bumprace-1.5.4/0000777000175000017500000000000011754254553010337 500000000000000bumprace-1.5.4/depcomp0000755000175000017500000004224611217461066011631 00000000000000#! /bin/sh # depcomp - compile a program generating dependencies as side-effects scriptversion=2006-10-15.18 # Copyright (C) 1999, 2000, 2003, 2004, 2005, 2006 Free Software # Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA # 02110-1301, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Originally written by Alexandre Oliva . case $1 in '') echo "$0: No command. Try \`$0 --help' for more information." 1>&2 exit 1; ;; -h | --h*) cat <<\EOF Usage: depcomp [--help] [--version] PROGRAM [ARGS] Run PROGRAMS ARGS to compile a file, generating dependencies as side-effects. Environment variables: depmode Dependency tracking mode. source Source file read by `PROGRAMS ARGS'. object Object file output by `PROGRAMS ARGS'. DEPDIR directory where to store dependencies. depfile Dependency file to output. tmpdepfile Temporary file to use when outputing dependencies. libtool Whether libtool is used (yes/no). Report bugs to . EOF exit $? ;; -v | --v*) echo "depcomp $scriptversion" exit $? ;; esac if test -z "$depmode" || test -z "$source" || test -z "$object"; then echo "depcomp: Variables source, object and depmode must be set" 1>&2 exit 1 fi # Dependencies for sub/bar.o or sub/bar.obj go into sub/.deps/bar.Po. depfile=${depfile-`echo "$object" | sed 's|[^\\/]*$|'${DEPDIR-.deps}'/&|;s|\.\([^.]*\)$|.P\1|;s|Pobj$|Po|'`} tmpdepfile=${tmpdepfile-`echo "$depfile" | sed 's/\.\([^.]*\)$/.T\1/'`} rm -f "$tmpdepfile" # Some modes work just like other modes, but use different flags. We # parameterize here, but still list the modes in the big case below, # to make depend.m4 easier to write. Note that we *cannot* use a case # here, because this file can only contain one case statement. if test "$depmode" = hp; then # HP compiler uses -M and no extra arg. gccflag=-M depmode=gcc fi if test "$depmode" = dashXmstdout; then # This is just like dashmstdout with a different argument. dashmflag=-xM depmode=dashmstdout fi case "$depmode" in gcc3) ## gcc 3 implements dependency tracking that does exactly what ## we want. Yay! Note: for some reason libtool 1.4 doesn't like ## it if -MD -MP comes after the -MF stuff. Hmm. ## Unfortunately, FreeBSD c89 acceptance of flags depends upon ## the command line argument order; so add the flags where they ## appear in depend2.am. Note that the slowdown incurred here ## affects only configure: in makefiles, %FASTDEP% shortcuts this. for arg do case $arg in -c) set fnord "$@" -MT "$object" -MD -MP -MF "$tmpdepfile" "$arg" ;; *) set fnord "$@" "$arg" ;; esac shift # fnord shift # $arg done "$@" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi mv "$tmpdepfile" "$depfile" ;; gcc) ## There are various ways to get dependency output from gcc. Here's ## why we pick this rather obscure method: ## - Don't want to use -MD because we'd like the dependencies to end ## up in a subdir. Having to rename by hand is ugly. ## (We might end up doing this anyway to support other compilers.) ## - The DEPENDENCIES_OUTPUT environment variable makes gcc act like ## -MM, not -M (despite what the docs say). ## - Using -M directly means running the compiler twice (even worse ## than renaming). if test -z "$gccflag"; then gccflag=-MD, fi "$@" -Wp,"$gccflag$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" echo "$object : \\" > "$depfile" alpha=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ## The second -e expression handles DOS-style file names with drive letters. sed -e 's/^[^:]*: / /' \ -e 's/^['$alpha']:\/[^:]*: / /' < "$tmpdepfile" >> "$depfile" ## This next piece of magic avoids the `deleted header file' problem. ## The problem is that when a header file which appears in a .P file ## is deleted, the dependency causes make to die (because there is ## typically no way to rebuild the header). We avoid this by adding ## dummy dependencies for each header file. Too bad gcc doesn't do ## this for us directly. tr ' ' ' ' < "$tmpdepfile" | ## Some versions of gcc put a space before the `:'. On the theory ## that the space means something, we add a space to the output as ## well. ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; hp) # This case exists only to let depend.m4 do its work. It works by # looking at the text of this script. This case will never be run, # since it is checked for above. exit 1 ;; sgi) if test "$libtool" = yes; then "$@" "-Wp,-MDupdate,$tmpdepfile" else "$@" -MDupdate "$tmpdepfile" fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" if test -f "$tmpdepfile"; then # yes, the sourcefile depend on other files echo "$object : \\" > "$depfile" # Clip off the initial element (the dependent). Don't try to be # clever and replace this with sed code, as IRIX sed won't handle # lines with more than a fixed number of characters (4096 in # IRIX 6.2 sed, 8192 in IRIX 6.5). We also remove comment lines; # the IRIX cc adds comments like `#:fec' to the end of the # dependency line. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' | \ tr ' ' ' ' >> $depfile echo >> $depfile # The second pass generates a dummy entry for each header file. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' -e 's/$/:/' \ >> $depfile else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; aix) # The C for AIX Compiler uses -M and outputs the dependencies # in a .u file. In older versions, this file always lives in the # current directory. Also, the AIX compiler puts `$object:' at the # start of each line; $object doesn't have directory information. # Version 6 uses the directory in both cases. stripped=`echo "$object" | sed 's/\(.*\)\..*$/\1/'` tmpdepfile="$stripped.u" if test "$libtool" = yes; then "$@" -Wc,-M else "$@" -M fi stat=$? if test -f "$tmpdepfile"; then : else stripped=`echo "$stripped" | sed 's,^.*/,,'` tmpdepfile="$stripped.u" fi if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi if test -f "$tmpdepfile"; then outname="$stripped.o" # Each line is of the form `foo.o: dependent.h'. # Do two passes, one to just change these to # `$object: dependent.h' and one to simply `dependent.h:'. sed -e "s,^$outname:,$object :," < "$tmpdepfile" > "$depfile" sed -e "s,^$outname: \(.*\)$,\1:," < "$tmpdepfile" >> "$depfile" else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; icc) # Intel's C compiler understands `-MD -MF file'. However on # icc -MD -MF foo.d -c -o sub/foo.o sub/foo.c # ICC 7.0 will fill foo.d with something like # foo.o: sub/foo.c # foo.o: sub/foo.h # which is wrong. We want: # sub/foo.o: sub/foo.c # sub/foo.o: sub/foo.h # sub/foo.c: # sub/foo.h: # ICC 7.1 will output # foo.o: sub/foo.c sub/foo.h # and will wrap long lines using \ : # foo.o: sub/foo.c ... \ # sub/foo.h ... \ # ... "$@" -MD -MF "$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" # Each line is of the form `foo.o: dependent.h', # or `foo.o: dep1.h dep2.h \', or ` dep3.h dep4.h \'. # Do two passes, one to just change these to # `$object: dependent.h' and one to simply `dependent.h:'. sed "s,^[^:]*:,$object :," < "$tmpdepfile" > "$depfile" # Some versions of the HPUX 10.20 sed can't process this invocation # correctly. Breaking it into two sed invocations is a workaround. sed 's,^[^:]*: \(.*\)$,\1,;s/^\\$//;/^$/d;/:$/d' < "$tmpdepfile" | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; hp2) # The "hp" stanza above does not work with aCC (C++) and HP's ia64 # compilers, which have integrated preprocessors. The correct option # to use with these is +Maked; it writes dependencies to a file named # 'foo.d', which lands next to the object file, wherever that # happens to be. # Much of this is similar to the tru64 case; see comments there. dir=`echo "$object" | sed -e 's|/[^/]*$|/|'` test "x$dir" = "x$object" && dir= base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'` if test "$libtool" = yes; then tmpdepfile1=$dir$base.d tmpdepfile2=$dir.libs/$base.d "$@" -Wc,+Maked else tmpdepfile1=$dir$base.d tmpdepfile2=$dir$base.d "$@" +Maked fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" exit $stat fi for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" do test -f "$tmpdepfile" && break done if test -f "$tmpdepfile"; then sed -e "s,^.*\.[a-z]*:,$object:," "$tmpdepfile" > "$depfile" # Add `dependent.h:' lines. sed -ne '2,${; s/^ *//; s/ \\*$//; s/$/:/; p;}' "$tmpdepfile" >> "$depfile" else echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" "$tmpdepfile2" ;; tru64) # The Tru64 compiler uses -MD to generate dependencies as a side # effect. `cc -MD -o foo.o ...' puts the dependencies into `foo.o.d'. # At least on Alpha/Redhat 6.1, Compaq CCC V6.2-504 seems to put # dependencies in `foo.d' instead, so we check for that too. # Subdirectories are respected. dir=`echo "$object" | sed -e 's|/[^/]*$|/|'` test "x$dir" = "x$object" && dir= base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'` if test "$libtool" = yes; then # With Tru64 cc, shared objects can also be used to make a # static library. This mechanism is used in libtool 1.4 series to # handle both shared and static libraries in a single compilation. # With libtool 1.4, dependencies were output in $dir.libs/$base.lo.d. # # With libtool 1.5 this exception was removed, and libtool now # generates 2 separate objects for the 2 libraries. These two # compilations output dependencies in $dir.libs/$base.o.d and # in $dir$base.o.d. We have to check for both files, because # one of the two compilations can be disabled. We should prefer # $dir$base.o.d over $dir.libs/$base.o.d because the latter is # automatically cleaned when .libs/ is deleted, while ignoring # the former would cause a distcleancheck panic. tmpdepfile1=$dir.libs/$base.lo.d # libtool 1.4 tmpdepfile2=$dir$base.o.d # libtool 1.5 tmpdepfile3=$dir.libs/$base.o.d # libtool 1.5 tmpdepfile4=$dir.libs/$base.d # Compaq CCC V6.2-504 "$@" -Wc,-MD else tmpdepfile1=$dir$base.o.d tmpdepfile2=$dir$base.d tmpdepfile3=$dir$base.d tmpdepfile4=$dir$base.d "$@" -MD fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4" exit $stat fi for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4" do test -f "$tmpdepfile" && break done if test -f "$tmpdepfile"; then sed -e "s,^.*\.[a-z]*:,$object:," < "$tmpdepfile" > "$depfile" # That's a tab and a space in the []. sed -e 's,^.*\.[a-z]*:[ ]*,,' -e 's,$,:,' < "$tmpdepfile" >> "$depfile" else echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; #nosideeffect) # This comment above is used by automake to tell side-effect # dependency tracking mechanisms from slower ones. dashmstdout) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout, regardless of -o. "$@" || exit $? # Remove the call to Libtool. if test "$libtool" = yes; then while test $1 != '--mode=compile'; do shift done shift fi # Remove `-o $object'. IFS=" " for arg do case $arg in -o) shift ;; $object) shift ;; *) set fnord "$@" "$arg" shift # fnord shift # $arg ;; esac done test -z "$dashmflag" && dashmflag=-M # Require at least two characters before searching for `:' # in the target name. This is to cope with DOS-style filenames: # a dependency such as `c:/foo/bar' could be seen as target `c' otherwise. "$@" $dashmflag | sed 's:^[ ]*[^: ][^:][^:]*\:[ ]*:'"$object"'\: :' > "$tmpdepfile" rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" tr ' ' ' ' < "$tmpdepfile" | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; dashXmstdout) # This case only exists to satisfy depend.m4. It is never actually # run, as this mode is specially recognized in the preamble. exit 1 ;; makedepend) "$@" || exit $? # Remove any Libtool call if test "$libtool" = yes; then while test $1 != '--mode=compile'; do shift done shift fi # X makedepend shift cleared=no for arg in "$@"; do case $cleared in no) set ""; shift cleared=yes ;; esac case "$arg" in -D*|-I*) set fnord "$@" "$arg"; shift ;; # Strip any option that makedepend may not understand. Remove # the object too, otherwise makedepend will parse it as a source file. -*|$object) ;; *) set fnord "$@" "$arg"; shift ;; esac done obj_suffix="`echo $object | sed 's/^.*\././'`" touch "$tmpdepfile" ${MAKEDEPEND-makedepend} -o"$obj_suffix" -f"$tmpdepfile" "$@" rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" sed '1,2d' "$tmpdepfile" | tr ' ' ' ' | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" "$tmpdepfile".bak ;; cpp) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout. "$@" || exit $? # Remove the call to Libtool. if test "$libtool" = yes; then while test $1 != '--mode=compile'; do shift done shift fi # Remove `-o $object'. IFS=" " for arg do case $arg in -o) shift ;; $object) shift ;; *) set fnord "$@" "$arg" shift # fnord shift # $arg ;; esac done "$@" -E | sed -n -e '/^# [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' \ -e '/^#line [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' | sed '$ s: \\$::' > "$tmpdepfile" rm -f "$depfile" echo "$object : \\" > "$depfile" cat < "$tmpdepfile" >> "$depfile" sed < "$tmpdepfile" '/^$/d;s/^ //;s/ \\$//;s/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; msvisualcpp) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout, regardless of -o, # because we must use -o when running libtool. "$@" || exit $? IFS=" " for arg do case "$arg" in "-Gm"|"/Gm"|"-Gi"|"/Gi"|"-ZI"|"/ZI") set fnord "$@" shift shift ;; *) set fnord "$@" "$arg" shift shift ;; esac done "$@" -E | sed -n '/^#line [0-9][0-9]* "\([^"]*\)"/ s::echo "`cygpath -u \\"\1\\"`":p' | sort | uniq > "$tmpdepfile" rm -f "$depfile" echo "$object : \\" > "$depfile" . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s:: \1 \\:p' >> "$depfile" echo " " >> "$depfile" . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s::\1\::p' >> "$depfile" rm -f "$tmpdepfile" ;; none) exec "$@" ;; *) echo "Unknown depmode $depmode" 1>&2 exit 1 ;; esac exit 0 # Local Variables: # mode: shell-script # sh-indentation: 2 # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-end: "$" # End: bumprace-1.5.4/acinclude.m40000644000175000017500000001402111217461066012433 00000000000000# Configure paths for SDL # Sam Lantinga 9/21/99 # stolen from Manish Singh # stolen back from Frank Belew # stolen from Manish Singh # Shamelessly stolen from Owen Taylor dnl AM_PATH_SDL([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND]]]) dnl Test for SDL, and define SDL_CFLAGS and SDL_LIBS dnl AC_DEFUN(AM_PATH_SDL, [dnl dnl Get the cflags and libraries from the sdl-config script dnl AC_ARG_WITH(sdl-prefix,[ --with-sdl-prefix=PFX Prefix where SDL is installed (optional)], sdl_prefix="$withval", sdl_prefix="") AC_ARG_WITH(sdl-exec-prefix,[ --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)], sdl_exec_prefix="$withval", sdl_exec_prefix="") AC_ARG_ENABLE(sdltest, [ --disable-sdltest Do not try to compile and run a test SDL program], , enable_sdltest=yes) if test x$sdl_exec_prefix != x ; then sdl_args="$sdl_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_args="$sdl_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi AC_REQUIRE([AC_CANONICAL_TARGET]) AC_PATH_PROG(SDL_CONFIG, sdl-config, no) min_sdl_version=ifelse([$1], ,0.11.0,$1) AC_MSG_CHECKING(for SDL - version >= $min_sdl_version) no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdlconf_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdlconf_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" dnl dnl Now check if the installed SDL is sufficiently new. (Also sanity dnl checks the results of sdl-config to some extent dnl rm -f conf.sdltest AC_TRY_RUN([ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { printf("\n*** 'sdl-config --version' returned %d.%d.%d, but the minimum version\n", $sdl_major_version, $sdl_minor_version, $sdl_micro_version); printf("*** of SDL required is %d.%d.%d. If sdl-config is correct, then it is\n", major, minor, micro); printf("*** best to upgrade to the required version.\n"); printf("*** If sdl-config was wrong, set the environment variable SDL_CONFIG\n"); printf("*** to point to the correct copy of sdl-config, and remove the file\n"); printf("*** config.cache before re-running configure\n"); return 1; } } ],, no_sdl=yes,[echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then AC_MSG_RESULT(yes) ifelse([$2], , :, [$2]) else AC_MSG_RESULT(no) if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_TRY_LINK([ #include #include "SDL.h" int main(int argc, char *argv[]) { return 0; } #undef main #define main K_and_R_C_main ], [ return 0; ], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH"], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" ]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(SDL_CFLAGS) AC_SUBST(SDL_LIBS) rm -f conf.sdltest ]) bumprace-1.5.4/Makefile.am0000644000175000017500000000011511217461066012275 00000000000000 SUBDIRS = data src EXTRA_DIST = FAQ macosx distdir = $(PACKAGE)-$(VERSION)bumprace-1.5.4/INSTALL0000644000175000017500000002231011217461066011273 00000000000000Installation Instructions ************************* Copyright (C) 1994, 1995, 1996, 1999, 2000, 2001, 2002, 2004, 2005, 2006 Free Software Foundation, Inc. This file is free documentation; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. Basic Installation ================== Briefly, the shell commands `./configure; make; make install' should configure, build, and install this package. The following more-detailed instructions are generic; see the `README' file for instructions specific to this package. The `configure' shell script attempts to guess correct values for various system-dependent variables used during compilation. It uses those values to create a `Makefile' in each directory of the package. It may also create one or more `.h' files containing system-dependent definitions. Finally, it creates a shell script `config.status' that you can run in the future to recreate the current configuration, and a file `config.log' containing compiler output (useful mainly for debugging `configure'). It can also use an optional file (typically called `config.cache' and enabled with `--cache-file=config.cache' or simply `-C') that saves the results of its tests to speed up reconfiguring. Caching is disabled by default to prevent problems with accidental use of stale cache files. If you need to do unusual things to compile the package, please try to figure out how `configure' could check whether to do them, and mail diffs or instructions to the address given in the `README' so they can be considered for the next release. If you are using the cache, and at some point `config.cache' contains results you don't want to keep, you may remove or edit it. The file `configure.ac' (or `configure.in') is used to create `configure' by a program called `autoconf'. You need `configure.ac' if you want to change it or regenerate `configure' using a newer version of `autoconf'. The simplest way to compile this package is: 1. `cd' to the directory containing the package's source code and type `./configure' to configure the package for your system. Running `configure' might take a while. While running, it prints some messages telling which features it is checking for. 2. Type `make' to compile the package. 