molecule,density,rho,mu,inc)) def show_tables(): molecule_table() periodictable.nsf.sld_table(4.75) periodictable.nsf.energy_dependent_table() periodictable.nsf.total_comparison_table() periodictable.nsf.coherent_comparison_table() periodictable.nsf.incoherent_comparison_table() print("""\ Specific elements with b_c values different from Neutron News 1992. This is not a complete list.""") for sym in ['Sc','Te','Xe','Sm','Eu','Gd','W','Au','Hg']: el = getattr(elements,sym) print("%s %s %s %s %s"%(el.symbol,el.neutron.b_c,el.neutron.coherent, el.neutron.incoherent,el.neutron.absorption)) if __name__ == "__main__": time_composite() periodictable-1.5.0/test/test_nsfd2o.py000077500000000000000000000010771310514471200201140ustar00rootroot00000000000000#!/usr/bin/env python import periodictable def test(): # Regression test: make sure neutron sld is an isotope property # Note: it is important that this test be run separately D2O = periodictable.formula('D2O',density=20./18) D2O_coh,D2O_abs,D2O_inc = periodictable.neutron_sld(D2O) D2O_coh2,D2O_abs2,D2O_inc2 = periodictable.neutron_sld(D2O) H2O = periodictable.formula('H2O',density=1) H2O_coh,H2O_abs,H2O_inc = periodictable.neutron_sld(H2O) assert D2O_coh == D2O_coh2 assert D2O_coh != H2O_coh if __name__ == "__main__": test() periodictable-1.5.0/test/test_private.py000066400000000000000000000034621310514471200203700ustar00rootroot00000000000000from periodictable import elements, formula, mix_by_weight, mix_by_volume from periodictable.core import PeriodicTable from periodictable import (mass, density, xsf, nsf, formulas, crystal_structure, covalent_radius) def test(): # Create private table private = PeriodicTable("mine") mass.init(private) density.init(private) xsf.init(private) nsf.init(private) crystal_structure.init(private) covalent_radius.init(private) # Test that it matches public table assert elements.Cm.mass == private.Cm.mass assert elements.Cm.density == private.Cm.density assert elements.Cm.crystal_structure == private.Cm.crystal_structure assert elements.Cm.covalent_radius == private.Cm.covalent_radius slde,abse = elements.Cm.xray.sld(energy=8) sldp,absp = private.Cm.xray.sld(energy=8) assert slde == sldp assert abse == absp # Check that modifications to private table don't change public table. private.Cm._mass = elements.Cm.mass+1 assert elements.Cm.mass != private.Cm.mass private.Cm._density = elements.Cm.density+1 assert elements.Cm.density != private.Cm.density private.Cm.covalent_radius = elements.Cm.covalent_radius+1 assert elements.Cm.covalent_radius != private.Cm.covalent_radius private.Cm.xray.newfield = 5 assert not hasattr(elements.Cm.xray,'newfield') # Check that the formula parser can use a private table privateH2O = formula('H2O', table=private) publicH2O = formula('H2O', table=elements) for el in privateH2O.atoms.keys(): assert id(el) == id(private[el.number]) assert privateH2O != publicH2O assert str(privateH2O) == str(publicH2O) assert privateH2O == publicH2O.change_table(private) private.H._mass = 1 assert formula('H2',table=private).mass == 2 periodictable-1.5.0/test/test_xsf.py000066400000000000000000000126301310514471200175130ustar00rootroot00000000000000import numpy from numpy import pi, isnan from periodictable import formula from periodictable import Cu,Mo,Ni,Fe,Si,H,D,O from periodictable.xsf import xray_energy, xray_sld_from_atoms, xray_sld from periodictable.xsf import index_of_refraction, mirror_reflectivity def test_xsf(): # Check some K_alpha and K_beta1 values assert Cu.K_alpha == 1.5418 assert Cu.K_beta1 == 1.3922 # Check scalar scattering factor lookup f1,f2 = Ni.xray.scattering_factors(energy=xray_energy(Cu.K_alpha)) assert abs(f1-25.0229)<0.0001 assert abs(f2-0.5249)<0.0001 # Check array scattering factor lookup f1,f2 = Ni.xray.scattering_factors(wavelength=Cu.K_alpha) m1,m2 = Ni.xray.scattering_factors(wavelength=Mo.K_alpha) B1,B2 = Ni.xray.scattering_factors(wavelength=[Cu.K_alpha,Mo.K_alpha]) assert (B1==[f1,m1]).all() and (B2==[f2,m2]).all() # Check that we can lookup sld by wavelength and energy Fe_rho,Fe_mu = Fe.xray.sld(wavelength=Cu.K_alpha) assert abs(Fe_rho-59.45) < 0.01 Si_rho,Si_mu = Si.xray.sld(energy=8.050) assert abs(Si_rho-20.0701) < 0.0001 assert abs(Si_mu-0.4572) < 0.0001 # Check that wavelength is the default Fe_rho_default,Fe_mu_default = Fe.xray.sld(wavelength=Cu.K_alpha) assert Fe_rho == Fe_rho_default and Fe_mu == Fe_mu_default # Check array form of sld lookup f1,f2 = Si.xray.sld(wavelength=Cu.K_alpha) m1,m2 = Si.xray.sld(wavelength=Mo.K_alpha) B1,B2 = Si.xray.sld(wavelength=[Cu.K_alpha,Mo.K_alpha]) assert (B1==[f1,m1]).all() and (B2==[f2,m2]).all() # Check energy conversion is consistent f1,f2 = Si.xray.sld(energy=xray_energy(Cu.K_alpha)) m1,m2 = Si.xray.sld(energy=xray_energy(Mo.K_alpha)) assert (B1==[f1,m1]).all() and (B2==[f2,m2]).all() B1,B2 = Si.xray.sld(energy=xray_energy([Cu.K_alpha,Mo.K_alpha])) assert (B1==[f1,m1]).all() and (B2==[f2,m2]).all() #print Cu.xray.sftable #plot_xsf(Cu) #emission_table() #sld_table(table,Cu.K_alpha) """ # Table of scattering length densities for various molecules for molecule,density in [('SiO2',2.2),('B4C',2.52)]: atoms = formula(molecule).atoms rho,mu = xray_sld(atoms,density,wavelength=Cu.K_alpha) print "sld for %s(%g g/cm**3) rho=%.4g mu=%.4g"\ %(molecule,density,rho,mu) """ # Cross check against mo rho,mu = xray_sld({Si:1},density=Si.density,wavelength=1.54) rhoSi,muSi = Si.xray.sld(wavelength=1.54) assert abs(rho - rhoSi) < 1e-14 assert abs(mu - muSi) < 1e-14 # Check that xray_sld works as expected atoms = formula('SiO2').atoms rho,mu = xray_sld(atoms,density=2.2,energy=xray_energy(Cu.K_alpha)) assert abs(rho-18.87)<0.1 atoms = formula('B4C').atoms rho,mu = xray_sld(atoms,density=2.52,energy=xray_energy(Cu.K_alpha)) assert abs(rho-20.17)<0.1 F = formula('', density=0) rho,mu = xray_sld('', density=0, wavelength=Cu.K_alpha) assert rho==mu==0 # Check natural density calculations D2O_density = (2*D.mass + O.mass)/(2*H.mass + O.mass) rho,mu = xray_sld('D2O',natural_density=1,wavelength=1.54) rho2,mu2 = xray_sld('D2O',density=D2O_density,wavelength=1.54) assert abs(rho-rho2)<1e-14 and abs(mu-mu2)<1e-14 # Check f0 calculation for scalar, vector, array and empty Q1,Q2 = 4*pi/Cu.K_alpha, 4*pi/Mo.K_alpha f0 = Ni.xray.f0(Q=Q1) assert abs(f0-10.11303) < 0.00001 assert isnan(Ni.xray.f0(Q=7*4*pi)) f0 = Ni.xray.f0(Q=Q1) m0 = Ni.xray.f0(Q=Q2) B0 = Ni.xray.f0(Q=[Q1,Q2]) assert (B0==[f0,m0]).all() f0 = Ni.xray.f0(Q=[]) assert len(f0) == 0 f0 = Ni.xray.f0(Q=[[1,2],[3,4]]) assert f0[0,0] == Ni.xray.f0(1) assert f0[0,1] == Ni.xray.f0(2) assert f0[1,0] == Ni.xray.f0(3) assert f0[1,1] == Ni.xray.f0(4) # Check f0 calculation for ion Ni_2p_f0 = Ni.ion[2].xray.f0(Q=Q1) assert abs(Ni_2p_f0-10.09535) < 0.00001 Ni58_2p_f0 = Ni[58].ion[2].xray.f0(Q=Q1) assert Ni_2p_f0 == Ni58_2p_f0 # The following test is implementation specific, and is not guaranteed # to succeed if the extension interface changes. assert '_xray' not in Ni[58].__dict__ def test_refl(): # Note: io always works on unicode (python 2.x and 3.x), so tag the input # as unicode. The alternative is to import StringIO from six, but only # if six is already required for some other reason. from io import StringIO # http://henke.lbl.gov/optical_constants/mirror2.html data2=StringIO(u"""\ #SiO2 Rho=2.2, Sig=3.nm, P=1., 2.deg # Photon Energy (eV), Reflectivity 30.0000 0.900114 42.6000 0.894588 60.4919 0.888959 85.8984 0.867922 121.976 0.724582 173.205 0.742043 245.951 0.752193 349.250 0.752260 495.934 0.717134 704.226 0.392855 1000.00 5.563799E-02""") data3=StringIO(u"""\ #SiO2 Rho=2.2, Sig=3.nm, P=1., 3.deg # Photon Energy (eV), Reflectivity 30.0000 0.853800 42.6000 0.845758 60.4919 0.837342 85.8984 0.806430 121.976 0.611468 173.205 0.630653 245.951 0.633574 349.250 0.604126 495.934 0.317861 704.226 2.655170E-02 1000.00 1.240138E-03""") e,R2 = numpy.loadtxt(data2).T e,R3 = numpy.loadtxt(data3).T R = mirror_reflectivity(energy=e*1e-3,angle=[2,3],compound='SiO2',density=2.2, roughness=30) assert numpy.max(abs((R-numpy.vstack([R2,R3]))/R)) < 1e-4 def main(): test_xsf() test_refl() if __name__ == "__main__": main()