3. Optionally, type `make check' to run any self-tests that come with the package. 4. Type `make install' to install the programs and any data files and documentation. 5. You can remove the program binaries and object files from the source code directory by typing `make clean'. To also remove the files that `configure' created (so you can compile the package for a different kind of computer), type `make distclean'. There is also a `make maintainer-clean' target, but that is intended mainly for the package's developers. If you use it, you may have to get all sorts of other programs in order to regenerate files that came with the distribution. Compilers and Options ===================== Some systems require unusual options for compilation or linking that the `configure' script does not know about. Run `./configure --help' for details on some of the pertinent environment variables. You can give `configure' initial values for configuration parameters by setting variables in the command line or in the environment. Here is an example: ./configure CC=c99 CFLAGS=-g LIBS=-lposix *Note Defining Variables::, for more details. Compiling For Multiple Architectures ==================================== You can compile the package for more than one kind of computer at the same time, by placing the object files for each architecture in their own directory. To do this, you can use GNU `make'. `cd' to the directory where you want the object files and executables to go and run the `configure' script. `configure' automatically checks for the source code in the directory that `configure' is in and in `..'. With a non-GNU `make', it is safer to compile the package for one architecture at a time in the source code directory. After you have installed the package for one architecture, use `make distclean' before reconfiguring for another architecture. Installation Names ================== By default, `make install' installs the package's commands under `/usr/local/bin', include files under `/usr/local/include', etc. You can specify an installation prefix other than `/usr/local' by giving `configure' the option `--prefix=PREFIX'. You can specify separate installation prefixes for architecture-specific files and architecture-independent files. If you pass the option `--exec-prefix=PREFIX' to `configure', the package uses PREFIX as the prefix for installing programs and libraries. Documentation and other data files still use the regular prefix. In addition, if you use an unusual directory layout you can give options like `--bindir=DIR' to specify different values for particular kinds of files. Run `configure --help' for a list of the directories you can set and what kinds of files go in them. If the package supports it, you can cause programs to be installed with an extra prefix or suffix on their names by giving `configure' the option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'. Optional Features ================= Some packages pay attention to `--enable-FEATURE' options to `configure', where FEATURE indicates an optional part of the package. They may also pay attention to `--with-PACKAGE' options, where PACKAGE is something like `gnu-as' or `x' (for the X Window System). The `README' should mention any `--enable-' and `--with-' options that the package recognizes. For packages that use the X Window System, `configure' can usually find the X include and library files automatically, but if it doesn't, you can use the `configure' options `--x-includes=DIR' and `--x-libraries=DIR' to specify their locations. Specifying the System Type ========================== There may be some features `configure' cannot figure out automatically, but needs to determine by the type of machine the package will run on. Usually, assuming the package is built to be run on the _same_ architectures, `configure' can figure that out, but if it prints a message saying it cannot guess the machine type, give it the `--build=TYPE' option. TYPE can either be a short name for the system type, such as `sun4', or a canonical name which has the form: CPU-COMPANY-SYSTEM where SYSTEM can have one of these forms: OS KERNEL-OS See the file `config.sub' for the possible values of each field. If `config.sub' isn't included in this package, then this package doesn't need to know the machine type. If you are _building_ compiler tools for cross-compiling, you should use the option `--target=TYPE' to select the type of system they will produce code for. If you want to _use_ a cross compiler, that generates code for a platform different from the build platform, you should specify the "host" platform (i.e., that on which the generated programs will eventually be run) with `--host=TYPE'. Sharing Defaults ================ If you want to set default values for `configure' scripts to share, you can create a site shell script called `config.site' that gives default values for variables like `CC', `cache_file', and `prefix'. `configure' looks for `PREFIX/share/config.site' if it exists, then `PREFIX/etc/config.site' if it exists. Or, you can set the `CONFIG_SITE' environment variable to the location of the site script. A warning: not all `configure' scripts look for a site script. Defining Variables ================== Variables not defined in a site shell script can be set in the environment passed to `configure'. However, some packages may run configure again during the build, and the customized values of these variables may be lost. In order to avoid this problem, you should set them in the `configure' command line, using `VAR=value'. For example: ./configure CC=/usr/local2/bin/gcc causes the specified `gcc' to be used as the C compiler (unless it is overridden in the site shell script). Unfortunately, this technique does not work for `CONFIG_SHELL' due to an Autoconf bug. Until the bug is fixed you can use this workaround: CONFIG_SHELL=/bin/bash /bin/bash ./configure CONFIG_SHELL=/bin/bash `configure' Invocation ====================== `configure' recognizes the following options to control how it operates. `--help' `-h' Print a summary of the options to `configure', and exit. `--version' `-V' Print the version of Autoconf used to generate the `configure' script, and exit. `--cache-file=FILE' Enable the cache: use and save the results of the tests in FILE, traditionally `config.cache'. FILE defaults to `/dev/null' to disable caching. `--config-cache' `-C' Alias for `--cache-file=config.cache'. `--quiet' `--silent' `-q' Do not print messages saying which checks are being made. To suppress all normal output, redirect it to `/dev/null' (any error messages will still be shown). `--srcdir=DIR' Look for the package's source code in directory DIR. Usually `configure' can determine that directory automatically. `configure' also accepts some other, not widely useful, options. Run `configure --help' for more details. bumprace-1.5.4/ChangeLog0000644000175000017500000002116511217461066012023 00000000000000Version 1.5.3 -fixed keyboard input after crash/timeout combination (thanks Bas Wijnen) -added more info to AUTHORS file -updated automake/autotools Version 1.5.2 -new background picture (thanks tozzie!) -players collide in two player mode (thanks Christoph Sommer) -minor fixes and cleanups (thanks Martin Michlmayr, Christoph Sommer) -improved backspace handling in text input (fixes problem under Mac OS X) Version 1.5.1 -updated autoconf files -improved second level set and fixed a bug concerning alternate level sets (Thanks Mehdi Yousfi) -removed more warnings -fade in should behave identical on all systems now -removed SDL_Image files from source and added SDL_Image as external dep -slighly changed configure.in Version 1.5.0 -replaced old fadeout by a new one, which should be fast enough on every system -added XCode project file for easy compilation under OS X -minor source code fixes to allow compilation under OS X -added Mac OS X icon -removed a lot of warnings -applied some patches (and forgot to note what they changed...) Version 1.46 -more hard levels (use --levelset 1) -speed increase on some systems (probably) -fixed choppy sound problem (perhaps) Version 1.45 -fixed crash-after-racer-selection bug. I can't understand why this bug didn't cause a crash on my computer... (Thanks Ben Marzinski) Version 1.44 -2 new levels -better balanced racers -changed the URL on the help screen -fixed "time boni are gone forever" bug Version 1.?? -new aclocal file (fixes compilation on arm) Version 1.43 -no SDL_mixer included -command line help -changed command line options -new option: no fadeout for slow computers -fixed a bug concerning wrong video flags Version 1.42 -game now easier (some smaller changes) -other changes?? (I deleted changelog... ooops!) -now using SDL>=1.1.5 (including a bug workaround) -hiscore bug finally fixed Version 1.4 -the highscore list is shown properly after the name has been entered -the lasers are now animated -messages like "crashed" are displayed until all particles have disappeared -the shot leave the cannon more precisely -a new level -the racer can move closer to the edges of the screen -changed some tile graphics -new timeout picture -new scoring system -changed collision code (I hope it's better...) -fixed a small update bug (nothing serious) -fixed a bug in the racer selection menu -bumprace uses always 16 bpp again, cause there are some problems with 8bpp Version 1.3 -now using input from sdl-config for configure -configure now checks for mathlib (-lm), too, if it is needed -bumprace can now be installed anywhere -the version number, which is displayed at startup, changes automatically -the last version installed an unneccessary header file -> fixed -removed a timeout bug when playing two times without quitting -music is faded out when quitting -removed some other bugs when played two times -added highscore list -now using SFont for fonts output -using the gfx.cpp of penguin-command which makes coding easier for me and it has also better error checking. -the particles are much better now. -there's a frame limit now. -a BumpRace Version without mixer is available -changed the special key to left ctrl for player 2 -new images for "crashed" and "level completed" -BumpRace can now run in any color depth, and uses the color depth of the X-server -some new tiles -png support Version 1.2 -fixed a bug in 2p team mode (the game didn't terminate after the timeout) -reduced the time between crashing and the crash sound by decreasing the chunk size. -repaired wrong output when the sound is turned off due a used device -fixed a bug in HandleShots() that could cause BumpRace to crash when the free CPU time for BumpRace is very low. -fixed a bug that caused the racer selction to be skipped on fast computers -added a quit button to the main menu. The game now returns to the main menu after the scoring. -moved the menus to menu.c -level numbers are displayed again (was a bug in 1.1) -the cannon is now displayed correctly -reduced cannon's turn speed -added a fullscreen fade after the scoring. This is very slow under Linux, but this will be better with XFree 4, when hardware acceleration is ready. -added configure/automake/autoconf support. This is not prefect yet, but I'm still working on it -modified LoadImage() to search for the graphic files in different directories -modified the sound and font loading to use the path selected by LoadImage -modified the README file, deleted README-SOURCE and created NEWS,AUTHORS and INSTALL files -better directory stucture -fullscreen mode is default now, cause the new SDL fullscreen code works perfect. -configure now checks for the needed libs and allows "make install" -the points hasn't been displayed correctly in competition mode. fixed. -now using SDL_Mixer 1.0.4 Version 1.1 -moved some gfx functions into gfx.c -added jpg support -all loaded images are converted to the pixel format of the screen surface. This should speed up bumprace and increase the image quality. -added some startup output -BumpRace is now using a backbuffer. This increases the memory usage but it makes a lot of programming easier and faster. -some pics are converted to jpg -> smaller download -BumpRace doesn't quit when it can't find a sound device, now it just turns the sound off -The time display is now labelled with "TIME LEFT" and the time decreases from the sides to the middle -You can quit BumpRace now by pressing the close button of your window manager -moved the particle code to particles.c -added the most complex obstacle: the cannon! This makes the game much more interesting IMO. -Racer are now handled very similar to shots and particles. This allows multiple racers, and eleminates some reasons for flickering. -yet another background -added two new game modes: 2player teamwork and 2player competition -added a nice menu for selecting the game mode -the startup message (This is free software...) is now faded in and out. -added simple scoring Version 1.00 -4 more levels (now 14). -added output "You have completed ?? levels". Windows users won't be able to see this, cause this appears in the shell after the game. -added tree levels (now 17)that were done by Stephan. Thanks! -added lasers (obstacles that switch on and off) -other background -encapsulated the particle routines into the "correct" functions. -fixes a particle removing bug over transparent surfaces -added email/web adresses to the credits -added racer info to the menu -the data is loaded while displaying the title screen -> faster startup -added a new racer -added the "sticky" ability -improved collision -time is only updated when the change is visible -time can now show a wider range of time -got timidity out of the sound system -> smaller package Version 0.90 -fixed the "quickstart bug" again :-) -now using SDL 0.10.0 -added short command line parameters. The old ones start with -- now. -added particle effects ( thanks Lion! ) -added new sound effects -fixed time display bug Version 0.80 -fixed the "quick start" bug -added help (and credits) screen -added a fadeout after every crash and the timeout -added fps counter (-fps , but it shows a very high value, so I'm not sure if that's correct: On my Cyrix200 it does 170fps!) -new 3D-Logo -added the "real" auto-slowdown ablility -added gravity -put racer abilities into variables -one new level with gravity -rendered new racer graphics, now with 18 pics for a smoother rotation Is anyone interested in the .blend files? -now 3 racers are available -added racer ability extra_time. This is the percentage of extra time at the beginning of the game -new graphic for the info board -lifetime if now displayed as a colored bar decreasing from green to red Version 0.70: -fonts are now blitted correctly -random level select -more levels (now 11) -bonus time for every completed level -collision rewritten -moved the levels to the file "levels.h" -new background(s) -added the output "This is free software..." like recommended. Version 0.60: -added timeout -added (terrible) fonts -better (but still flickering and buggy) fullscreen mode -fixed some bugs -added music: 22khz, 16bit, stereo! -added sound effect(s) -BumpRace is now available under the GNU General Public License version 2. -added command line parameter -added three levels Version 0.45: -one speed on all systems -cleaned up the source -title screen -smaller background ( 144 KB ) -added one level ------------------------------------< BUGS >------------------------------------ no known bugs -> please mail any bug reports to karlb@gmx.net bumprace-1.5.4/configure0000755000175000017500000046435511754254551012201 00000000000000#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.61. # # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, # 2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc. # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi # PATH needs CR # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then echo "#! /bin/sh" >conf$$.sh echo "exit 0" >>conf$$.sh chmod +x conf$$.sh if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then PATH_SEPARATOR=';' else PATH_SEPARATOR=: fi rm -f conf$$.sh fi # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) as_nl=' ' IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 { (exit 1); exit 1; } fi # Work around bugs in pre-3.0 UWIN ksh. for as_var in ENV MAIL MAILPATH do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. for as_var in \ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ LC_TELEPHONE LC_TIME do if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then eval $as_var=C; export $as_var else ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var fi done # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # CDPATH. $as_unset CDPATH if test "x$CONFIG_SHELL" = x; then if (eval ":") 2>/dev/null; then as_have_required=yes else as_have_required=no fi if test $as_have_required = yes && (eval ": (as_func_return () { (exit \$1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = \"\$1\" ); then : else exitcode=1 echo positional parameters were not saved. fi test \$exitcode = 0) || { (exit 1); exit 1; } ( as_lineno_1=\$LINENO as_lineno_2=\$LINENO test \"x\$as_lineno_1\" != \"x\$as_lineno_2\" && test \"x\`expr \$as_lineno_1 + 1\`\" = \"x\$as_lineno_2\") || { (exit 1); exit 1; } ") 2> /dev/null; then : else as_candidate_shells= as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. case $as_dir in /*) for as_base in sh bash ksh sh5; do as_candidate_shells="$as_candidate_shells $as_dir/$as_base" done;; esac done IFS=$as_save_IFS for as_shell in $as_candidate_shells $SHELL; do # Try only shells that exist, to save several forks. if { test -f "$as_shell" || test -f "$as_shell.exe"; } && { ("$as_shell") 2> /dev/null <<\_ASEOF if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi : _ASEOF }; then CONFIG_SHELL=$as_shell as_have_required=yes if { "$as_shell" 2> /dev/null <<\_ASEOF if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi : (as_func_return () { (exit $1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = "$1" ); then : else exitcode=1 echo positional parameters were not saved. fi test $exitcode = 0) || { (exit 1); exit 1; } ( as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2") || { (exit 1); exit 1; } _ASEOF }; then break fi fi done if test "x$CONFIG_SHELL" != x; then for as_var in BASH_ENV ENV do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done export CONFIG_SHELL exec "$CONFIG_SHELL" "$as_myself" ${1+"$@"} fi if test $as_have_required = no; then echo This script requires a shell more modern than all the echo shells that I found on your system. Please install a echo modern shell, or manually run the script under such a echo shell if you do have one. { (exit 1); exit 1; } fi fi fi (eval "as_func_return () { (exit \$1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = \"\$1\" ); then : else exitcode=1 echo positional parameters were not saved. fi test \$exitcode = 0") || { echo No shell found that supports shell functions. echo Please tell autoconf@gnu.org about your system, echo including any error possibly output before this echo message } as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line after each line using $LINENO; the second 'sed' # does the real work. The second script uses 'N' to pair each # line-number line with the line containing $LINENO, and appends # trailing '-' during substitution so that $LINENO is not a special # case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # scripts with optimization help from Paolo Bonzini. Blame Lee # E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in -n*) case `echo 'x\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. *) ECHO_C='\c';; esac;; *) ECHO_N='-n';; esac if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir fi echo >conf$$.file if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 7<&0 &1 # Name of the host. # hostname on some systems (SVR3.2, Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` # # Initializations. # ac_default_prefix=/usr/local ac_clean_files= ac_config_libobj_dir=. LIBOBJS= cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= SHELL=${CONFIG_SHELL-/bin/sh} # Identity of this package. PACKAGE_NAME= PACKAGE_TARNAME= PACKAGE_VERSION= PACKAGE_STRING= PACKAGE_BUGREPORT= ac_unique_file="README" ac_subst_vars='SHELL PATH_SEPARATOR PACKAGE_NAME PACKAGE_TARNAME PACKAGE_VERSION PACKAGE_STRING PACKAGE_BUGREPORT exec_prefix prefix program_transform_name bindir sbindir libexecdir datarootdir datadir sysconfdir sharedstatedir localstatedir includedir oldincludedir docdir infodir htmldir dvidir pdfdir psdir libdir localedir mandir DEFS ECHO_C ECHO_N ECHO_T LIBS build_alias host_alias target_alias build build_cpu build_vendor build_os host host_cpu host_vendor host_os target target_cpu target_vendor target_os INSTALL_PROGRAM INSTALL_SCRIPT INSTALL_DATA am__isrc CYGPATH_W PACKAGE VERSION ACLOCAL AUTOCONF AUTOMAKE AUTOHEADER MAKEINFO install_sh STRIP INSTALL_STRIP_PROGRAM mkdir_p AWK SET_MAKE am__leading_dot AMTAR am__tar am__untar CC CFLAGS LDFLAGS CPPFLAGS ac_ct_CC EXEEXT OBJEXT DEPDIR am__include am__quote AMDEP_TRUE AMDEP_FALSE AMDEPBACKSLASH CCDEPMODE am__fastdepCC_TRUE am__fastdepCC_FALSE RANLIB MATHLIB SDL_CONFIG SDL_CFLAGS SDL_LIBS LIBOBJS LTLIBOBJS' ac_subst_files='' ac_precious_vars='build_alias host_alias target_alias CC CFLAGS LDFLAGS LIBS CPPFLAGS' # Initialize some variables set by options. ac_init_help= ac_init_version=false # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. # (The list follows the same order as the GNU Coding Standards.) bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datarootdir='${prefix}/share' datadir='${datarootdir}' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' includedir='${prefix}/include' oldincludedir='/usr/include' docdir='${datarootdir}/doc/${PACKAGE}' infodir='${datarootdir}/info' htmldir='${docdir}' dvidir='${docdir}' pdfdir='${docdir}' psdir='${docdir}' libdir='${exec_prefix}/lib' localedir='${datarootdir}/locale' mandir='${datarootdir}/man' ac_prev= ac_dashdash= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval $ac_prev=\$ac_option ac_prev= continue fi case $ac_option in *=*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; *) ac_optarg=yes ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=*) datadir=$ac_optarg ;; -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ | --dataroo | --dataro | --datar) ac_prev=datarootdir ;; -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) datarootdir=$ac_optarg ;; -disable-* | --disable-*) ac_feature=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid feature name: $ac_feature" >&2 { (exit 1); exit 1; }; } ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'` eval enable_$ac_feature=no ;; -docdir | --docdir | --docdi | --doc | --do) ac_prev=docdir ;; -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) docdir=$ac_optarg ;; -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) ac_prev=dvidir ;; -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) dvidir=$ac_optarg ;; -enable-* | --enable-*) ac_feature=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid feature name: $ac_feature" >&2 { (exit 1); exit 1; }; } ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'` eval enable_$ac_feature=\$ac_optarg ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) ac_prev=htmldir ;; -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ | --ht=*) htmldir=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localedir | --localedir | --localedi | --localed | --locale) ac_prev=localedir ;; -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) localedir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst | --locals) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) ac_prev=pdfdir ;; -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) pdfdir=$ac_optarg ;; -psdir | --psdir | --psdi | --psd | --ps) ac_prev=psdir ;; -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) psdir=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_package=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid package name: $ac_package" >&2 { (exit 1); exit 1; }; } ac_package=`echo $ac_package | sed 's/[-.]/_/g'` eval with_$ac_package=\$ac_optarg ;; -without-* | --without-*) ac_package=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid package name: $ac_package" >&2 { (exit 1); exit 1; }; } ac_package=`echo $ac_package | sed 's/[-.]/_/g'` eval with_$ac_package=no ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) { echo "$as_me: error: unrecognized option: $ac_option Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; } ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid variable name: $ac_envvar" >&2 { (exit 1); exit 1; }; } eval $ac_envvar=\$ac_optarg export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option} ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` { echo "$as_me: error: missing argument to $ac_option" >&2 { (exit 1); exit 1; }; } fi # Be sure to have absolute directory names. for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ datadir sysconfdir sharedstatedir localstatedir includedir \ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ libdir localedir mandir do eval ac_val=\$$ac_var case $ac_val in [\\/$]* | ?:[\\/]* ) continue;; NONE | '' ) case $ac_var in *prefix ) continue;; esac;; esac { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2 { (exit 1); exit 1; }; } done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host. If a cross compiler is detected then cross compile mode will be used." >&2 elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null ac_pwd=`pwd` && test -n "$ac_pwd" && ac_ls_di=`ls -di .` && ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || { echo "$as_me: error: Working directory cannot be determined" >&2 { (exit 1); exit 1; }; } test "X$ac_ls_di" = "X$ac_pwd_ls_di" || { echo "$as_me: error: pwd does not report name of working directory" >&2 { (exit 1); exit 1; }; } # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then the parent directory. ac_confdir=`$as_dirname -- "$0" || $as_expr X"$0" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$0" : 'X\(//\)[^/]' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || echo X"$0" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` srcdir=$ac_confdir if test ! -r "$srcdir/$ac_unique_file"; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r "$srcdir/$ac_unique_file"; then test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." { echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2 { (exit 1); exit 1; }; } fi ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" ac_abs_confdir=`( cd "$srcdir" && test -r "./$ac_unique_file" || { echo "$as_me: error: $ac_msg" >&2 { (exit 1); exit 1; }; } pwd)` # When building in place, set srcdir=. if test "$ac_abs_confdir" = "$ac_pwd"; then srcdir=. fi # Remove unnecessary trailing slashes from srcdir. # Double slashes in file names in object file debugging info # mess up M-x gdb in Emacs. case $srcdir in */) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; esac for ac_var in $ac_precious_vars; do eval ac_env_${ac_var}_set=\${${ac_var}+set} eval ac_env_${ac_var}_value=\$${ac_var} eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} eval ac_cv_env_${ac_var}_value=\$${ac_var} done # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures this package to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] --datadir=DIR read-only architecture-independent data [DATAROOTDIR] --infodir=DIR info documentation [DATAROOTDIR/info] --localedir=DIR locale-dependent data [DATAROOTDIR/locale] --mandir=DIR man documentation [DATAROOTDIR/man] --docdir=DIR documentation root [DATAROOTDIR/doc/PACKAGE] --htmldir=DIR html documentation [DOCDIR] --dvidir=DIR dvi documentation [DOCDIR] --pdfdir=DIR pdf documentation [DOCDIR] --psdir=DIR ps documentation [DOCDIR] _ACEOF cat <<\_ACEOF Program names: --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names System types: --build=BUILD configure for building on BUILD [guessed] --host=HOST cross-compile to build programs to run on HOST [BUILD] --target=TARGET configure for building compilers for TARGET [HOST] _ACEOF fi if test -n "$ac_init_help"; then cat <<\_ACEOF Optional Features: --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) --enable-FEATURE[=ARG] include FEATURE [ARG=yes] --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors --disable-sdltest Do not try to compile and run a test SDL program Optional Packages: --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) --with-sdl-prefix=PFX Prefix where SDL is installed (optional) --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional) Some influential environment variables: CC C compiler command CFLAGS C compiler flags LDFLAGS linker flags, e.g. -L if you have libraries in a nonstandard directory LIBS libraries to pass to the linker, e.g. -l CPPFLAGS C/C++/Objective C preprocessor flags, e.g. -I if you have headers in a nonstandard directory Use these variables to override the choices made by `configure' or to help it to find libraries and programs with nonstandard names/locations. _ACEOF ac_status=$? fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d "$ac_dir" || continue ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } # Check for guested configure. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive elif test -f "$ac_srcdir/configure"; then echo && $SHELL "$ac_srcdir/configure" --help=recursive else echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF configure generated by GNU Autoconf 2.61 Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit fi cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by $as_me, which was generated by GNU Autoconf 2.61. Invocation command line was $ $0 $@ _ACEOF exec 5>>config.log { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` /usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. echo "PATH: $as_dir" done IFS=$as_save_IFS } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) ac_arg=`echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;; 2) ac_configure_args1="$ac_configure_args1 '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi ac_configure_args="$ac_configure_args '$ac_arg'" ;; esac done done $as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; } $as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; } # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo cat <<\_ASBOX ## ---------------- ## ## Cache variables. ## ## ---------------- ## _ASBOX echo # The following way of writing the cache mishandles newlines in values, ( for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5 echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( *) $as_unset $ac_var ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( *${as_nl}ac_space=\ *) sed -n \ "s/'\''/'\''\\\\'\'''\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" ;; #( *) sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) echo cat <<\_ASBOX ## ----------------- ## ## Output variables. ## ## ----------------- ## _ASBOX echo for ac_var in $ac_subst_vars do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac echo "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then cat <<\_ASBOX ## ------------------- ## ## File substitutions. ## ## ------------------- ## _ASBOX echo for ac_var in $ac_subst_files do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac echo "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then cat <<\_ASBOX ## ----------- ## ## confdefs.h. ## ## ----------- ## _ASBOX echo cat confdefs.h echo fi test "$ac_signal" != 0 && echo "$as_me: caught signal $ac_signal" echo "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer explicitly selected file to automatically selected ones. if test -n "$CONFIG_SITE"; then set x "$CONFIG_SITE" elif test "x$prefix" != xNONE; then set x "$prefix/share/config.site" "$prefix/etc/config.site" else set x "$ac_default_prefix/share/config.site" \ "$ac_default_prefix/etc/config.site" fi shift for ac_site_file do if test -r "$ac_site_file"; then { echo "$as_me:$LINENO: loading site script $ac_site_file" >&5 echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special # files actually), so we avoid doing that. if test -f "$cache_file"; then { echo "$as_me:$LINENO: loading cache $cache_file" >&5 echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else { echo "$as_me:$LINENO: creating cache $cache_file" >&5 echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in $ac_precious_vars; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val=\$ac_cv_env_${ac_var}_value eval ac_new_val=\$ac_env_${ac_var}_value case $ac_old_set,$ac_new_set in set,) { echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5 echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then { echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5 echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} { echo "$as_me:$LINENO: former value: $ac_old_val" >&5 echo "$as_me: former value: $ac_old_val" >&2;} { echo "$as_me:$LINENO: current value: $ac_new_val" >&5 echo "$as_me: current value: $ac_new_val" >&2;} ac_cache_corrupted=: fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *\'*) ac_arg=$ac_var=`echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) ac_configure_args="$ac_configure_args '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5 echo "$as_me: error: changes in the environment can compromise the build" >&2;} { { echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5 echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;} { (exit 1); exit 1; }; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu ######## Detect the canonical host and target build environment ac_aux_dir= for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do if test -f "$ac_dir/install-sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f "$ac_dir/install.sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f "$ac_dir/shtool"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then { { echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&5 echo "$as_me: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&2;} { (exit 1); exit 1; }; } fi # These three variables are undocumented and unsupported, # and are intended to be withdrawn in a future Autoconf release. # They can cause serious problems if a builder's source tree is in a directory # whose full name contains unusual characters. ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # Make sure we can run config.sub. $SHELL "$ac_aux_dir/config.sub" sun4 >/dev/null 2>&1 || { { echo "$as_me:$LINENO: error: cannot run $SHELL $ac_aux_dir/config.sub" >&5 echo "$as_me: error: cannot run $SHELL $ac_aux_dir/config.sub" >&2;} { (exit 1); exit 1; }; } { echo "$as_me:$LINENO: checking build system type" >&5 echo $ECHO_N "checking build system type... $ECHO_C" >&6; } if test "${ac_cv_build+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_build_alias=$build_alias test "x$ac_build_alias" = x && ac_build_alias=`$SHELL "$ac_aux_dir/config.guess"` test "x$ac_build_alias" = x && { { echo "$as_me:$LINENO: error: cannot guess build type; you must specify one" >&5 echo "$as_me: error: cannot guess build type; you must specify one" >&2;} { (exit 1); exit 1; }; } ac_cv_build=`$SHELL "$ac_aux_dir/config.sub" $ac_build_alias` || { { echo "$as_me:$LINENO: error: $SHELL $ac_aux_dir/config.sub $ac_build_alias failed" >&5 echo "$as_me: error: $SHELL $ac_aux_dir/config.sub $ac_build_alias failed" >&2;} { (exit 1); exit 1; }; } fi { echo "$as_me:$LINENO: result: $ac_cv_build" >&5 echo "${ECHO_T}$ac_cv_build" >&6; } case $ac_cv_build in *-*-*) ;; *) { { echo "$as_me:$LINENO: error: invalid value of canonical build" >&5 echo "$as_me: error: invalid value of canonical build" >&2;} { (exit 1); exit 1; }; };; esac build=$ac_cv_build ac_save_IFS=$IFS; IFS='-' set x $ac_cv_build shift build_cpu=$1 build_vendor=$2 shift; shift # Remember, the first character of IFS is used to create $*, # except with old shells: build_os=$* IFS=$ac_save_IFS case $build_os in *\ *) build_os=`echo "$build_os" | sed 's/ /-/g'`;; esac { echo "$as_me:$LINENO: checking host system type" >&5 echo $ECHO_N "checking host system type... $ECHO_C" >&6; } if test "${ac_cv_host+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "x$host_alias" = x; then ac_cv_host=$ac_cv_build else ac_cv_host=`$SHELL "$ac_aux_dir/config.sub" $host_alias` || { { echo "$as_me:$LINENO: error: $SHELL $ac_aux_dir/config.sub $host_alias failed" >&5 echo "$as_me: error: $SHELL $ac_aux_dir/config.sub $host_alias failed" >&2;} { (exit 1); exit 1; }; } fi fi { echo "$as_me:$LINENO: result: $ac_cv_host" >&5 echo "${ECHO_T}$ac_cv_host" >&6; } case $ac_cv_host in *-*-*) ;; *) { { echo "$as_me:$LINENO: error: invalid value of canonical host" >&5 echo "$as_me: error: invalid value of canonical host" >&2;} { (exit 1); exit 1; }; };; esac host=$ac_cv_host ac_save_IFS=$IFS; IFS='-' set x $ac_cv_host shift host_cpu=$1 host_vendor=$2 shift; shift # Remember, the first character of IFS is used to create $*, # except with old shells: host_os=$* IFS=$ac_save_IFS case $host_os in *\ *) host_os=`echo "$host_os" | sed 's/ /-/g'`;; esac { echo "$as_me:$LINENO: checking target system type" >&5 echo $ECHO_N "checking target system type... $ECHO_C" >&6; } if test "${ac_cv_target+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "x$target_alias" = x; then ac_cv_target=$ac_cv_host else ac_cv_target=`$SHELL "$ac_aux_dir/config.sub" $target_alias` || { { echo "$as_me:$LINENO: error: $SHELL $ac_aux_dir/config.sub $target_alias failed" >&5 echo "$as_me: error: $SHELL $ac_aux_dir/config.sub $target_alias failed" >&2;} { (exit 1); exit 1; }; } fi fi { echo "$as_me:$LINENO: result: $ac_cv_target" >&5 echo "${ECHO_T}$ac_cv_target" >&6; } case $ac_cv_target in *-*-*) ;; *) { { echo "$as_me:$LINENO: error: invalid value of canonical target" >&5 echo "$as_me: error: invalid value of canonical target" >&2;} { (exit 1); exit 1; }; };; esac target=$ac_cv_target ac_save_IFS=$IFS; IFS='-' set x $ac_cv_target shift target_cpu=$1 target_vendor=$2 shift; shift # Remember, the first character of IFS is used to create $*, # except with old shells: target_os=$* IFS=$ac_save_IFS case $target_os in *\ *) target_os=`echo "$target_os" | sed 's/ /-/g'`;; esac # The aliases save the names the user supplied, while $host etc. # will get canonicalized. test -n "$target_alias" && test "$program_prefix$program_suffix$program_transform_name" = \ NONENONEs,x,x, && program_prefix=${target_alias}- ######## Setup for automake NAME="bumprace" SDL_VERSION=1.1.5 am__api_version='1.10' # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. { echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5 echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6; } if test -z "$INSTALL"; then if test "${ac_cv_path_install+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in ./ | .// | /cC/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi done done ;; esac done IFS=$as_save_IFS fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { echo "$as_me:$LINENO: result: $INSTALL" >&5 echo "${ECHO_T}$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' { echo "$as_me:$LINENO: checking whether build environment is sane" >&5 echo $ECHO_N "checking whether build environment is sane... $ECHO_C" >&6; } # Just in case sleep 1 echo timestamp > conftest.file # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftest.file` fi rm -f conftest.file if test "$*" != "X $srcdir/configure conftest.file" \ && test "$*" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". { { echo "$as_me:$LINENO: error: ls -t appears to fail. Make sure there is not a broken alias in your environment" >&5 echo "$as_me: error: ls -t appears to fail. Make sure there is not a broken alias in your environment" >&2;} { (exit 1); exit 1; }; } fi test "$2" = conftest.file ) then # Ok. : else { { echo "$as_me:$LINENO: error: newly created file is older than distributed files! Check your system clock" >&5 echo "$as_me: error: newly created file is older than distributed files! Check your system clock" >&2;} { (exit 1); exit 1; }; } fi { echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6; } test "$program_prefix" != NONE && program_transform_name="s&^&$program_prefix&;$program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s&\$&$program_suffix&;$program_transform_name" # Double any \ or $. echo might interpret backslashes. # By default was `s,x,x', remove it if useless. cat <<\_ACEOF >conftest.sed s/[\\$]/&&/g;s/;s,x,x,$// _ACEOF program_transform_name=`echo $program_transform_name | sed -f conftest.sed` rm -f conftest.sed # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing" # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= { echo "$as_me:$LINENO: WARNING: \`missing' script is too old or missing" >&5 echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;} fi { echo "$as_me:$LINENO: checking for a thread-safe mkdir -p" >&5 echo $ECHO_N "checking for a thread-safe mkdir -p... $ECHO_C" >&6; } if test -z "$MKDIR_P"; then if test "${ac_cv_path_mkdir+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in mkdir gmkdir; do for ac_exec_ext in '' $ac_executable_extensions; do { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; } || continue case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #( 'mkdir (GNU coreutils) '* | \ 'mkdir (coreutils) '* | \ 'mkdir (fileutils) '4.1*) ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext break 3;; esac done done done IFS=$as_save_IFS fi if test "${ac_cv_path_mkdir+set}" = set; then MKDIR_P="$ac_cv_path_mkdir -p" else # As a last resort, use the slow shell script. Don't cache a # value for MKDIR_P within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. test -d ./--version && rmdir ./--version MKDIR_P="$ac_install_sh -d" fi fi { echo "$as_me:$LINENO: result: $MKDIR_P" >&5 echo "${ECHO_T}$MKDIR_P" >&6; } mkdir_p="$MKDIR_P" case $mkdir_p in [\\/$]* | ?:[\\/]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac for ac_prog in gawk mawk nawk awk do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_AWK+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$AWK"; then ac_cv_prog_AWK="$AWK" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_AWK="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi AWK=$ac_cv_prog_AWK if test -n "$AWK"; then { echo "$as_me:$LINENO: result: $AWK" >&5 echo "${ECHO_T}$AWK" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi test -n "$AWK" && break done { echo "$as_me:$LINENO: checking whether ${MAKE-make} sets \$(MAKE)" >&5 echo $ECHO_N "checking whether ${MAKE-make} sets \$(MAKE)... $ECHO_C" >&6; } set x ${MAKE-make}; ac_make=`echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` if { as_var=ac_cv_prog_make_${ac_make}_set; eval "test \"\${$as_var+set}\" = set"; }; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @echo '@@@%%%=$(MAKE)=@@@%%%' _ACEOF # GNU make sometimes prints "make[1]: Entering...", which would confuse us. case `${MAKE-make} -f conftest.make 2>/dev/null` in *@@@%%%=?*=@@@%%%*) eval ac_cv_prog_make_${ac_make}_set=yes;; *) eval ac_cv_prog_make_${ac_make}_set=no;; esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then { echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6; } SET_MAKE= else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." am__isrc=' -I$(srcdir)' # test to see if srcdir already configured if test -f $srcdir/config.status; then { { echo "$as_me:$LINENO: error: source directory already configured; run \"make distclean\" there first" >&5 echo "$as_me: error: source directory already configured; run \"make distclean\" there first" >&2;} { (exit 1); exit 1; }; } fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi # Define the identity of the package. PACKAGE=$NAME VERSION=1.5.4 cat >>confdefs.h <<_ACEOF #define PACKAGE "$PACKAGE" _ACEOF cat >>confdefs.h <<_ACEOF #define VERSION "$VERSION" _ACEOF # Some tools Automake needs. ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"} AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"} AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"} AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"} MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"} install_sh=${install_sh-"\$(SHELL) $am_aux_dir/install-sh"} # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. if test "$cross_compiling" != no; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then { echo "$as_me:$LINENO: result: $STRIP" >&5 echo "${ECHO_T}$STRIP" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_ac_ct_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_STRIP="strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then { echo "$as_me:$LINENO: result: $ac_ct_STRIP" >&5 echo "${ECHO_T}$ac_ct_STRIP" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi if test "x$ac_ct_STRIP" = x; then STRIP=":" else case $cross_compiling:$ac_tool_warned in yes:) { echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&5 echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&2;} ac_tool_warned=yes ;; esac STRIP=$ac_ct_STRIP fi else STRIP="$ac_cv_prog_STRIP" fi fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" # We need awk for the "check" target. The system "awk" is bad on # some platforms. # Always define AMTAR for backward compatibility. AMTAR=${AMTAR-"${am_missing_run}tar"} am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -' ######## Check for tools ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. set dummy ${ac_tool_prefix}gcc; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}gcc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi fi if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_ac_ct_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="gcc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 echo "${ECHO_T}$ac_ct_CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&5 echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi else CC="$ac_cv_prog_CC" fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. set dummy ${ac_tool_prefix}cc; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}cc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi fi fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else ac_prog_rejected=no as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS if test $ac_prog_rejected = yes; then # We found a bogon in the path, so make sure we never use it. set dummy $ac_cv_prog_CC shift if test $# != 0; then # We chose a different compiler from the bogus one. # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" fi fi fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then for ac_prog in cl.exe do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="$ac_tool_prefix$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi test -n "$CC" && break done fi if test -z "$CC"; then ac_ct_CC=$CC for ac_prog in cl.exe do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_ac_ct_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 echo "${ECHO_T}$ac_ct_CC" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi test -n "$ac_ct_CC" && break done if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&5 echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi fi fi test -z "$CC" && { { echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&5 echo "$as_me: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } # Provide some information about the compiler. echo "$as_me:$LINENO: checking for C compiler version" >&5 ac_compiler=`set X $ac_compile; echo $2` { (ac_try="$ac_compiler --version >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compiler --version >&5") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (ac_try="$ac_compiler -v >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compiler -v >&5") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (ac_try="$ac_compiler -V >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compiler -V >&5") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files a.out a.exe b.out" # Try to create an executable without -o first, disregard a.out. # It will help us diagnose broken compilers, and finding out an intuition # of exeext. { echo "$as_me:$LINENO: checking for C compiler default output file name" >&5 echo $ECHO_N "checking for C compiler default output file name... $ECHO_C" >&6; } ac_link_default=`echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` # # List of possible output files, starting from the most likely. # The algorithm is not robust to junk in `.', hence go to wildcards (a.*) # only as a last resort. b.out is created by i960 compilers. ac_files='a_out.exe a.exe conftest.exe a.out conftest a.* conftest.* b.out' # # The IRIX 6 linker writes into existing files which may not be # executable, retaining their permissions. Remove them first so a # subsequent execution test works. ac_rmfiles= for ac_file in $ac_files do case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;; * ) ac_rmfiles="$ac_rmfiles $ac_file";; esac done rm -f $ac_rmfiles if { (ac_try="$ac_link_default" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link_default") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # Autoconf-2.13 could set the ac_cv_exeext variable to `no'. # So ignore a value of `no', otherwise this would lead to `EXEEXT = no' # in a Makefile. We should not override ac_cv_exeext if it was cached, # so that the user can short-circuit this test for compilers unknown to # Autoconf. for ac_file in $ac_files '' do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;; [ab].out ) # We found the default executable, but exeext='' is most # certainly right. break;; *.* ) if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no; then :; else ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` fi # We set ac_cv_exeext here because the later test for it is not # safe: cross compilers may not add the suffix if given an `-o' # argument, so we may need to know it at that point already. # Even if this section looks crufty: it has the advantage of # actually working. break;; * ) break;; esac done test "$ac_cv_exeext" = no && ac_cv_exeext= else ac_file='' fi { echo "$as_me:$LINENO: result: $ac_file" >&5 echo "${ECHO_T}$ac_file" >&6; } if test -z "$ac_file"; then echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { echo "$as_me:$LINENO: error: C compiler cannot create executables See \`config.log' for more details." >&5 echo "$as_me: error: C compiler cannot create executables See \`config.log' for more details." >&2;} { (exit 77); exit 77; }; } fi ac_exeext=$ac_cv_exeext # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. { echo "$as_me:$LINENO: checking whether the C compiler works" >&5 echo $ECHO_N "checking whether the C compiler works... $ECHO_C" >&6; } # FIXME: These cross compiler hacks should be removed for Autoconf 3.0 # If not cross compiling, check that we can run a simple program. if test "$cross_compiling" != yes; then if { ac_try='./$ac_file' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_try") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then cross_compiling=no else if test "$cross_compiling" = maybe; then cross_compiling=yes else { { echo "$as_me:$LINENO: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&5 echo "$as_me: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi fi fi { echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6; } rm -f a.out a.exe conftest$ac_cv_exeext b.out ac_clean_files=$ac_clean_files_save # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. { echo "$as_me:$LINENO: checking whether we are cross compiling" >&5 echo $ECHO_N "checking whether we are cross compiling... $ECHO_C" >&6; } { echo "$as_me:$LINENO: result: $cross_compiling" >&5 echo "${ECHO_T}$cross_compiling" >&6; } { echo "$as_me:$LINENO: checking for suffix of executables" >&5 echo $ECHO_N "checking for suffix of executables... $ECHO_C" >&6; } if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # If both `conftest.exe' and `conftest' are `present' (well, observable) # catch `conftest.exe'. For instance with Cygwin, `ls conftest' will # work properly (i.e., refer to `conftest.exe'), while it won't with # `rm'. for ac_file in conftest.exe conftest conftest.*; do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;; *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` break;; * ) break;; esac done else { { echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&5 echo "$as_me: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi rm -f conftest$ac_cv_exeext { echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5 echo "${ECHO_T}$ac_cv_exeext" >&6; } rm -f conftest.$ac_ext EXEEXT=$ac_cv_exeext ac_exeext=$EXEEXT { echo "$as_me:$LINENO: checking for suffix of object files" >&5 echo $ECHO_N "checking for suffix of object files... $ECHO_C" >&6; } if test "${ac_cv_objext+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.o conftest.obj if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then for ac_file in conftest.o conftest.obj conftest.*; do test -f "$ac_file" || continue; case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf ) ;; *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'` break;; esac done else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&5 echo "$as_me: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi rm -f conftest.$ac_cv_objext conftest.$ac_ext fi { echo "$as_me:$LINENO: result: $ac_cv_objext" >&5 echo "${ECHO_T}$ac_cv_objext" >&6; } OBJEXT=$ac_cv_objext ac_objext=$OBJEXT { echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5 echo $ECHO_N "checking whether we are using the GNU C compiler... $ECHO_C" >&6; } if test "${ac_cv_c_compiler_gnu+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { #ifndef __GNUC__ choke me #endif ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_compiler_gnu=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_compiler_gnu=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_c_compiler_gnu=$ac_compiler_gnu fi { echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5 echo "${ECHO_T}$ac_cv_c_compiler_gnu" >&6; } GCC=`test $ac_compiler_gnu = yes && echo yes` ac_test_CFLAGS=${CFLAGS+set} ac_save_CFLAGS=$CFLAGS { echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5 echo $ECHO_N "checking whether $CC accepts -g... $ECHO_C" >&6; } if test "${ac_cv_prog_cc_g+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_save_c_werror_flag=$ac_c_werror_flag ac_c_werror_flag=yes ac_cv_prog_cc_g=no CFLAGS="-g" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_g=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 CFLAGS="" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_c_werror_flag=$ac_save_c_werror_flag CFLAGS="-g" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_g=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_c_werror_flag=$ac_save_c_werror_flag fi { echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5 echo "${ECHO_T}$ac_cv_prog_cc_g" >&6; } if test "$ac_test_CFLAGS" = set; then CFLAGS=$ac_save_CFLAGS elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then CFLAGS="-g -O2" else CFLAGS="-g" fi else if test "$GCC" = yes; then CFLAGS="-O2" else CFLAGS= fi fi { echo "$as_me:$LINENO: checking for $CC option to accept ISO C89" >&5 echo $ECHO_N "checking for $CC option to accept ISO C89... $ECHO_C" >&6; } if test "${ac_cv_prog_cc_c89+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_prog_cc_c89=no ac_save_CC=$CC cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include /* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ struct buf { int x; }; FILE * (*rcsopen) (struct buf *, struct stat *, int); static char *e (p, i) char **p; int i; { return p[i]; } static char *f (char * (*g) (char **, int), char **p, ...) { char *s; va_list v; va_start (v,p); s = g (p, va_arg (v,int)); va_end (v); return s; } /* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has function prototypes and stuff, but not '\xHH' hex character constants. These don't provoke an error unfortunately, instead are silently treated as 'x'. The following induces an error, until -std is added to get proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an array size at least. It's necessary to write '\x00'==0 to get something that's true only with -std. */ int osf4_cc_array ['\x00' == 0 ? 1 : -1]; /* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters inside strings and character constants. */ #define FOO(x) 'x' int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1]; int test (int i, double x); struct s1 {int (*f) (int a);}; struct s2 {int (*f) (double a);}; int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); int argc; char **argv; int main () { return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; ; return 0; } _ACEOF for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \ -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" do CC="$ac_save_CC $ac_arg" rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_c89=$ac_arg else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext test "x$ac_cv_prog_cc_c89" != "xno" && break done rm -f conftest.$ac_ext CC=$ac_save_CC fi # AC_CACHE_VAL case "x$ac_cv_prog_cc_c89" in x) { echo "$as_me:$LINENO: result: none needed" >&5 echo "${ECHO_T}none needed" >&6; } ;; xno) { echo "$as_me:$LINENO: result: unsupported" >&5 echo "${ECHO_T}unsupported" >&6; } ;; *) CC="$CC $ac_cv_prog_cc_c89" { echo "$as_me:$LINENO: result: $ac_cv_prog_cc_c89" >&5 echo "${ECHO_T}$ac_cv_prog_cc_c89" >&6; } ;; esac ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu DEPDIR="${am__leading_dot}deps" ac_config_commands="$ac_config_commands depfiles" am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo done .PHONY: am__doit END # If we don't find an include directive, just comment out the code. { echo "$as_me:$LINENO: checking for style of include used by $am_make" >&5 echo $ECHO_N "checking for style of include used by $am_make... $ECHO_C" >&6; } am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # We grep out `Entering directory' and `Leaving directory' # messages which can occur if `w' ends up in MAKEFLAGS. # In particular we don't look at `^make:' because GNU make might # be invoked under some other name (usually "gmake"), in which # case it prints its new name instead of `make'. if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then am__include=include am__quote= _am_result=GNU fi # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then am__include=.include am__quote="\"" _am_result=BSD fi fi { echo "$as_me:$LINENO: result: $_am_result" >&5 echo "${ECHO_T}$_am_result" >&6; } rm -f confinc confmf # Check whether --enable-dependency-tracking was given. if test "${enable_dependency_tracking+set}" = set; then enableval=$enable_dependency_tracking; fi if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi if test "x$enable_dependency_tracking" != xno; then AMDEP_TRUE= AMDEP_FALSE='#' else AMDEP_TRUE='#' AMDEP_FALSE= fi depcc="$CC" am_compiler_list= { echo "$as_me:$LINENO: checking dependency style of $depcc" >&5 echo $ECHO_N "checking dependency style of $depcc... $ECHO_C" >&6; } if test "${am_cv_CC_dependencies_compiler_type+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_CC_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n 's/^#*\([a-zA-Z0-9]*\))$/\1/p' < ./depcomp` fi for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf case $depmode in nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; none) break ;; esac # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. if depmode=$depmode \ source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst1.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_CC_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_CC_dependencies_compiler_type=none fi fi { echo "$as_me:$LINENO: result: $am_cv_CC_dependencies_compiler_type" >&5 echo "${ECHO_T}$am_cv_CC_dependencies_compiler_type" >&6; } CCDEPMODE=depmode=$am_cv_CC_dependencies_compiler_type if test "x$enable_dependency_tracking" != xno \ && test "$am_cv_CC_dependencies_compiler_type" = gcc3; then am__fastdepCC_TRUE= am__fastdepCC_FALSE='#' else am__fastdepCC_TRUE='#' am__fastdepCC_FALSE= fi # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. { echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5 echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6; } if test -z "$INSTALL"; then if test "${ac_cv_path_install+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in ./ | .// | /cC/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi done done ;; esac done IFS=$as_save_IFS fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { echo "$as_me:$LINENO: result: $INSTALL" >&5 echo "${ECHO_T}$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}ranlib", so it can be a program name with args. set dummy ${ac_tool_prefix}ranlib; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_RANLIB+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$RANLIB"; then ac_cv_prog_RANLIB="$RANLIB" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_RANLIB="${ac_tool_prefix}ranlib" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi RANLIB=$ac_cv_prog_RANLIB if test -n "$RANLIB"; then { echo "$as_me:$LINENO: result: $RANLIB" >&5 echo "${ECHO_T}$RANLIB" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi fi if test -z "$ac_cv_prog_RANLIB"; then ac_ct_RANLIB=$RANLIB # Extract the first word of "ranlib", so it can be a program name with args. set dummy ranlib; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_prog_ac_ct_RANLIB+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_RANLIB"; then ac_cv_prog_ac_ct_RANLIB="$ac_ct_RANLIB" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_RANLIB="ranlib" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_RANLIB=$ac_cv_prog_ac_ct_RANLIB if test -n "$ac_ct_RANLIB"; then { echo "$as_me:$LINENO: result: $ac_ct_RANLIB" >&5 echo "${ECHO_T}$ac_ct_RANLIB" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi if test "x$ac_ct_RANLIB" = x; then RANLIB=":" else case $cross_compiling:$ac_tool_warned in yes:) { echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&5 echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools whose name does not start with the host triplet. If you think this configuration is useful to you, please write to autoconf@gnu.org." >&2;} ac_tool_warned=yes ;; esac RANLIB=$ac_ct_RANLIB fi else RANLIB="$ac_cv_prog_RANLIB" fi ######## Check for compiler environment { echo "$as_me:$LINENO: checking for an ANSI C-conforming const" >&5 echo $ECHO_N "checking for an ANSI C-conforming const... $ECHO_C" >&6; } if test "${ac_cv_c_const+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { /* FIXME: Include the comments suggested by Paul. */ #ifndef __cplusplus /* Ultrix mips cc rejects this. */ typedef int charset[2]; const charset cs; /* SunOS 4.1.1 cc rejects this. */ char const *const *pcpcc; char **ppc; /* NEC SVR4.0.2 mips cc rejects this. */ struct point {int x, y;}; static struct point const zero = {0,0}; /* AIX XL C 1.02.0.0 rejects this. It does not let you subtract one const X* pointer from another in an arm of an if-expression whose if-part is not a constant expression */ const char *g = "string"; pcpcc = &g + (g ? g-g : 0); /* HPUX 7.0 cc rejects these. */ ++pcpcc; ppc = (char**) pcpcc; pcpcc = (char const *const *) ppc; { /* SCO 3.2v4 cc rejects this. */ char *t; char const *s = 0 ? (char *) 0 : (char const *) 0; *t++ = 0; if (s) return 0; } { /* Someone thinks the Sun supposedly-ANSI compiler will reject this. */ int x[] = {25, 17}; const int *foo = &x[0]; ++foo; } { /* Sun SC1.0 ANSI compiler rejects this -- but not the above. */ typedef const int *iptr; iptr p = 0; ++p; } { /* AIX XL C 1.02.0.0 rejects this saying "k.c", line 2.27: 1506-025 (S) Operand must be a modifiable lvalue. */ struct s { int j; const int *ap[3]; }; struct s *b; b->j = 5; } { /* ULTRIX-32 V3.1 (Rev 9) vcc rejects this */ const int foo = 10; if (!foo) return 0; } return !cs[0] && !zero.x; #endif ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_c_const=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_c_const=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi { echo "$as_me:$LINENO: result: $ac_cv_c_const" >&5 echo "${ECHO_T}$ac_cv_c_const" >&6; } if test $ac_cv_c_const = no; then cat >>confdefs.h <<\_ACEOF #define const _ACEOF fi ######## Figure out which math library to use case "$target" in *-*-mingw32*) MATHLIB="" ;; *-*-beos*) MATHLIB="" ;; *) MATHLIB="-lm" { echo "$as_me:$LINENO: checking for main in -lm" >&5 echo $ECHO_N "checking for main in -lm... $ECHO_C" >&6; } if test "${ac_cv_lib_m_main+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lm $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { return main (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && $as_test_x conftest$ac_exeext; then ac_cv_lib_m_main=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_m_main=no fi rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { echo "$as_me:$LINENO: result: $ac_cv_lib_m_main" >&5 echo "${ECHO_T}$ac_cv_lib_m_main" >&6; } if test $ac_cv_lib_m_main = yes; then cat >>confdefs.h <<_ACEOF #define HAVE_LIBM 1 _ACEOF LIBS="-lm $LIBS" else { { echo "$as_me:$LINENO: error: Your system is missing libm (mathlib)!" >&5 echo "$as_me: error: Your system is missing libm (mathlib)!" >&2;} { (exit 1); exit 1; }; } fi ;; esac ######## Check for SDL # Check whether --with-sdl-prefix was given. if test "${with_sdl_prefix+set}" = set; then withval=$with_sdl_prefix; sdl_prefix="$withval" else sdl_prefix="" fi # Check whether --with-sdl-exec-prefix was given. if test "${with_sdl_exec_prefix+set}" = set; then withval=$with_sdl_exec_prefix; sdl_exec_prefix="$withval" else sdl_exec_prefix="" fi # Check whether --enable-sdltest was given. if test "${enable_sdltest+set}" = set; then enableval=$enable_sdltest; else enable_sdltest=yes fi if test x$sdl_exec_prefix != x ; then sdl_args="$sdl_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_args="$sdl_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi # Extract the first word of "sdl-config", so it can be a program name with args. set dummy sdl-config; ac_word=$2 { echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } if test "${ac_cv_path_SDL_CONFIG+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $SDL_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_SDL_CONFIG="$SDL_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_path_SDL_CONFIG="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS test -z "$ac_cv_path_SDL_CONFIG" && ac_cv_path_SDL_CONFIG="no" ;; esac fi SDL_CONFIG=$ac_cv_path_SDL_CONFIG if test -n "$SDL_CONFIG"; then { echo "$as_me:$LINENO: result: $SDL_CONFIG" >&5 echo "${ECHO_T}$SDL_CONFIG" >&6; } else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } fi min_sdl_version=$SDL_VERSION { echo "$as_me:$LINENO: checking for SDL - version >= $min_sdl_version" >&5 echo $ECHO_N "checking for SDL - version >= $min_sdl_version... $ECHO_C" >&6; } no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdlconf_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdlconf_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" rm -f conf.sdltest if test "$cross_compiling" = yes; then echo $ac_n "cross compiling; assumed OK... $ac_c" else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { printf("\n*** 'sdl-config --version' returned %d.%d.%d, but the minimum version\n", $sdl_major_version, $sdl_minor_version, $sdl_micro_version); printf("*** of SDL required is %d.%d.%d. If sdl-config is correct, then it is\n", major, minor, micro); printf("*** best to upgrade to the required version.\n"); printf("*** If sdl-config was wrong, set the environment variable SDL_CONFIG\n"); printf("*** to point to the correct copy of sdl-config, and remove the file\n"); printf("*** config.cache before re-running configure\n"); return 1; } } _ACEOF rm -f conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_try") 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else echo "$as_me: program exited with status $ac_status" >&5 echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) no_sdl=yes fi rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then { echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6; } : else { echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6; } if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include "SDL.h" int main(int argc, char *argv[]) { return 0; } #undef main #define main K_and_R_C_main int main () { return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && $as_test_x conftest$ac_exeext; then echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH" else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" fi rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" { { echo "$as_me:$LINENO: error: *** SDL version $SDL_VERSION not found!" >&5 echo "$as_me: error: *** SDL version $SDL_VERSION not found!" >&2;} { (exit 1); exit 1; }; } fi rm -f conf.sdltest ######## Check for other libs { echo "$as_me:$LINENO: checking for main in -ljpeg" >&5 echo $ECHO_N "checking for main in -ljpeg... $ECHO_C" >&6; } if test "${ac_cv_lib_jpeg_main+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ljpeg $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { return main (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && $as_test_x conftest$ac_exeext; then ac_cv_lib_jpeg_main=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_jpeg_main=no fi rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { echo "$as_me:$LINENO: result: $ac_cv_lib_jpeg_main" >&5 echo "${ECHO_T}$ac_cv_lib_jpeg_main" >&6; } if test $ac_cv_lib_jpeg_main = yes; then cat >>confdefs.h <<_ACEOF #define HAVE_LIBJPEG 1 _ACEOF LIBS="-ljpeg $LIBS" else { { echo "$as_me:$LINENO: error: Your system is missing libjpeg!" >&5 echo "$as_me: error: Your system is missing libjpeg!" >&2;} { (exit 1); exit 1; }; } fi #Commented out because of a bug in the SuSE 6.2 #AC_CHECK_LIB(png, main, , AC_MSG_ERROR(Your system is missing libpng!)) { echo "$as_me:$LINENO: checking for main in -lSDL_mixer" >&5 echo $ECHO_N "checking for main in -lSDL_mixer... $ECHO_C" >&6; } if test "${ac_cv_lib_SDL_mixer_main+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lSDL_mixer $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { return main (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && $as_test_x conftest$ac_exeext; then ac_cv_lib_SDL_mixer_main=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_SDL_mixer_main=no fi rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { echo "$as_me:$LINENO: result: $ac_cv_lib_SDL_mixer_main" >&5 echo "${ECHO_T}$ac_cv_lib_SDL_mixer_main" >&6; } if test $ac_cv_lib_SDL_mixer_main = yes; then SOUND="-lSDL_mixer";CFLAGS="$CFLAGS -DSOUND" fi { echo "$as_me:$LINENO: checking for main in -lSDL_image" >&5 echo $ECHO_N "checking for main in -lSDL_image... $ECHO_C" >&6; } if test "${ac_cv_lib_SDL_image_main+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lSDL_image $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { return main (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && $as_test_x conftest$ac_exeext; then ac_cv_lib_SDL_image_main=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_SDL_image_main=no fi rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { echo "$as_me:$LINENO: result: $ac_cv_lib_SDL_image_main" >&5 echo "${ECHO_T}$ac_cv_lib_SDL_image_main" >&6; } if test $ac_cv_lib_SDL_image_main = yes; then cat >>confdefs.h <<_ACEOF #define HAVE_LIBSDL_IMAGE 1 _ACEOF LIBS="-lSDL_image $LIBS" else { { echo "$as_me:$LINENO: error: Your system is missing libSDL_image!" >&5 echo "$as_me: error: Your system is missing libSDL_image!" >&2;} { (exit 1); exit 1; }; } fi ######## Set compiler flags and libraries CFLAGS="$CFLAGS $SDL_CFLAGS -DDATADIR=\\\"$datadir/bumprace\\\"" LIBS="$LIBS $SDL_LIBS -lSDL_image $SOUND -lz -lSDL" ######## Check for headers ######## Finally create all the generated files ac_config_files="$ac_config_files Makefile src/Makefile data/Makefile data/gfx/Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, we kill variables containing newlines. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. ( for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5 echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( *) $as_unset $ac_var ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space=' '; set) 2>&1` in #( *${as_nl}ac_space=\ *) # `set' does not quote correctly, so add quotes (double-quote # substitution turns \\\\ into \\, and sed turns \\ into \). sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; #( *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) | sed ' /^ac_cv_env_/b end t clear :clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then test "x$cache_file" != "x/dev/null" && { echo "$as_me:$LINENO: updating cache $cache_file" >&5 echo "$as_me: updating cache $cache_file" >&6;} cat confcache >$cache_file else { echo "$as_me:$LINENO: not updating unwritable cache $cache_file" >&5 echo "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' # Transform confdefs.h into DEFS. # Protect against shell expansion while executing Makefile rules. # Protect against Makefile macro expansion. # # If the first sed substitution is executed (which looks for macros that # take arguments), then branch to the quote section. Otherwise, # look for a macro that doesn't take arguments. ac_script=' t clear :clear s/^[ ]*#[ ]*define[ ][ ]*\([^ (][^ (]*([^)]*)\)[ ]*\(.*\)/-D\1=\2/g t quote s/^[ ]*#[ ]*define[ ][ ]*\([^ ][^ ]*\)[ ]*\(.*\)/-D\1=\2/g t quote b any :quote s/[ `~#$^&*(){}\\|;'\''"<>?]/\\&/g s/\[/\\&/g s/\]/\\&/g s/\$/$$/g H :any ${ g s/^\n// s/\n/ /g p } ' DEFS=`sed -n "$ac_script" confdefs.h` ac_libobjs= ac_ltlibobjs= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' ac_i=`echo "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. ac_libobjs="$ac_libobjs \${LIBOBJDIR}$ac_i\$U.$ac_objext" ac_ltlibobjs="$ac_ltlibobjs \${LIBOBJDIR}$ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs if test -z "${AMDEP_TRUE}" && test -z "${AMDEP_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"AMDEP\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"AMDEP\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${am__fastdepCC_TRUE}" && test -z "${am__fastdepCC_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"am__fastdepCC\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"am__fastdepCC\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi : ${CONFIG_STATUS=./config.status} ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5 echo "$as_me: creating $CONFIG_STATUS" >&6;} cat >$CONFIG_STATUS <<_ACEOF #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi # PATH needs CR # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then echo "#! /bin/sh" >conf$$.sh echo "exit 0" >>conf$$.sh chmod +x conf$$.sh if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then PATH_SEPARATOR=';' else PATH_SEPARATOR=: fi rm -f conf$$.sh fi # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) as_nl=' ' IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 { (exit 1); exit 1; } fi # Work around bugs in pre-3.0 UWIN ksh. for as_var in ENV MAIL MAILPATH do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. for as_var in \ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ LC_TELEPHONE LC_TIME do if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then eval $as_var=C; export $as_var else ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var fi done # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # CDPATH. $as_unset CDPATH as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line after each line using $LINENO; the second 'sed' # does the real work. The second script uses 'N' to pair each # line-number line with the line containing $LINENO, and appends # trailing '-' during substitution so that $LINENO is not a special # case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # scripts with optimization help from Paolo Bonzini. Blame Lee # E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in -n*) case `echo 'x\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. *) ECHO_C='\c';; esac;; *) ECHO_N='-n';; esac if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir fi echo >conf$$.file if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 # Save the log message, to keep $[0] and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by $as_me, which was generated by GNU Autoconf 2.61. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " _ACEOF cat >>$CONFIG_STATUS <<_ACEOF # Files that config.status was made for. config_files="$ac_config_files" config_commands="$ac_config_commands" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF ac_cs_usage="\ \`$as_me' instantiates files from templates according to the current configuration. Usage: $0 [OPTIONS] [FILE]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit -q, --quiet do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE Configuration files: $config_files Configuration commands: $config_commands Report bugs to ." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF ac_cs_version="\\ config.status configured by $0, generated by GNU Autoconf 2.61, with options \\"`echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`\\" Copyright (C) 2006 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='$ac_pwd' srcdir='$srcdir' INSTALL='$INSTALL' MKDIR_P='$MKDIR_P' _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # If no file are specified by the user, then we need to provide default # value. By we need to know if files were specified by the user. ac_need_defaults=: while test $# != 0 do case $1 in --*=*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) echo "$ac_cs_version"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift CONFIG_FILES="$CONFIG_FILES $ac_optarg" ac_need_defaults=false;; --he | --h | --help | --hel | -h ) echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) { echo "$as_me: error: unrecognized option: $1 Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; } ;; *) ac_config_targets="$ac_config_targets $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF if \$ac_cs_recheck; then echo "running CONFIG_SHELL=$SHELL $SHELL $0 "$ac_configure_args \$ac_configure_extra_args " --no-create --no-recursion" >&6 CONFIG_SHELL=$SHELL export CONFIG_SHELL exec $SHELL "$0"$ac_configure_args \$ac_configure_extra_args --no-create --no-recursion fi _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX echo "$ac_log" } >&5 _ACEOF cat >>$CONFIG_STATUS <<_ACEOF # # INIT-COMMANDS # AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "depfiles") CONFIG_COMMANDS="$CONFIG_COMMANDS depfiles" ;; "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; "src/Makefile") CONFIG_FILES="$CONFIG_FILES src/Makefile" ;; "data/Makefile") CONFIG_FILES="$CONFIG_FILES data/Makefile" ;; "data/gfx/Makefile") CONFIG_FILES="$CONFIG_FILES data/gfx/Makefile" ;; *) { { echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5 echo "$as_me: error: invalid argument: $ac_config_target" >&2;} { (exit 1); exit 1; }; };; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files test "${CONFIG_COMMANDS+set}" = set || CONFIG_COMMANDS=$config_commands fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= trap 'exit_status=$? { test -z "$tmp" || test ! -d "$tmp" || rm -fr "$tmp"; } && exit $exit_status ' 0 trap '{ (exit 1); exit 1; }' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || { echo "$me: cannot create a temporary directory in ." >&2 { (exit 1); exit 1; } } # # Set up the sed scripts for CONFIG_FILES section. # # No need to generate the scripts if there are no CONFIG_FILES. # This happens for instance when ./config.status config.h if test -n "$CONFIG_FILES"; then _ACEOF ac_delim='%!_!# ' for ac_last_try in false false false false false :; do cat >conf$$subs.sed <<_ACEOF SHELL!$SHELL$ac_delim PATH_SEPARATOR!$PATH_SEPARATOR$ac_delim PACKAGE_NAME!$PACKAGE_NAME$ac_delim PACKAGE_TARNAME!$PACKAGE_TARNAME$ac_delim PACKAGE_VERSION!$PACKAGE_VERSION$ac_delim PACKAGE_STRING!$PACKAGE_STRING$ac_delim PACKAGE_BUGREPORT!$PACKAGE_BUGREPORT$ac_delim exec_prefix!$exec_prefix$ac_delim prefix!$prefix$ac_delim program_transform_name!$program_transform_name$ac_delim bindir!$bindir$ac_delim sbindir!$sbindir$ac_delim libexecdir!$libexecdir$ac_delim datarootdir!$datarootdir$ac_delim datadir!$datadir$ac_delim sysconfdir!$sysconfdir$ac_delim sharedstatedir!$sharedstatedir$ac_delim localstatedir!$localstatedir$ac_delim includedir!$includedir$ac_delim oldincludedir!$oldincludedir$ac_delim docdir!$docdir$ac_delim infodir!$infodir$ac_delim htmldir!$htmldir$ac_delim dvidir!$dvidir$ac_delim pdfdir!$pdfdir$ac_delim psdir!$psdir$ac_delim libdir!$libdir$ac_delim localedir!$localedir$ac_delim mandir!$mandir$ac_delim DEFS!$DEFS$ac_delim ECHO_C!$ECHO_C$ac_delim ECHO_N!$ECHO_N$ac_delim ECHO_T!$ECHO_T$ac_delim LIBS!$LIBS$ac_delim build_alias!$build_alias$ac_delim host_alias!$host_alias$ac_delim target_alias!$target_alias$ac_delim build!$build$ac_delim build_cpu!$build_cpu$ac_delim build_vendor!$build_vendor$ac_delim build_os!$build_os$ac_delim host!$host$ac_delim host_cpu!$host_cpu$ac_delim host_vendor!$host_vendor$ac_delim host_os!$host_os$ac_delim target!$target$ac_delim target_cpu!$target_cpu$ac_delim target_vendor!$target_vendor$ac_delim target_os!$target_os$ac_delim INSTALL_PROGRAM!$INSTALL_PROGRAM$ac_delim INSTALL_SCRIPT!$INSTALL_SCRIPT$ac_delim INSTALL_DATA!$INSTALL_DATA$ac_delim am__isrc!$am__isrc$ac_delim CYGPATH_W!$CYGPATH_W$ac_delim PACKAGE!$PACKAGE$ac_delim VERSION!$VERSION$ac_delim ACLOCAL!$ACLOCAL$ac_delim AUTOCONF!$AUTOCONF$ac_delim AUTOMAKE!$AUTOMAKE$ac_delim AUTOHEADER!$AUTOHEADER$ac_delim MAKEINFO!$MAKEINFO$ac_delim install_sh!$install_sh$ac_delim STRIP!$STRIP$ac_delim INSTALL_STRIP_PROGRAM!$INSTALL_STRIP_PROGRAM$ac_delim mkdir_p!$mkdir_p$ac_delim AWK!$AWK$ac_delim SET_MAKE!$SET_MAKE$ac_delim am__leading_dot!$am__leading_dot$ac_delim AMTAR!$AMTAR$ac_delim am__tar!$am__tar$ac_delim am__untar!$am__untar$ac_delim CC!$CC$ac_delim CFLAGS!$CFLAGS$ac_delim LDFLAGS!$LDFLAGS$ac_delim CPPFLAGS!$CPPFLAGS$ac_delim ac_ct_CC!$ac_ct_CC$ac_delim EXEEXT!$EXEEXT$ac_delim OBJEXT!$OBJEXT$ac_delim DEPDIR!$DEPDIR$ac_delim am__include!$am__include$ac_delim am__quote!$am__quote$ac_delim AMDEP_TRUE!$AMDEP_TRUE$ac_delim AMDEP_FALSE!$AMDEP_FALSE$ac_delim AMDEPBACKSLASH!$AMDEPBACKSLASH$ac_delim CCDEPMODE!$CCDEPMODE$ac_delim am__fastdepCC_TRUE!$am__fastdepCC_TRUE$ac_delim am__fastdepCC_FALSE!$am__fastdepCC_FALSE$ac_delim RANLIB!$RANLIB$ac_delim MATHLIB!$MATHLIB$ac_delim SDL_CONFIG!$SDL_CONFIG$ac_delim SDL_CFLAGS!$SDL_CFLAGS$ac_delim SDL_LIBS!$SDL_LIBS$ac_delim LIBOBJS!$LIBOBJS$ac_delim LTLIBOBJS!$LTLIBOBJS$ac_delim _ACEOF if test `sed -n "s/.*$ac_delim\$/X/p" conf$$subs.sed | grep -c X` = 94; then break elif $ac_last_try; then { { echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5 echo "$as_me: error: could not make $CONFIG_STATUS" >&2;} { (exit 1); exit 1; }; } else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done ac_eof=`sed -n '/^CEOF[0-9]*$/s/CEOF/0/p' conf$$subs.sed` if test -n "$ac_eof"; then ac_eof=`echo "$ac_eof" | sort -nru | sed 1q` ac_eof=`expr $ac_eof + 1` fi cat >>$CONFIG_STATUS <<_ACEOF cat >"\$tmp/subs-1.sed" <<\CEOF$ac_eof /@[a-zA-Z_][a-zA-Z_0-9]*@/!b end _ACEOF sed ' s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g s/^/s,@/; s/!/@,|#_!!_#|/ :n t n s/'"$ac_delim"'$/,g/; t s/$/\\/; p N; s/^.*\n//; s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g; b n ' >>$CONFIG_STATUS >$CONFIG_STATUS <<_ACEOF :end s/|#_!!_#|//g CEOF$ac_eof _ACEOF # VPATH may cause trouble with some makes, so we remove $(srcdir), # ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=/{ s/:*\$(srcdir):*/:/ s/:*\${srcdir}:*/:/ s/:*@srcdir@:*/:/ s/^\([^=]*=[ ]*\):*/\1/ s/:*$// s/^[^=]*=[ ]*$// }' fi cat >>$CONFIG_STATUS <<\_ACEOF fi # test -n "$CONFIG_FILES" for ac_tag in :F $CONFIG_FILES :C $CONFIG_COMMANDS do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) { { echo "$as_me:$LINENO: error: Invalid tag $ac_tag." >&5 echo "$as_me: error: Invalid tag $ac_tag." >&2;} { (exit 1); exit 1; }; };; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || { { echo "$as_me:$LINENO: error: cannot find input file: $ac_f" >&5 echo "$as_me: error: cannot find input file: $ac_f" >&2;} { (exit 1); exit 1; }; };; esac ac_file_inputs="$ac_file_inputs $ac_f" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input="Generated from "`IFS=: echo $* | sed 's|^[^:]*/||;s|:[^:]*/|, |g'`" by configure." if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { echo "$as_me:$LINENO: creating $ac_file" >&5 echo "$as_me: creating $ac_file" >&6;} fi case $ac_tag in *:-:* | *:-) cat >"$tmp/stdin";; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` { as_dir="$ac_dir" case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || { $as_mkdir_p && mkdir -p "$as_dir"; } || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || { { echo "$as_me:$LINENO: error: cannot create directory $as_dir" >&5 echo "$as_me: error: cannot create directory $as_dir" >&2;} { (exit 1); exit 1; }; }; } ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac ac_MKDIR_P=$MKDIR_P case $MKDIR_P in [\\/$]* | ?:[\\/]* ) ;; */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;; esac _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= case `sed -n '/datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p ' $ac_file_inputs` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { echo "$as_me:$LINENO: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF ac_datarootdir_hack=' s&@datadir@&$datadir&g s&@docdir@&$docdir&g s&@infodir@&$infodir&g s&@localedir@&$localedir&g s&@mandir@&$mandir&g s&\\\${datarootdir}&$datarootdir&g' ;; esac _ACEOF # Neutralize VPATH when `$srcdir' = `.'. # Shell code in configure.ac might set extrasub. # FIXME: do we really want to maintain this feature? cat >>$CONFIG_STATUS <<_ACEOF sed "$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s&@configure_input@&$configure_input&;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t s&@MKDIR_P@&$ac_MKDIR_P&;t t $ac_datarootdir_hack " $ac_file_inputs | sed -f "$tmp/subs-1.sed" >$tmp/out test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' "$tmp/out"`; test -z "$ac_out"; } && { echo "$as_me:$LINENO: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined." >&5 echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined." >&2;} rm -f "$tmp/stdin" case $ac_file in -) cat "$tmp/out"; rm -f "$tmp/out";; *) rm -f "$ac_file"; mv "$tmp/out" $ac_file;; esac ;; :C) { echo "$as_me:$LINENO: executing $ac_file commands" >&5 echo "$as_me: executing $ac_file commands" >&6;} ;; esac case $ac_file$ac_mode in "depfiles":C) test x"$AMDEP_TRUE" != x"" || for mf in $CONFIG_FILES; do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`$as_dirname -- "$mf" || $as_expr X"$mf" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$mf" : 'X\(//\)[^/]' \| \ X"$mf" : 'X\(//\)$' \| \ X"$mf" : 'X\(/\)' \| . 2>/dev/null || echo X"$mf" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`$as_dirname -- "$file" || $as_expr X"$file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$file" : 'X\(//\)[^/]' \| \ X"$file" : 'X\(//\)$' \| \ X"$file" : 'X\(/\)' \| . 2>/dev/null || echo X"$file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` { as_dir=$dirpart/$fdir case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || { $as_mkdir_p && mkdir -p "$as_dir"; } || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || { { echo "$as_me:$LINENO: error: cannot create directory $as_dir" >&5 echo "$as_me: error: cannot create directory $as_dir" >&2;} { (exit 1); exit 1; }; }; } # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done ;; esac done # for ac_tag { (exit 0); exit 0; } _ACEOF chmod +x $CONFIG_STATUS ac_clean_files=$ac_clean_files_save # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || { (exit 1); exit 1; } fi bumprace-1.5.4/NEWS0000644000175000017500000000001611217461066010740 00000000000000see ChangeLog bumprace-1.5.4/AUTHORS0000644000175000017500000000141711217461066011317 00000000000000====== CODE ====== Graphics and code by KARL BARTEL: E-mail: karlb@gmx.net Homepage: http://www.linux-games.com Particle code, ideas and other support by LION KIMBRO: E-mail: SnowLion@sprynet.com Some levels by STEPHAN: E-mail: emailme@enthralling.com Second level set by MEHDI YOUSFI-MONOD E-mail: tuxmym@gmail.com ====== ARTWORK ====== The music was written by THE LIZARD KING E-mail: gustaf.grefberg@pp.itv.se Homepage: http://www.itv.se/~a1055/frames.html Files: lizard.mod License: free to use, modify and redistribute Background image by TOZZIE: Homepage: http://www.tozzie-designs.com/ Files: back2.jpg License: free to use, modify and redistribute Sound effects: Copied from an old version of the game Clanbomber Files: explode.wav whoosh.wav winlevel.wav License: GPLbumprace-1.5.4/FAQ0000644000175000017500000000141211217461066010574 00000000000000 BUMPRACE FAQ -------------------------------------------------------------------------------- Q: Fullscreen mode does not work on my computer. A: You probably have an old SDL version. SDL 1.2.x is reccomended for this release. -------------------------------------------------------------------------------- Q: BumpRace runs too slow on my computer. A: 1. turn off particles (-t / --noparticles) 2. turn off fadeouts (-o / --nofadeout) 3. Start your X server at 16 bpp color depth. (startx -- -bpp 16) -------------------------------------------------------------------------------- Q: My question is not written here. A: Then write a mail: karlb@gmx.net or get the newest version of BumpRace from http://www.linux-games.com bumprace-1.5.4/data/0000777000175000017500000000000011754254553011250 500000000000000bumprace-1.5.4/data/Makefile.am0000644000175000017500000000010211754254410013201 00000000000000SUBDIRS = gfx generaldir = $(datadir)/@PACKAGE@ general_DATA = bumprace-1.5.4/data/Makefile.in0000644000175000017500000003556311754254551013243 00000000000000# Makefile.in generated by automake 1.10.1 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ target_triplet = @target@ subdir = data DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/acinclude.m4 \ $(top_srcdir)/configure.in am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = SOURCES = DIST_SOURCES = RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-dvi-recursive install-exec-recursive \ install-html-recursive install-info-recursive \ install-pdf-recursive install-ps-recursive install-recursive \ installcheck-recursive installdirs-recursive pdf-recursive \ ps-recursive uninstall-recursive am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = `echo $$p | sed -e 's|^.*/||'`; am__installdirs = "$(DESTDIR)$(generaldir)" generalDATA_INSTALL = $(INSTALL_DATA) DATA = $(general_DATA) RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive \ distclean-recursive maintainer-clean-recursive ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPPFLAGS = @CPPFLAGS@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EXEEXT = @EXEEXT@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MATHLIB = @MATHLIB@ MKDIR_P = @MKDIR_P@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ RANLIB = @RANLIB@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ ac_ct_CC = @ac_ct_CC@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target = @target@ target_alias = @target_alias@ target_cpu = @target_cpu@ target_os = @target_os@ target_vendor = @target_vendor@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ SUBDIRS = gfx generaldir = $(datadir)/@PACKAGE@ general_DATA = all: all-recursive .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu data/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --gnu data/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh install-generalDATA: $(general_DATA) @$(NORMAL_INSTALL) test -z "$(generaldir)" || $(MKDIR_P) "$(DESTDIR)$(generaldir)" @list='$(general_DATA)'; for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ f=$(am__strip_dir) \ echo " $(generalDATA_INSTALL) '$$d$$p' '$(DESTDIR)$(generaldir)/$$f'"; \ $(generalDATA_INSTALL) "$$d$$p" "$(DESTDIR)$(generaldir)/$$f"; \ done uninstall-generalDATA: @$(NORMAL_UNINSTALL) @list='$(general_DATA)'; for p in $$list; do \ f=$(am__strip_dir) \ echo " rm -f '$(DESTDIR)$(generaldir)/$$f'"; \ rm -f "$(DESTDIR)$(generaldir)/$$f"; \ done # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" $(RECURSIVE_CLEAN_TARGETS): @failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonemtpy = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ distdir=`$(am__cd) $(distdir) && pwd`; \ top_distdir=`$(am__cd) $(top_distdir) && pwd`; \ (cd $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$top_distdir" \ distdir="$$distdir/$$subdir" \ am__remove_distdir=: \ am__skip_length_check=: \ distdir) \ || exit 1; \ fi; \ done check-am: all-am check: check-recursive all-am: Makefile $(DATA) installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(generaldir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-recursive clean-am: clean-generic mostlyclean-am distclean: distclean-recursive -rm -f Makefile distclean-am: clean-am distclean-generic distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive info: info-recursive info-am: install-data-am: install-generalDATA install-dvi: install-dvi-recursive install-exec-am: install-html: install-html-recursive install-info: install-info-recursive install-man: install-pdf: install-pdf-recursive install-ps: install-ps-recursive installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-generalDATA .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) install-am \ install-strip .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am check check-am clean clean-generic ctags \ ctags-recursive distclean distclean-generic distclean-tags \ distdir dvi dvi-am html html-am info info-am install \ install-am install-data install-data-am install-dvi \ install-dvi-am install-exec install-exec-am \ install-generalDATA install-html install-html-am install-info \ install-info-am install-man install-pdf install-pdf-am \ install-ps install-ps-am install-strip installcheck \ installcheck-am installdirs installdirs-am maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic pdf \ pdf-am ps ps-am tags tags-recursive uninstall uninstall-am \ uninstall-generalDATA # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: bumprace-1.5.4/data/gfx/0000777000175000017500000000000011754254553012034 500000000000000bumprace-1.5.4/data/gfx/racerd11.gif0000644000175000017500000000041511217461066014032 00000000000000GIF89a[[[QQQ@@@ ,,, PPPRRR["#%$%&!Made with GIMP, dihlp,Amϥ`x$ (  0j"tJmYpNc:0#v #nO |U ~ 3 =  K K" "!;bumprace-1.5.4/data/gfx/fore2.png0000644000175000017500000001307711217461066013474 00000000000000PNG  IHDR,,ZgAMA aIDATx5xys~]vާgӳHHdŊmqK***!*CHEQ >**llKT,4LwOoֳ|?xgg6%opiZZXzzxM͵!ar '_E5cya0:@z0Ƃ# =h4@ʩSغ=E;†WsӣCƻyo'dtet{ ByzVKzn4WsyQ;?_4Aĸ}*ap8P×cH_L,Ci>T7ngkz l==Rm/΅8u||Fo}oT|ρW! q$ I,0Wkb0@>.fFUI,c')E"sg7{w:v}[-?oư kVҞDk_hzQafJ$;b|?~?'_~5( i1P,Qş煏9{jlז0y:֪{r,8*X˯.nB0HXvڢVoe "HsQ@(\1ˋ$)R+>9vEs b|*,@@4/QVQT1jU4a8ѤRE% WaC٪}?-ڨ7ݽK_FEBAXⅨsA ImIYd;;J  o%)#?r! $R:&Z fchPDlliBD2B hp0*I6PNT 1tnh0T!& G(KFQҔ(jj611DUʢlF3øMB@ 4UyN/ֽXXZD%ւJZh/`{MG!9P-p L%9ø*xǻ[02HE4AbJXg `PQX&pda ']QiKX\G \6W 4F<Sr-thE0 δx?$>|'G!=e}88::d @ZGo8S 3`, *)a5v:88>TkGTc,FXMy!+V1q9`)1&*(H`WbeES> (Pk"#L*$ (;}|ΓH3֜jgQ^(L dm 8[AkfqqI2CZlbO1+Sd@ 'C<<:b{w'?F w4Z@9ōMVA0ZHk1j9=2HDDcB5I&L/|XmѬwC2Ë2C$ʢS$Be_o|q@vwyq /BUBNT*إpa2 A^]^3׮n ~_ Ek xۘiKp"&Xlaׇ# I$> \OsMA՗XWo!+28K݃+xw:Y!|xNa^Ä8_~qCtOzh6P 3Y2E S_u)s 9^Y^{Gc8V3Ow&}AJUZ&2GM*ʇN n>7:&њLY2KHVpqtg7|dVFkRA(:bPY5n.VWqP[zw \f#\yЏ G!<61!`1L Q +%Y #&g(tF #% l `NF B:@ AĀ'cE܈>5~{ocl13%.\~:LR@C.mZ_ %'rY! &nT c/>s ׮^%éjԩ$&bK94k{, ֐)2G]s֎1؁P@یpVPa'.(ؠZ+h,bni++hVb~!5 vR 4 |$OY@*,i Z~iD<:k1F0J'zUHQl~^X/Vl?~Xg^z4H;w‚{TZAI vY<4ACC*G Μ;GĄzJ@paùIlEx0(v Ol.՛ɕ ncy^/wϫؼ vvd"2Ja~~l 1yJ@AA / [.\ZLB/Az<"֔'no͌, 6?tB_~L>878<3GRh24%HYAA ) "GUB7?6j$׿Sa"n7Hf\ǩ6&~zJ=7&i⍳KU}tncDžT5{?~[N2L)(8)L{+Өzvtw_,qE`;1$$yo>v<0f&D^\8޲Y:Vֹ|$҈+Kl޽ZZ_y}B;p/)pd 1$GQ33)RATbA,prыqo.^72R:o:%&_CN˓0 s$v6MaqTTfb?]HAx_4M% $IaUkPyyaAwqMp OjS7RطSIENDB`bumprace-1.5.4/data/gfx/fore6.png0000644000175000017500000000173211217461066013473 00000000000000PNG  IHDR;0gAMA aIDATxoU{gl;<ڤZ)AEBBA, MX +b"6AA64q?c<.')]|s=H>s{)4}#KGR}@zXXbU]ϸ,6Kmad 96rӑPL_`R)5.+SXMޮ:?G~񢓝8=*~?6G0 E|yT,~wt>fĚ;f(U[>dݙ@jWqE qs/Օ-5SCg'.,NTUWNr$VO (-JSoro;w%6BV>Zgwnj'C*4^gy VRpIENDB`bumprace-1.5.4/data/gfx/racerd14.gif0000644000175000017500000000041311217461066014033 00000000000000GIF89a;;;QQQJJJ!!""RRR$___!Made with GIMP,~ dihlpBm^`bqK:ҙzjU]AV({H `$|\vp< yy{2~;x@@#%$!;bumprace-1.5.4/data/gfx/cannon14.jpg0000644000175000017500000000236311217461066014070 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULlaNC= $MUԠ溘0 Ӧj #B! .rϧF7ፁd:|M+?Q岣Rnzl=9k^j0Noieǂ.5Ok1x~?)汁xHTDt xzUOmH'kqrg+YL|u$ǎW'j)>`#Oʢ0w=\feBT O:jvm<2,5˰XdێSC@I!n~uzVEY]g;'R)Mdc8}*5}CK#g`L7ahZ#0À0'{^5+S"+ <2,5˰Xdێwfw=ϿO~GOE*͋Mdqp18pYyp?4)dj6^#IGTZBC,D5j2.#`Iۮd8}W[kÇӢ؋)bD1T ' Gen93mBD Dٵ\k \}FG,Fۮ.< v!UX 2"0z%s%=5Yb9>Uf"/b.K|R>H3}no{b1FQ/NgK-24O(0 z.z͈ dлwNg7_\{<}>3,bfIENDB`bumprace-1.5.4/data/gfx/cannon8.jpg0000644000175000017500000000242511217461066014012 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>Sn(4a< |HFv:)ͨvXVEY]g;'R)Mdc8}* W2Ks,qc¤FaDaOOsx`wMbxD#bFwb =z*{a5 DžcsEU[LlaNC= $z ]~c[R2@ uH54m2(cr@54pȈrriu2;p؉a+F=7_Tƥn,"IW S#8n>>~~~zzzqqqlll888}}}{{{xxxuuurrrnnniii333yyywwwoookkk///...ssspppmmm+++qpppiiuppujjtdds]]:::<<<xnnxiixddy__xYYxSSvMM=;;^RRaPPss}ZZ|TT|OOZII]FFbEEss~OOTTs>>W@@X>>hCCffLLNNIIv66%H))EEBBDD@@z//w**G%%J$$<<99<<8844{$$w I 7755225511-- HL00..,,..** JN**(('' IMQK!Made with GIMP,H*\Ȱ!:@ @@4pB @@B.LA@ 6X!D1Å $J4q&A 6[kU/l#2fШ!8r@"d"F$%L8J)ST2,Yl/`ˆC3mѤQM7o഍#g:vG>}T( BμЙ;bumprace-1.5.4/data/gfx/fore15.gif0000644000175000017500000000222111217461066013526 00000000000000GIF89a((~~~}}}!Made with GIMP,((   ʚ̸űλܳl5Wչ @p<=!-M"~"XA!Bl6 LDN$g"`1t @q(h3ey|8!JDytΥbJ %JCS&/*b =I+Q8˒ ҷ̞ %MQ$JTרC{k6p m;4콱(ad{Exf'"wx1i6K8m @ 4cڶQƥ5˥M\ 'R;o&?OajԊʦE ҟyMl9vfͫP+x/gy+w_{U_) %^lͶ_v%8߂,˃]* V]NXHb ~R.Ђ }]do>/ 0 2!裑NԲL3@C 6܀C:C=A1EaH$K0DN<EQH1Uh ^)fg&o)gwgZ]~fn™ģv'~Raڠ顝z jYy)2 gFz*T`5 kj :iY(kEr ÒjjŲ:;ŠZREïjzl;bumprace-1.5.4/data/gfx/fore16.gif0000644000175000017500000000226211217461066013534 00000000000000GIF89a((~~~}}}|||{{{zzzyyyxxxwwwvvvuuutttsssrrrqqqpppooo!Made with GIMP,((  ϼ‹ǘՉ׎䆈đƖ1@SsTldqŋ=KnI(bɓ#,ZcΟ;DB7QcʥޖYĉ8*ِ5zjU=9iK(A J@Yz|I+y`Ū@]j qD*Xhap^I/5l .:(>zk K.jO]/Z9BHO &~0\O?I9 ?"  $!;bumprace-1.5.4/data/gfx/cannon21.jpg0000644000175000017500000000231111217461066014057 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uz~-w2byMUS)ʩ8S򕈈Jm#3U={[v+#:Z麑!Ou)0(6 q1|n*1Y/lHp,A9EOv&Vb: pNh,yͦ6MI'`E1GF-pOjVͻBY,sH!YY.N\=9Τs6_<#)³mn@18\8=[B #sUc%۸V5k|,Vya5F<:XqW -AJO>(uʓ_ ۵xdYZkacr1x Tq~%y>WFʥ NIy*In 1I P0g;c uAs* 6`+7L9T/4˕Sq袐W,MgUf|t=(oSzq\bumprace-1.5.4/data/gfx/select.gif0000644000175000017500000000717511217461066013721 00000000000000GIF89axFG$GΊH&NJ&&H̦k&fG~J6&&&f~&k&k(&hf6Gkf7~J̻&&~G~~F&  ~77& ~f̗~G(~k~kk~~:~6ZZZkW~Z|66ڦf}}WWr777WJ}}}rWWWW777~W~~W~  &ʲr~ Jڻڗ}}   ֲ~~}~Z~~.r~~rrJ6&f~ZrN*&Gk!Made with GIMP,xe(>`?|v]&;Z86x$ⵠIMK:-@ c E A0n -D7KvE0$&CxٍvCM!Qv|)5=° (|R̀#15HXIg?r.pD`n4! iBS X5iNG'3M.kXf}iVɯ4U=[79tj_:浭b`{Z5S]G{&p?}lSmpzHmm[fx t[u=`z[|Ѵt d'z 7wf{Mfƽ=Yw1'hFUf|=o~}&ё^/ݬA:bKIաt{|@:ص}b?;Tucxwݾ[aoԲ=ﯦ3,s>,Qs(Nwr0WFxWyb`zNMg $@|Ѕ^|@bxink0 CІ0@Pux{l~8Xhjj&`bH; j 0kvhkp(s( wzȇ}xxgiƈa88HPȆm8o r艟xȘHhqj9G腏nexjqthX⨌XhφpHHgٸȉ(縏؏Tm+i؅٨ȉvX8؎XgHᨏoV*Y8k+ǎ8[h葙!yIX(@hm2yֈ؉$&ByXɌ抯82fxix؍"<)XX;bumprace-1.5.4/data/gfx/racerc11.gif0000644000175000017500000000230411217461066014030 00000000000000GIF89a>*$BJ24J*,F&$R.4Z^"R:4Z*4R"$Rj  r> *^64n6<~64~BLF6<  V B..&.RTFDJTFDFLr>L &,."&"**f\b\jlbdft:>LJT J\*4 & fdrl~t~|†6J\.j"n:T*<*."  ʂ|ڒ֦NFB\*D  fdjlr|΂ʒ.FLV\R\:L.<~RTV\jtvbd&.4"BD," ~ZT>DzRTVFLFFL&,$ 2&~JD>D~6<>"$>&46$:"$.fB$R6}(H,,

o͊FAE-rbT/PÉcT*e ҒX4E@ _uuuwÏ>?ggw_ /a7eX轤;r"NF;j*e  ao eM`zx4L%~Vgxf"lTݴ$Mp / {w8cH5U6u^ۼ LDd#!eNFI#ՕL04@w"ߏRbFtjA`tq4ޅ)U-c9f ^o8m @; RʀG2"g-Z/OW #h uwyg_>|vÉjVp 8>00[v( qa8`fFqzr(gl UM] vWڲ`& qsϏ:lpqM0i5W9"㘄DZD~M>|A{{ؽ LL qe{;<v[kZGqv?$ ж@4󬶆(4R :I6#HDTn6i0?{[d@x^(9T#[YWF7,( ,#. #0geS@5  $0srzH}. b#xb h OuHG?Og~u:"_xU ukS;g&e[ŵi?Ijuj.VMMY53ZL ?N9!bɯgizaѦ<#_qߏtvzMq' Zy JvUxã'6LgQGt_>oSz'm(Q7n*D@` $ 014v/֗1VZH:0 ZDZ4P5\[mim%M7뙖 7SYѓ4Mc!D@Yaa/0 ($kT6?{lQGrp{s.-Y.7 nr|O?],_Uun1kIENDB`bumprace-1.5.4/data/gfx/racerd13.gif0000644000175000017500000000040711217461066014035 00000000000000GIF89a+++,,,QQQxxx111 +RRRLLL02469;!Made with GIMP,z dihln `өlx R@8"JeәNU)h\YFY(bNG$ [Y }xy/N"!;bumprace-1.5.4/data/gfx/cannon15.jpg0000644000175000017500000000237111217461066014070 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULhl7rbP]Ơdcֿ?4]>[=YH#>Óa6(Xmn.3G[`a8 >.;'VakoHP$,JBcqqY>g=ZRIKE[שA"TҮ^C(hY"OI?>ywTu81Es="x[LskO.ӓo)5Or&(ԯ$L,6z=y3c3}O +MrUwP:AET8Sbumprace-1.5.4/data/gfx/racere11.gif0000644000175000017500000000117011217461066014032 00000000000000GIF89a12+3ypE,>g+777))) 0ooouuuSSS###J,PPPlllLLL KKKxxxzzziiiGGG{{{^^^MMM666vvvhhhXXX@@@000tttdddHHH333JJJqqqWWW999$$$eeeFFF(((yyy444IIIjjjVVV888rrrppp\\\DDDgggBBB"""]]]NNNQQQ!Made with GIMP,ˀ  !"#$%&'()**+,-.-/0*)$12345!6789:;<=>?@ABC؝DEFGHIJK5LEMNOLA )M*XQ,eѲKrR H`|s19ZÅ2dϟ;bumprace-1.5.4/data/gfx/cannon12.jpg0000644000175000017500000000241011217461066014057 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}*ucEcy v\UK`<7Fe# FOI4ݎѫN rQϸf%l^I5 i8ui}xPբjҳD\G; 9κ.t=Y%k\ zIs^i9i&i򫑒'y)[‚5v0|׏YS )֟<2,5˰Xdێ><{nlC"$NL><ʚnl~|j,,l^\&$EfRTNNL44@44nl~VTFDj9:,,334NAAVTzGEu>:<::GAAhabi@?W?>hh`89+$$f*,K$$f$$vtvt.,vt@@^RT6 PP@@nNLVPQXYHHr9:WVFDvrthh" YZnZ\VJLvGFjFDGG$$34Ҟ||r,,rJ24F24+,:64*:%$JR54{| :*,BBDzBDW~bdbd~RTbbd2bBD{rtRTBDrtbd*,RRTrt}Z\JLZ\uBDrtrrt~jljljlZ\!Made with GIMP,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJիXjʵׯ`ÊKٳhӪ]˶۷pʝKݻx˷߿aJ`Ŧp`CfnYLN{`ܘ[',v.]qd-6)jԛfڃ4)@,WN1g)Y۞e۸i[>A[w<AßNNȞv]}[~Aut Ʒ^513t {ƲLPAj("7uSuw%^]ؘ%-]0 ~Oks?^EݓkM9ro"0ězcECnw֖_W؂'C 0 ./9ݰgmbh`5]ЯrmƼ _ށ>/.}\vPFFhߪ nl)3 !`xT^%3 DߎnԞ 3 6$? @D/S_m&vN׆7y/d8E2^p|a?">HF#"1ɣZ4H9Fhnya)^pc# >HH1ѐ)T~8ˁpp7Ee/-@$"o0?GRCP*02"x/P4U2$ǠaHK*tpsp/40L8A(C QzqĠBD_,FxomQoJh<aL&Msu^f7w.oyVsfq<`CP:`A8π).;w`ӦM1j#9#OzKw4YG OO9}˰@a0=u"4aMGFC8%w0;n䎟}L.Md 㞻̭L#6Gnރ@|A?/ ;~κx?bxLzI#Yi{۽}ELb🽕%^ݺy o7k E |uyh.00}3eqvvr(`+u'eWWs4wneT{CoJ@kof MЄPUP3yI/P^^(7zc'gW#E#~~r.aQifw9pw6hw=s@8`8 BJ`t &P1EP'  c [E`}nq%XHF#vR   3!Xae]vn%0zx||w<(a(x=؈GXko Su< ` n@'  G (j(`p8( nua3H X7w~w;'oo`@L0uz L0$P^~bGvb Pu 8 P /sew`p LJ6nZsVeVoJ0RK@VTqk @AȒ33n 4@8 } ȏܰ8}+V3eTPJINy{z\:eef6]`hx Pu) 407) ٓɩ2C)(0Kɔؐ >nW9Hm6V tw Ai戎)Л) J?Pʙ0>4 Fa@Ӊٔň w:@hf%0Z jТɞt'7 y ) 9 9p9Ҡ :+Ij@\p:9{h8ٝT)Z iڢ.ڞ|t6:ߠ sJFzPLJ H S+r9W6Yi8;>88 Z>P Mxqtt yZ@LS0pP @ B٘e% zJ^98יizZo* &LȄy`pp @JЫ  :?9exF5@ՊZZ wO٩w(x`ڢ@bخ 7jy sЫJ+` xQrٰTzZMy_ #ʃ7{p犮&{Ly|퀣s= 2 TrI655PF{H v aJ$vڠ k8Mhgp @ ֋p۶ Ԋy[ʥxe  o 0M۠pjwP`;XK}("nP;vWKMPMJ+m˶{ u ;a` }ګ kнM Lkր> FI\{﫹+_wMj;axÐZLo0Ã[kdV뀾DaP;ؚ閝۴gV G0k@6;LnTpCƗkę ;tRLaGx`T,p 3lk PK[rW Cl<YKܥPIwK a`}Y,k; Th`_& ,ɓ\{ɘY׼mY׍9P ^n2G/T aOl/V_xzjs'|L[s7@MYq 0K%{ .'?< ɿI}@8_MXaۏK1aB 0!B s<1DŽ-ZXQ T8vRȐ @yuЬkL?[ęSN=}g?1+X)҂L &, CP%^HQƭ=I(Sx2&LfW.P6"֢{c_%|tzPpCXfXqװÎIYTrl6fl~'xM޷SVJj8Ëm?n-auSKJ/$D|!M,mdR יRQXBmWه#/\ծjIU[0LC5V`-(-S0avu嘙o!5s2}9渐gԌIhaLButfZ))>]\+k GKKaپμg;[*P6M-; 8zp˗(6sζ N./CE30z zs{ Vh(7Ɵ{~_|bí5=SzC~nkm??WXAi4:I(π$&.3C`%x@mX5AT`E8BЄ'Da UBЅ/a e8CІ7auCЇ?b8D"шGDbD&6щOb8E*VъWbE.vы_c8F2ьgDcոF6ql;bumprace-1.5.4/data/gfx/racere13.gif0000644000175000017500000000115411217461066014036 00000000000000GIF89a)*uuu.am8eeer/DDDnnnhhh444E}}}sssZZZu*jjjrrr[[[((()___પ~~~vvvNNN...J8򢢢xxxoooiii666wwwlllbbbYYYSSSRRRgggXXXKKKCCC@@@>>>===QQQpppfffGGG222###!!! 888^^^EEE111mmmIII!Made with GIMP,    !"#$%&'() *+,-./01234 56789:;<=>?@A+BC.DEFGHIJHB8K024qJ)$WdѲEG\zE/(i2EJ1 2˗0cʜI@;bumprace-1.5.4/data/gfx/racerd9.gif0000644000175000017500000000032111217461066013755 00000000000000GIF89accc444)))QQQ RRRPPPd!Made with GIMP,tI8ͻ`(dPNJCvQ\a¼յ%38@V4vbhЦjq:ohÆ">/ pr  %;bumprace-1.5.4/data/gfx/racerc1.gif0000644000175000017500000000227311217461066013754 00000000000000GIF89aB*,>.,6&$*F*$J*,N.,N&$F&$62"&V64Z24V*$N"J&:.6"2*Z64^.,n24b*,Z"$B">6.*fB<~FL^6L:L"4"**^\jdz|Ί΢.N\.f|B\*<" bdvl֎Ҧ.VdFJ>\.D&j\~|z|&JTZd R\>L^LVLZ\JLjV\&6<"JT*>D:. *"vFD~64~:@"\DLR,Yl򣋗(_jN&1dʘ9sM5kz aà6TܼG:uqgH(xF>}&К5w"R A2tDN BE1:#"IB(C+8I&l‰ApI']0' BJ)(%x*;I( + ,AtA,2K)b-D.‹.H* PF)T;bumprace-1.5.4/data/gfx/racerf6.gif0000644000175000017500000000116411217461066013762 00000000000000GIF89a,,QQEE==66FF??;;<<@@@@ W@@NMMOOOQQQRRRTTT///kn$$q**t11@@FFMM}KK UFFLFFLLLNNNPPPVVV111,,,jl p&&s--x55}??IITT. YDD[LLSMMKKKMMMlllccceee333---[]`b##d))f//QQ^^ZZU;;VBBaSSd^^^^^___aaaYYY[[[```bbb...(((Z\^`##b((d..f55h<<_==dHHiTTqcc-++444777XXXZZZ\\\]]]fff'''CDFGHI!!J%%J**'&&)))+++222666UUUWWWA&&&***!Made with GIMP,ǀ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKGLM5NOPQRSTUVWXYZ[L ˈ/`ˆL2fΠIf Bmܼ1N8rF9"!!:pޯ,6.p9dXV/N_w1 QV*f_7[$a}q "'y$I&jP'ȰxB?D <@81Jȟ <CX[Y+Ĺk5nލ$wh^gqPQa7/1n4]yb1ܹzp\&!8.IQsOz +_oO~ ȧ̊ӫtwȕL{k4,[dXEEV5@E/]0(/wgrV l:p.k\,ɆjP6`q{iDYD&nTFZCq%TDBa b?Xl2Vͮ^$i^~ʢtx1V%i;lѸZciRYii$1YQtMTa6`fݲdEרH0Ru @fj3I %eYbvpT(P5jkQj~Fw{C6s~xxvDHkkfsG xssfo~y̹,I$1QC qrI.&qgei!OkA00g,EY׭|r{N0Qf{ЛO$` w~5smG7qEpr-Vs6VsVs]Qtٲ,s=z>tzfyN"sjUHQEHP愼`$ \u` i8lr]p+Y,(,FbkP @fHDEQ N b, 82,,}{ "./8 m7KG?,fWo,^k<W0O'B*˒,f`p|tV @@wu)1Qm3Qͷ(reYzϾ p)Kuj(*S&y.&j9 8.c N/- tdwIENDB`bumprace-1.5.4/data/gfx/racere2.gif0000644000175000017500000000114511217461066013754 00000000000000GIF89aPPPsss;;;nnnvvvgggddd```wwwZZZ~~~rrrSSSlllէIII툈:::XXX...kkkJJJcccbbb>>>|||\\\===tttWWWoooUUU???iiixxxVVVAAA KKK___YYY111CCC(((e,,,---D:W.3!Made with GIMP,   !"#$ %&'()*+,-.( /0/123456789:;ߤ'<=>?@ABAC( #$Q$ MxzJ)STREG+\E pAɲK;bumprace-1.5.4/data/gfx/racerd3.gif0000644000175000017500000000041211217461066013750 00000000000000GIF89a\\\\RRRQQQkkkLLL!Made with GIMP,} dihlp,k@A +1b,\J$̙3s??/4L>/3¿qBvv &Yh$I= &)s}jþnPo{ڕ[+|4 P!;4yO48煏qr0t̯&F߾p[K{=RVٌsie O|}{;%Nޗj^4gW\)HҊ\/-K l5?s@@fV׮r6#`~+-wʍ?gGEF?\tԨ5`*HBɴ†(6g$)JAw&1 T<_)+tu]sj܉D :v(Y`KRX _~z]lrui%DF"Bɳgo2ι<`2cJxwS8vxD쯿Ke2!pm)־ԇNyVTLS "냚8.rh@P =_|.KvxnkfD`oV_wT_( @={>|"DH"%QmAfg?vРi-m}$3N0OWY|"_6;o:4'@MyۏLE8Ǿ6ʳ_[rBHYTYk`;n~OnGQ\kW&U"0LZYv,_d1=ٙyW<…>ڡҪc_µh [o~ k$Ck7\PRRSaAXb14q^?6CD72|Dys̄b8XIz&HZ:6Vѣ;}>H)lS`CO O2Hk&cAJ 0bi bCAO gNlY&;P"ƍ^6_K۷ Cf:taB@ZSPquoDIsHt:>A}( 6TYM/ovy|Hє]Ko^=vD laϣ;x}66t(C'v_]qG\-k;䈌 I|Ͼ-F4;M7QL=\fկQL:rﻎvŗ$ΫW^m{U|6\lJ ,٥o~yֽ_? 7y6 ΄W/) r7TM2tҤu+ӴܫW˾zh/A#\0ony7aߗ/^yݬ{? ѢEQPFl^o={^Y_9!|.3-_FTE!La1KɓsΝܕ⌯Ԣ/w|A=aaFMäP6v¥?_huX䠚=j O8:ݼ䗁B1Z4Yo>97Ƨ8uɛAAJdW3 2A"F!Lo>j*zT>rN]@e$ZQUttct[TB|&sƎmKv&o2 ԃnHejGFf#G_h]tu+O㈎.OEQ!mO \oHgk7E,cvrkB !7.X|4,*q7R~5yow/¿m غu )9ƏAҙr@h?逻?I J fc¥=_߸1pƐTt3?~% ̶1^0ܨ ۧ`s<)]j@3`斡w'^NLNX"r;ǝu'#5$mS&Mt@x :uڷS[Ώ+w c4SEp+' p#н~ˑ#P-'n;P?cы~I:Ra3鵇oco_G0 qtq''ļy,wih8Ҥ[f@w92E}/@IYˑr +siek.M̺Ud;Ƀ4EBGSA] 6o0r34TO8saE{]t $;(S;2wK3_즫SJWahƦvr8#җ6)W]Įiq)LTnHȚxMzl6 5I}BBĮ (<㔷ӢaK}㤙\z)l+禝>iӅ0S6o_0..`raW)+6>{˗{-ghu[IkVwQF1?__[9Em?lM3xDmW~΂n!{O>M! K5עqBR_0E.~YJ}ef(v_V]͙WZ% yygt NS, >))NPlmuˈuBMA}|-_~^_=8-im_uc _#d,JGSX:ɬ]SfW*?;"o_r'ԆD _Q^vrp3=F#..~~6_w-n/Q!k+l3k^nLȳ~%WGn)ɑZ7mzw禭-Z}&EnEP"`NNAytu>~}Z>0Q):;m~]9^Zm!3U ~Nm[jn11wk-Qt/ Co2HLq*I(r;籘u@ <ڂwxsr䦺=C\ݒ^p?ݢɝWܭ6CAt5eB+ "灨sotrutE2ut.#WdHR ( @ߋofv"&9ܟr[j<׽ g8v3//vcϼ?_$dWc>u ȸ8aUι.R&agYD ?ZV&HdjVH1<QojgZrI混}g!l-ۻMú2c$n?Iŀsso|_dU*?er<X+9LVVP+CϘr6J4=_m3C<@w/odi.砿N(Yϫ/RT-}/zm'Ωgׂy7^FB Pެs@YY$m]RyxՖ.Ogy?(aƪ6αL0͡z]z텪״kz̧y E]땸DȸwjɎxUJ.:Hv6` ÑJ33WhyӦZaQw7S k\i9Q#u*jJ* cEl߬[u?'y0bx$I Ʋ;_L|00eRBɱ97M71=ݧA6m:T{IKz'S';D^nt(ڊHDB "Wj.!VA_K?fp5270%2Hl<'^Ӭw=A@ɓ;ܓwc7d4u™B*HNlga#_Bc (y-Zu)ۺy,:܁lspx4g+sξ{w|q`5Aq+ڌiucvgw_Sdy'Ń.{k[ V!M^4>؂3;AAp/`JrRp}ٵ &Mu@Ǿ-.z8=3@텒INni\sp{oI|&TU?iRT}FLLTf*r4#n#ɓ;:NCu3O4)Wft?^1vT4[Wfl/*gnnsp g ޘD~,J#ư fr3[¶vEicf+WS'[3 /W_NB+=)SmAj⇓t`yL>fL˳% Yqf0~V;6ޯ:ǩ1(֭|}We%%ϯt֒ɮ" a&kz-+&Țwqu~1FZAAقbס8v0~O%~sxu>=U޿qeF>V3)bպS;oWڗ =y72d]STzg~^V(WG!fD`KTk&زuFf̹̫.FJ&VdvE gI%iO_~SB-Z)_dx[&P@[_~١W_Q~c$,S?xsn%HB՗ K5{&Wi^?>GZtW;Z>Jr4|G#4|._b nݿ ;t{4ɹ"˫N-y1Ǖ&a=yAG|ɏ>effx5-}amO끳"_}vE _F3yl 3xlYeʜF@Ir@CԜN/lree+ `8j7?\qn)x%zdd~W`%29'LbNn_hkn.LQڑ#~!'>HW_]CjӼDBUõb(B7zJýz_UT `Y4\#" 9x3ВՓtuG"pջzd\ǶQ&XmI>Ң<Ç{\r F^$ rO,z *d| $7n=_RM4Bh0cWO5d6zWQ9r ʑ  VR OjtXɁ֯~ɒ-z|3p=^Tj8>/_ן BBBNqA)c2"V`(C*KKC.?{[~?N7|F){q@0ޘ굣 uLa/8O8 CY=Z)A ,HJsu4z֫!ǮN^)8:3|MSF0Q0, P% p]듊!ꐈi{2[A7#| e;K ՒfQVuqɤ~ie!m#ѣfh!JSIWm=!E>-a0HPJ$FG@N=oG=K>uj{Qѹm%! VEDTQ@ Cj5Suo ∢Yb1Spaa $ S~3߮ׯ6ݩQms\C3hegTyI$*v\qeV4C$ )´PY㞺GG@/ VZǁʈHE"BFOOwwwL RKD z5Ӧ H+<s5o/ە@Bƾ]S|}G6mf9hϊV+psPfeMC r Ψ@=$4c$\q%QQE7턳EsՔE b0/Q tQh`*$+ LtiP+2LZ&Zhy%%lǝQiv{2( ^0(!n#<=o "2) /+\ĉ/Oi w$4R)Go@ ZbD:ei^SrLY'-6l莝P^\.*@2?ZQF +ZrB˥$\sY&6Ahh,B-rI6ɸ<=wϾ廮uDiJym#OiDZ!k 2(B C-]<@Hd38t{evhYd(  z ,З;~݆y>֒uh^WoDj¦Q~Oӳ0ˋno: ql0\ulۡ`nnu\ "t?IҥKGmYՐ'Ywٹ0:䀼_Aσ 199Ske^0ܱY5>?< Q0 x0׷#zEHҫ0p5j3TGO<LON'˼͇QHœw+F $HeibX7Db[a"Ѧ>+-U:ݷlbň!B.J.jܢc佶yNjvkjkkp  }x#_rFR PrKVPnM+--]Se}kX|B&@ΝUjTEE>Ztioe^ixtS~_fJ $q3% vBݯtRh=9v.~A/siGlPSht!0 +ڣ:`]CT5k;X'}NsրEHZv tKK9#F!iL:g̘&8P9 [ˍ QZi>υʵP@хhں*So|n@ÅZPʧ:`}ܤcATV rF"Ӡ|.q"'GL`L;rYU$}(cRAEƅQPCWHƀg5Hxm~] q\BcE`Z/l+;])v `P#h,3(c&vPt*/78"Ʉoi-||mZ 떏5}giSZj<5ΣtF "Mt*MM}+cuۜJ^:#T@:t_|`BkkPRVC|ni oUV`\i!EW}T@O6{&wZק]iQ+/=ML"i\WD!;KpTe"1r##<22<#ZC9l٭e˻~YX72a fse%5??7{ﲍ7'vz k)TUU$([vn myO9o`"#ôZ fs"Q钂4c=k0DDRP`THLƄ |]OjyƅyaZ4ŮLRir#f$:"9ctE/ñ 0j @+V:)([t9p@&M*oViH 1)roѰf ɩ'eREĠn: B.Qyy*장jDIDŁhvoΜ}1!Hee=~Inn]`Iˁ# xjXy CCcLtO5{YȜ,6cl@J*&c%׿c KHȨ5^n$99666xS7MRHmdΜ9mcOvIIXvd:JAWVz}N9 㕢$5dbcg)B HP[M$g=Uiʓ B ="v&A Yh3>;ޓ0+1RzgQ̙S-yVDT H  6< &0INL H.ILQ??FS<ܳQz9+t ,{. BU@=1C쩴N,J,Z*XB#8(5KAXx+Rޜs.T WLJJаT1"DBclJ0CAޖ:cɾFߌ%UUr9/)(5*@I='F&G$.~Ak;Hb"ܱc/YK4(#El, z3;$8VEd4Q/Z G"bb4[[+ё$OTwl>S±R"hD#S"* a^&;:6_v[ȳhC%%ֽo|8̃]Ŏɥx1εn SL_%@{tܗ|F3c=kؚ*P<@0Ov& ]IW\=^ ^a^*,A _Qz$zM:5\L_bPRBi <3OlUӂx+Q8\91jzP`l"64ܞ(?B Q(AhxDA>QɁJpTG 0ɅVh-'*:9I\㚳< =8@|O z.@Gw<ALppE+ D Z@DzXX|P, ؇c, q[Pܳx|fA>"ϲ0ǫYЌHTf)<^K)1G0LNɁ0FRbh?L$y 4&(MO2 HT[bOay 2)=hB_D9"B1 # 0>bdb=uW,H<͟zHE<%{?[E.EEJ]0D|˵!2b׊r@h|.k0 z$/c+U=,".%ASiQSTT۵E ⡢TjęLL CArAƏ |qb1bte=P]<ߝo!#>OCiċ)|[e;=b'3,I p*xKZ"ԌN1-^*;x.Ǒ#>>J$>e0t{1`T41 Bqqq@b2\b!K֙L^e-LjzyBʠOPm聤D>-YZR `ĺB* qnaJa $kkLg~y6z# [c/Bu' L%pfAXJ`y4+CFS$;.O?_Y*몪AP)ToiWgAO)D-eD߾HK= 8X >(D<6PZPATU9GFIax5c#ZX9~?bTG92HQPgRCĂ!f[t MeFl:fP1G}# irXjy:>#цܶXX2Ȉaa3e_20r2Oz)E$!@r :?hOS;DlGF?u@QzW\_9rH"K%3a d\c3 =D"jLZkh" Ѕ >=):ʆeC]_@L[#F@o!2*VATROaAV$Pa9 YM67BAѣ~Ga!Y#µmx9<B0 B*$l]`-[mGܹsI( Gb[j6)EM@,Q,(p`S%$C6Ѳ]cOlNcP+b %oԜuAFC~|~\Ζlʳ""##u}-[.ܹͦ&&R(AN1:X,Yq 6-#b0H0([f ;` BrX&@[| \=mkX@?Qztrɯ1BUo9yQ:\N D})#1(hy j++ TZf2đ m " oD|&COH0XGW&D8P&ÇTntNBC%2]ۗ#@R&Vv෠@LV!ZeƻrX!H̑0边q)kIa;_ $IOÅnvz0#ByR kjjjn}D'Ag"90l# h̍F t 2G$xO96q 3 n2r{h eR鮧A taAPˁ+Ֆ%RQl2lH&aZfAaEV$ԧ=B~D0| ֽ\yRff/kW~2O<Cv% ^͛ #:BE19Nq$QL9DŽ@HS$*$I&$mI~\r^9֭1E:d Z G-96D('/'EAha "1 x / aB "Ք/R+u L$Ajf|3iPy8 b6>9{1,DZn0:"%`40]JVFh38.<$]jj0Gq~UIϷ[pQ@7K114^=Hb&c :atQnDr耛4Ɗ/6Dq${pR1zLv>P[ nEe[a974iҕ+֔$!' 45ǾW!E}@GZ0[y1(Xϱ/ t''/J^蝘!Vzzڦ2x,&-h Ӄ|h]دߕ+(Q=Jktc1W8"f|etgD`ʆ2Q<ڦ*Ǖp"D- +a.i"ې'B(#G}&úII$hJ"Kt.*O4oD[dA@|8" Ƹ~!Q1y`[&3ܗ1(.a]MDmr"VEߜ7#ShA~@S)gj k-kBah5 ǔ)Ӕ TY KW~f4FX;! Uhu?=CzzɁO:,X j W.\~,kŊ '*F8ܾm:D"6]2oXdXhJOD\=:B=c@WNAW4Mz,8^R w!Y+΍JIW b{mVDFE <*P[ӊ h֊2CIc^:UϦo8mو;r~_ytxhpcߍ9vnȑޭ]ڕI=1xJ og~z2T1yQ AH 4LLɽzu:DwR܋a8~FLhW5RDVWX`t5v+hkFB7~3v+.F(=޾WX]]| *MCP(-> B,wlOԠO<~m;Wٍ"j,p=!%GA(Ç:J18Bpa3`Y}r; p j)mJj%5xcG4Ckz3kϗsМK))h&^<|*\{]kGΟ?CquB+Q ԝxuqD"-χؐ3R_*"n0T2fMƠDf).`4̛s/?fC͸O z/(ϝ7C€@z/Fr`j |qalhCvϨB.I|> "p5!pB.ڸccf`จw/ڿ?J-h5>\w6I5cnH~kѥcÁPq +*"MvvIRK,XȻ\Pp՜f6hc#\_x>%6?Vw56m0m\~G#JLP}JOqgu gwj)$L($r)nEN( B(}))R8riԄ AmBl9=F>a"ĉ7ߙ53 :xMM֞ҩA9tlH[BPkA+] (CIy<҂QO AQB2GZvDWS4y3\IDAT8u-EQ5# ?2*3-n`ףGuJ*]ti/jO+- `-o.nB,>E}򬬬1c8f5Lmg| \JqWn]P"tԋ/\V0]m|R?2"* J+pѹT-nRn޴i={A)^B[fn zI&O2ŋ{ZIM糢̰zZ;{:GOlj-qe6xŃ δBՇ9v6N'Dt *33t:t]ŲeVV`1ǻ ͛6mB_m>7服./[+2Xf|U>>ʮorw _ӯ: xڼh~pfU5Cw?d'f-geت*DNyNƃLJ3Q%ɏO[hK|.`U&߄c[YSr}F />؎@&ȼ\SP/u&ggmLFIENDB`bumprace-1.5.4/data/gfx/cannon7.jpg0000644000175000017500000000240611217461066014010 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULlaNC= $w8n4?_mZ2X3=x9|X;ey#+""e˝8 r\ǣ<eYEJ x/ş nnR8gٮah;K 7,yѯSW 51vTd-֚2IY'd $Ď^<](u31QE3-[$2SnXqT%Hb@ U=GΊ)erj[uVgʮ @3(7bumprace-1.5.4/data/gfx/racerc17.gif0000644000175000017500000000230311217461066014035 00000000000000GIF89a>*,6"$J2,N2,F"BB*4:2"."&V:4R*,V&$Z.,N&JB">&$2.&b:4^.,j24j.,Z"$R&,J&6:"2&*b>4n:4v:<^2T:D4"" ^dnlvtΊƚ.NL.f|*n:L.D &bd~֮2ZdFFB\ z"V\N\>\*< &  ~RL^d^dZ\rbd*24"BD2D:6 6 * zZT>D",,"^j^ BzFD6*4B",Jjz nFjB<~64z24v24V",F$N*$J~jn.4f*,^&$^*,NJj fV.,b64Z*,N^"$N.,J&$F&$>F>>*$6&. !Made with GIMP,H*\ȰÇ#* @D0pA .`$L@0dаC <|B$J8A *Vh1d̘A#C 7pL@"<H!C!b9 IP&M8y%)DTcG+ `ɢe .^ #$ɐYX4iԬa8qIB' buAsO={ c$b@^ "THLCA0EL5r $)D"IDK /aʤ &N<}J(R$1&TBLJ+ ,@B1 -`K ܂K.K/8t 0 +ń1 2  $C2D.43P2L4" $4|54iXfH;bumprace-1.5.4/data/gfx/racerb_big.gif0000644000175000017500000001116411217461066014512 00000000000000GIF89affd664|NNLBBD&l26d*.d>Bt>><"lJJLZZ\.~~|L26T>B\VVT:>dl::T&**,*.6&.lJNd&*d"6:LFF\rrt6:d:>T"*l&.|\BF\.2l ,FFD&&$26tFJtFJdbbd26\l224*2lRRl&|>>T*2|nnl"NR\""4"&l66d.2\:B"t^^\BB\RVt**D*.lNRl"|6:\zz|"\<|jjl::<BBL""$&t26lBFl>>L"tJJTZZdT66L>BdVVd:>t::\&..,2:|&.tNNl&*l6:TFFdvvt6:l:>\FFTRRT*.|JJd66\"*tBFdt>>\*2.2d""dD!Made with GIMP,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJիXjʵׯ`ÊKٳhӪ]˶۷pʝKݻx˷߿ LÈ+^̸ǐ#KL˘3k̹ϠC=sFH7 ^k/b Cut HտW`@|8q/:p/ dwAu^n'6 @oc y Kں s}.*E7t!Ȑz{7C`ax! KTX}]`_~  8݊UGRh,q(ȏ`At0bD  0 XdF:)'){ ^\{Bk[~#fH揌6h sFb $}) +0Ad`QE]ިcHz+s>Ft+uٵU@ M4l\*@߫٨wZj`a)Z$𩧡"ƻLpQUؚ ~k:b ߞbD&k(d$kT}:Li YnWɾ+W' X *\BpzKR*. W^`D+ ord,OCL cx&3W)dB vW"'P7}W%즣 os^+| 6@GV^6g| w!coq|uћ>}J1kYָ5yM|l,s>m.~_Bt34A-Nx%;.a`#jȶ (p_ >dx9D'my?o@G*ᖞЈFtq ĉ\^QR#1@ԡĤ/n"w?JLyGBAj@B#6+X bd |pvw p\3nNidXǽUt^,IFAhB;Cdp=Ot8fX҆Pq~M[:HꋉbM% y , `rZ!"R _n\{̯sK;&Ȑ7oiL[gUscGB!9q:Y* Er¾aބ:R|(K<ҎwTHWP:7mыV &h9:C@$ㅝb PVR|&_L:ǚttJ#6DEяTUjpщ3+9T5 P0sE L iij 4Ҵ_ҁle葸Ua(*E׌.կF|QX|&t(fCUr悎yLiMb|#\KnDR+TռI-liK[.@G(;e@Ip \&MiEL?nЦo5MV)<K`__] &Xl|Ĉ>0ߢ0h~77:JzMuLNB^SXףբMo_:wxmiKb.lA%0F(6cј -qq\ܺQgQ)df3Ri*2Iy? b,گ岉3tot 7͘F3 c/%f" |v@&! nml_WgY˵no\28Vp~ͬ_87Ϧ%h'$JC~[G[(.-A )Ð2W=tsMhZ$@`c+J8 ?QR¦k2?@olh,k9ѷ.І@E?=H>kElΙΠ[Z03)r{CCr <215%=iyy1,H oխ{lЁpֶskA?UwGͩXt>rVnS\pX N{Nn&z]2*4D73Φ٭.P3\l ?j0]F\5.ۉ_`Z7Ԣ#?VHx?onhL?ZpnĖW;>q.OC?4}t٧?zܗM&a*x*C~6mS+fnv['[E Ky}kGzϖSVwo7B}0/;B~(=e7@W|\K7|w7znw1}k5j;Udր{!{80-B-`y7|f|&y%p%H='zwVD4uu]*=2`ǃ;rAhgnFHbv,QtFw|:|%[hx.'(sx{~@BD+| XbmwbX|؄G2h"zV]Gf!ag:H(+K=|?7b7bHp\P3PrHxHx\hdMI2Kv5#3rbv7q'FJ7!،؊r6*]:?:5+/08GbyȌ a{tV}v#ؖjr-ב>xZS+$-")/`iqi]ƒA1WOdgZ/P/,=.C@J9)pWRYZbgW͑$\{}?'&8@%:)ABCD=4E&9$N 0i(QJ2J(V` c,Z¥/`j3˗0k;bumprace-1.5.4/data/gfx/fore3.png0000644000175000017500000000447711217461066013501 00000000000000PNG  IHDR(( H_gAMA aPLTEfpL&X^v%>,^i*6z"*>/?4\S&b$*&$V$B<fKT.>NDB:D2@*I)~#OD>4%B,,F15N8bl.~(&02:r(z$f9&DFN)#RJ\fj(:1R"\e"qF&P"j" vJ"Ts|.f,LWNXF<*"WL.'%F+JTF$:4bW3,26<Z-R/nzlu*N,n$R'*@JD7.=b lB($J)r|:N<8B<,Z,.&KDn5*.Dt"ENDV*`J6^&g66<z^:"D2c.lX&`.n*xR*\4R6'v$2B4"Z$N:T8J;-b-^.d&r$6,$N&N>T&)j*^"h.,2,`6h72>V.\t&|:R<:6D4,:*D~*J2P\gtALbl(n%>"HFPN"Xv}e2oHJLR! VABD*$*B/fF.Lz*?2F.64~.v,V"_F"Pf*pelU_"~VU\2F4"zbl@&I1.R&\Nl2t2J4T\R.\.B4N3Z6r*|H>LV\*V,*f,>6D.j,*r'NB"LfJBLק IDATxT[g4 .%!971%BJj`R-(BYKRtRшZ*m-ֶPk?vgfyw{0 R# @@(U dD%IQCddE)1%e @<5yZt%YgL7^g0ӤZg+32X1 d:GcA \&FڼuKl*.Pjk`vpjGt V].lULRX$KRYOpww?.L>t4''O͏,&W?M=e9"c qѧJd;\8LnBt/P4a\ F0m[ec҉&-F72~|W/#:[/ӆ' c-EHE(NiuC?fs!b&2m5kQ h_+G$P>>EEErrrbbbBBBJJJɨ|||iiiHHHMMM}}}ݟsssgggeeedddcccaaaNNNvvvҮ{{{zzzyyyLLLlllƪIII```mmmQQQ///52.222OOOUUU666R###[[[jjj]]]p'DDDpppSSSKKK444Guuu111h-<<<l<&&&..!Made with GIMP,  !!"# $%&'())*+,-*./012'3456)789:7;<=>?@A&BCDEFGHIJKLMNO""e$*!\r,Z&m)B .GxR'23L2̜Ų˗0c: ;bumprace-1.5.4/data/gfx/cannon6.jpg0000644000175000017500000000240111217461066014002 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULlaNC= $o ~(bWGsn&ZąBT>ciz5#w̅*X眐M\IGr֒DJFW$gRUik?5= 'm巳bg`3Ou/O~iV6 K&u2w 6qpH䁃u[xG$$,ϫMGasF1=ey1*r*sbrE(?+~[~^%$+`mad|qWAMXM5 km %a(fn`[''{t[$FG [s RH :㭒 QH,cY*dvȒhy~\oEbk?-3W~PQEKzӊ?bumprace-1.5.4/data/gfx/racerf8.gif0000644000175000017500000000205611217461066013765 00000000000000GIF89ajiacki ;Kceg""j$$@IKNg$$i((l))j**) KNPm..o33l00B( * MPS##u<>D((__pp,.T--\\hKKmUU,/O11R77\\hPPm[['E22SAAkkrr}}}{{{C44F::HAAA??ooollljjjhhhC<<=;;@@@DDDGGGKKKdddkkkttt977<<>>BBBEEEIIIMMMgggnnnuuu666999===HHHLLLeeeppp888|||iiibbb ___###[[[!Made with GIMP,H*\ȰÇ# @" 8`  0hq"H@ .`Ƞa<|B%\v0qE +Xp'2fШaK8r@2H#G$QI'@"e *V`q+1-\x&1L:)c 4jaӱ7pșCwg+}Xȍ8ЩѤM lqB1ćJI߇!lHUyѓN0;bumprace-1.5.4/data/gfx/racerf15.gif0000644000175000017500000000112311217461066014035 00000000000000GIF89a999<<<333666888:::fffhhh555cccdddgggiffk__wcck,,i&&g!!&&!!```aaaeeegccfZZq]]iigCC^^OOCC::22,,''"" yyytttaTTjVVcFFoDDMMFF@@::5500++''qjj"fGGg@@Y22^//??994400++''>**B((X00^..c,,i))o''u%%{##((48=h((n&&t##z!!:>CHy @DI!Made with GIMP,      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ,IB+X2eѲKN|@3jȱL;bumprace-1.5.4/data/gfx/cannon19.jpg0000644000175000017500000000240711217461066014074 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>WTO~E%_| _޻$4гrrf&u?Px4iw}Nn YeuJ8<`TwyJDC67Q^h, fM̳og1{ aAsnEVv?GVDE8˓;ONp@'zo rSC;^/j-J7Esnx;vޡm4onʻ^7޲#na(`dv@HHuUKpNaI]8PN㭒 QH,cY*dvȒhy~\oEbk?-3W~PQEKzӊ?bumprace-1.5.4/data/gfx/cannon3.jpg0000644000175000017500000000237611217461066014012 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c>STk:(YQMM8S27~$RintңR)}̅2FČg {Thk`a #抻M6MI'`E46\JbNxsnEVv?V 5-O2j*bXɒjO^3YI=*5yr|߮jR.n-cclŏ9wbp:z5Ů f 1Qax u9u5__Dp sҲ]'`uTB/穙c,.Zz7ޢ +MrUwP:AET8Sbumprace-1.5.4/data/gfx/racere9.gif0000644000175000017500000000116111217461066013761 00000000000000GIF89a+3=1Ge|86=9&&&<<>>===:::!Made with GIMP,Ā  !"#$%&'()*+,-./°012*345673189:;<='>?@AA8BCD:EF:GH;IJK#LMN*h"=RBA+*pȸR ,YtH1hQ.V,"0 0-_i ͛8s* ;bumprace-1.5.4/data/gfx/racerc7.gif0000644000175000017500000000226711217461066013765 00000000000000GIF89a>*$B*4>&J.4F&$J*$:6"2"*V6"22*f:4b.,b*Df&$^&,Z&,J&:6.*.,.$~2$z.n24j.4V",>662"" .^.,N*$>"$22*:4n64 .&".,*4:L..<:D&4 .JDVLNDZT>DB\*FTFT6L&4 "*&Z\bdndrtzʒJFd*j|nB\.D  "" fdfl~|ގ֚®2NTF>Fd*<& ^drtR\:L*&rNLZdbd~nt*24>DBL2D,"  zVT~FDFLRTVFLFFL"&,:<6$f.,NJB6Z24b:<^*,FR2,R.$B.$F2,!Made with GIMP,H*\ȰÇ#. `D0` .X"H@B.`Ƞa :x"F(aăP8b-\A"F2fAF  C z4l` B)b$=@(&M=<7!Made with GIMP, dihl+1; p}sGC" Hh&M7juh:k0bjzet$o ,  ]*!;bumprace-1.5.4/data/gfx/timeout.png0000644000175000017500000011531411217461066014142 00000000000000PNG  IHDRM8gAMA abKGD pHYs  #utIME)˾} IDATx}{|ՙc.Kd[e8rpb$^`@ڲ5ჴۯewen@tKdKX -, tSZLC mV$DH:ёF3f$r2_ithf9}ފߞz*T(ƺ#c *TPBʼn\w@\BB *TP4P ,\ *TP|vE֍صJڌx) *TPBI(,Y7c-Kɻ0PcUPB *Q&=R$茶@u !N̯{ IKA]%*TPB P ҄u3frFv޵o +pس/5V7YC<%]] *TP"jH (Ků;N t \s7r·w] ~. QB *TP!ʹ 1&fg'B\@Z0:mi$V*TPB %k3]>)Ϻk19m?b9T#zUPB *cCb(/8z 8rTw~䏶 RUPB *Tc ;.d"a\o_\;n'λ˥&PB *frJ 悴 )GHcrWzb߂44$kJ*TPBrA9r3r}J.R!$_nb}1uŵ F{w>:H4,茩] *TPCsA>^+D)yc?*_ebP)-|fʞD4hEjJ *TW(G  %Ş )>Y4a;Ѣ;1axY{-vC\u& UTo]ZPa,vEoԯ?(%zUPB|J xowx8-[箈S˶z)I%>pRmn:4MnURAg9$`>yŌbƜ[H__ UQ *T($DtP^(u;p+~OvO5_s}"b~0{{)Iؕu hCS]C_?' H_ )9K"vL9[億F!il_x@_UG*TPq#)E$wPI@69m_zs`Q`]П<, Y]=dBGLLL2@[Kޏ{,rjz.stA!4(<%Ԋ { B-)z)dZw휋z)4c-|`W,+=~Uo *T($G{ :2+L]g8-U(YgG8m}`%+(v>d]`rfJl@;kkn'X\ǖ}XmC{,v;ql P!8fe3mr%9@X2׹iC<{h?yW|8W1h` =Pޤ=?Dȣ~A=z(]owYa"1.} ӠB *Thq"T],__醙}vAM:ų/ݯ]/mIvyv;N tܼ7x} {8hu-]CߞƢǰ}w,䨻H :"RgЦ 1%<>uc AЍ4`,?zn7m5$G<>T@4٢Tc0 @ BMdAKwʕ I{(1!h!ŴB *T+XetF:<(}_А|KB9r톤DSܼ.<~ˀK_JQEhP$Fg ᚵ\q$/?Nr<8).1P,à( T&q5kldAИJ鎦 \WO }a0^CPuR׼XD wIOw>Y#$ H2d(TB *NdqB 03lW t̀&j~i|7Q{?% ;@Zc1ZF.)ajNn-HwV?_X9.@PB㳺0/?\o5k3wY|3KD^:z}fhk3N ENnrF,뀯|}JiNz:z>.wUֹ򿿰ߖ@@fR"^Cw]ƺ xhB ̀JVG;/`m34]nùV0Exw"[-OB$lB{O.* I0?tSԬ:[Ozc~0#׭v}X6.i?.&R*TPBE9 rIhlw9N t%!I;}'6]Л.Z}A|=59mFgMnGm!77Ӕ'+^ ؽ+R_m xׅ|hw$]@*A@c&#ށh" ڛI*T(=T DSZG˧<(&va ϻhnC>+c~1D6pBC '%;^X/ yz!B g,P40Mv<ĝ@dK-x f QgJ:'] @+T;u%ﲜ w@Vv5[=k%88E9Cjzuyk숎xܫœq:4;ֲ_p*aW攕F7zcJصٓB]G:&=W Qƪ(GQ be0'Ч=z;ɧлΊmZ;.Ӻ+jz1&5:J+ˍ'y /KBE١t{krFThP *qP 2 X{7OMֈZ^E6X*!&724{<`g N[6'+gvVƼXx=iq0.(`V@IWZ*TȁԹD|R~2qvgbk}9! x [6[U5T1Q,s-an:L=}C'+u#„rhBykIW5D *f?*fQPE U8vmP*J5oxU3W.qly5[={,8|[SEH=Vړ3m ?'p'~i}i[Wך?~ͻR֍T1Vzi:`AN|5#IyOډ*wLfgb+p-RI?IJb{9{PrDk9gp2XMG S!R2n'> DPa;~$'~\`ݬܸ;LIV}H"oZ8Lp$Qc#z'^ lǐI ћ[odF־ X\V4z0 *eRV-W=$_ r [=O ?T)>`˃ DQ b~ryy;\_|(SŬ|xşJyCoM Wpix ^n? "9ptX2.YȨO|&h 4DcW1QIK1X*Pb inλ46 r1$|5im5]ÕRAFA-FrCsu{Ϯoo kbQx ?]ly6)smtFHD!NeiY;^C9/{~V̽ 95!n1$s^[(kOuT"vqa* \η4v %D(땊f)Yr8aaxӉ1i](" z@nd=HǎBˊȁMtB -,1jrF#+)ţx,<.NTc?.zQ8O4y,+%K>.ڎp世 {gSڋJ'~1a\2+7brs~"^Cm3s,^!;:[䌶)'VGJq.tXS..~U1VΈt&t{lv-]lxEF$K ߵ8ת3\r=ՇcFhEryMtrZ)} (d"/WRr)sĮ5\x/ &|هBrp.Tz;;tL8C(`Ig#w 1UNf7dw!㖄bu@1 [R^v@ޜe:Eֹ̯CSfsMb_ ک|7_'ŎD-2?`Lov)H(KYSk(Cw^ e pIbړHo DܮK!܁ HV?1~#!vFAR9O IY}^)ujO""Z3ߓК-] 1t~ ys dJdyg!$Ԉz:`AWab88_^3X8t~Xwk^z\/K)O\|;>}OԈ5H=# wP:Xs-2W0 |dya 0T# dyrF[W)e+ h!"dލ5t'\ .j<@jlhC>BvôT;g8r{܅[ ȵID!]Xg1{+PJIrTR$H姈5î&rOpFgM`a O̸} i lirN 7~áz|brଵeqz-gqA#|C 68"WxCݯo\֒]}HI%I'Ew|^&S\Ho-"w;= <'g/Ƨd Crde 㬵 ew.6V) !ugƑQЭX87tS\)A y'ﰆ9[lDN0F~DzKOY3Qw"NƜq)1>1`KKDN&=!1D . \k͛{9%wޭx Tdy[;XT< `NS8|[wL3ÒurwشANœ`(y-`+.}{R"CwQK_a.!:<"PU-UԪ fD1B<:lQ> '>r1-9g>\Me;=N*dLnEw: ~wOK0!6fo v CՀ\Y~kZG渡"s|!H,׿'8h:p@ XX_/hh&0-aO1_NX@By4`ۏgZss݆ 9/_!pEd4ϫ'F֩qqS-dۿApρFtBxWث)R$=WOpIJp~ օ9+f~];{5BX0Z)7"/2–&7JFBq Пl"Q _mw /0頭MncyL)k;F߫#A@H6+W>ܼWG=rXR1TH[MB?M.? T##!l<KKHRO'5XhCb;:wk;naxXO*~wB:ĉ;fދfu$Z8a4> o;͝^G< ]e>ĤPR4LkzY b< DrK&"qϷM`No Բ)UB>3xi(;ǭALྰ|D,F;d@8HR?p_v\_v'jzROuJ mRêbQ !i79mz.:-6+;6?yȷzƹ!>sコQH [۫!Й$z{nOrd@VD׈::wz6|N13=2lC.: 8Q ]ZjՇ/v r0:8[vRT(haBU08I2'9!R*߼N*3@)|1O]!kɱޮ4LL!>%"s ϶bѶqR Q8.{l Cnj IDATOHSqx\J<պwY^?5Z0Wر~0˒h'3]2%ғu 㞧8lׄERJE" ~< aZa-B.dBgق÷5{p U3e:&p85}xVv#)7E`j%c*!y8NU5f,6˺+>B°4I~[u'ɟĝ8EH\ފ'vi;m8 Y.Hиƺ*ܳC"(0lMj)Q&'#N!*RDZqΣ{g ,(#Ͽ ` $HLjLTY&=zO|p92dGiY[h0jqz .,=Hp7Z8cvbpW 2TQDdY^C{{q}ʷ2S^'Rл3z"lJ}"Y we ~.5k:,gL^|t)glw^_3,g#+]Suѵ,cUF 7bE;S@j "c+}}!@{; *1G(ά& +2r$ ;#FKlqn't \0sCok^(z^C/#K܅v">5;ΥbDKD]ZUamMrBk {1va;i|8v&BCsrǬXܴkݚ\8 44?RxhOH{ZĐv92kxF%œ%|1|2jl E#Q`k}`Nh?iW\:s`t]blJ { ~`eHぃcARՆŏ_Mn৯yTrq\l`uy3$ $w= @̯(U/l|1@0L.@3 6M׃*+J-,= L ř+AII.{HB7.J/𪳞~Y#3h;368}xWZӾ[RױP/=RXi-֕_K n?OJޕ]szڣ3K1~Ց`ʡB(_3\%aWG3~LR8ƫZNwHJ8Q*К9B$=n[.78C! J!ߠ@dp zEE9PE!R/{[O(u1ÝUn$؅^cK@⁃cY#bdwYs;bLhOx½+@G{K} &/7VaVT}ʂw@bכzYpg.}ݙ-P7-|ݱ6,w 锃ǿ|!A95 iAKaf.8:9mm~9k`/_Ig g+pu ww#v-L"^yul'N~Ļ~d?ƟwLȮ6y8cWp~t7,{["f )=c6m̜+4y$T <6.>@dbpYkr% {k59[{O2~zhLp23:W&~|w[9923BfY-p_:^c#]0}kn'yk81w'͋1PH-o׀^n\x(zƹo{`OR 1ӭ a gJ;D359mgotR [A5K%(f q-)b\4쉶M9w6 {Z,þSduIvsc}"@otsm^s]zf*󗪭_3 ?QH@03+پ1 }:IAsR픅#Ԋ'D޵h̿@ƲRE*Dɺe}z J<_LIҲ]}מh'`sw,xg4=f,ZF׿tx ٤=d";yz-DΗ+kHCXgY@fBܼfu OzM+W<j,;N`R͔TN{ %bI¬NHqqE š5b۟,*.IU E. P r ιș 5j̨ړi wB_",^,Bvf=ΤMsHn,>YuU="[lqqT#dˠw<,/ڙq9@ryOyf)\G N %X{Q$,0m/6A'9JBW?jFORH!n0S .Terѣ!5ݲ rxB+%KWkt_ߪͧr"hQ0Wf3ڦ ?KK_)<3έX M!T\Y^iMDbwn?PtVEK})z_:< Ws}3$)cw-UBGAύʄmxW/1+Q_c$O!MکG_c]4:ĈywF۴( #"1/K!3yb!u2t!tGH \v qn'H}} ӿ_єN`yF$|8W .&JspQLRn6PHG F  вeJ=V]^kWqIetӅBa8m)AX=nh  i;s 2{"ETQoWš!Asa(u7&ǂl 0OliC|d4ֳ=09mZ!e P*;@3Vך\ވp/#v5&GrHjzn4lt Rܱ$])^Z.i(j$!H-M&,io( dw'.K1h+5kꪰ֌EB!0\)gޔ"Iƍ,Y|s~D =Gmn,6Sk(p"1q!w֠29m~^jVךmdQ,DNI!rz;R[OK\B$ V fkV]tuqKK]A#.2F) YDHTގ1HzH9, m\0xBސZ_wZ~TVxu+El/4E>+ ߵwm+w;6 (tPVs)kJ)kQ(pm͖:ǂKx|?@ryWf籬! uO<<b/S-)Nj؜Ne8y.pMzrs~Xu0ΔdzX!( '7u.#O3fh"HМAy #Q=N/vU[ZйK DHK9r |YlR宜zRQNPkNen]wJ>hQRlB&%,ƩV+8D!VDowFaƞX8 $zfp0͔*2)mZeo(@mQI\N5!r0D &ijfKM˟'zhh K'Gk>ʎ]H̀g_P[uPd&7F^E|zKZ(:G'c}u IVs)uZ+nduar/M! pN2R' 9"?^4Gcp2UQ5S; ]vNVb},)k͍Ȉ_SPwC;:iZRLn$jdAЕ [ZPaRRTb,ƥhD5iHl(Ya5iE&%dv~%휤BLVB*^GO^Vĺi}'YU@9ʗelh|λr]MdoLKKw0# r2R ۓ׌w] T%Hk&u @Blxnͪs*R.%%5k:;+dO`a{r AJ$YPWHDW9מ]jŗ^BaMWɐuB{gTeHAynZXN=o.$43 Kipa֗rhK~Qyf&iOBIuY'aͻ+E)SOe IDAT;נkۚg3fוrќv1 A3مZbl\ۓ|J-\RJ,CZPf3_frsǂdǵTw.#1 Iz2g#op4,'0? y0w}sb{xzי{ZDIh{ sH"i= 3`tƮjo}LTi+q[[c*C2fr|$}Ol{ Vc rdRa Bw2̷gT52(Yk.椢]|>,G8EJc 1R]qb{,_b;*ls_;88 n-ҧ4[VLRI~O$ ̻ ݙ]յƛ7IqRͳ.f2¾\\4%#qM5]55КS7昶G4Opc^G o'8mJ-iۇ*Z]|i?m?V?^VT,K b LUŃ#|D3Su@^gkj|-L6CUJ~&3ŗjQ뗎_m]֚^TLƗƃ#k NO`#&0yjCs^4 *0'8.ُT_jt&q}t #tuŰ+0͓zHp}>UOpшWlyOmto@Rl*@ae< amSq5TW'pOPC~X$-P N>JpQg]+l*_5*䌶U[Ɨj|-}"^h1ULėLXohq[yEP8HuKQ .WسwӅ_;~\4~^~~;}y9Q ˣi&?[҄{/{w zG^Z~ORs4U9~jӰ*<{8M~Z#_[AS!R1ŗZ'/?{>G~m ھ5Oϯ15WŮb3k ^Ip!Y̌KU1t}@\QB} 5MEپ5"YX(տ륤RZ"E hR8EۉHHzKuB$r~_"茶}PO)8{88/QCe?ͻlDGޝ࠭Mz,s~c]4zqH[ZEHdm$D#^CHP 8^Ğ`$v7{OmZ2v-b*9=r01|vE[W.q症xw]˂^ĔǮ@B0B1KŐLHC}8ޢxKF{>䚓>*+?Q\s.ZCI-aš2N1~h8%Ttg%bƾ] Bɹ!/49{&2 FbTKא{¬1L--\B,|ƬsܰuK~͘gx;Gkj(IU˼Ƃd'<_ı'S"FjA`upՙ|);nnwtb%3ٸOnڍ{<>`ͭx|h^3!!6Ru^Յdl[}'aZaB2 X@u%ƒ;v폟FC4 L9 1m&pjOX}z[g\XN~X1i\ZaG $g崱a-_Bߜo`,-K$︎!,.\l)iلcWl;hf?fɤM4+kйG34{EȂa_, 9 #Ew4$zs'1"U˒u2XC3 @{c'V!;p6ͳJ~wuN,MqwL>uݘ{PCB HV=Us͌al 4 X ؟[37@I\U))JEO&Pu2y"mKKYG/-0֓T8 ]R 1wB&a_SWX*+T}&r3r7zc#A@&YUV,a%X ÷5{h3䨒>C%9TF>ZB&aS(!#>)I >3eV 3xǹx!֨Ƒ.Ul᱔L:bh4>~k9 1t+C:KdkJh.=r J} %eN:wHq Ji'Z<}$w.4؅ƇF4{ƹGȊ=\v6-ztv'ܗ{A;Y=rm&Wp`n2£Ƒٔ}-zQbtH=VqgI9?YdM\ F1u[ й!'ȭ@B4(ۨSP?L,N ɱ(;SÒl$w??=+kI,s eۙ@߳KǒOM# J&a9 (+%}(r2Jyש$UK%[ Iy_0"OCs*`eגY7^?"^g|ڍzݶ 0ttW,wU ,ZoN{,@(1T( rqfm%(>3<(Eh+hN;F{~ȏw³9/K2ح|s/ "h@w]2!`--[fѬGb<3b*-kH]ٻ^}!X̦GI:z wPyj,Td)`ǚ*T؎!FDm/4J*-IQi q :JcYv b])8nVE&2*/S^W(ªK$`=0%J&"CNo?cTp& xdd Hk8q2Ui%VLN?[~:G)j[S%Q;9|1M.Bbq㔬0n|KŅ\NxY![PH ]T%fӸo`vI;#;ƻB̺s/3]ɹ[.H .*茝Aw5)iO 2* jGɗf^[*=%mA 8-f(hak^k2vŜcehwY,!x`dBPi  W3,E֥O-I>" W#Y,+.]DdBz#E~/*<6]gE`{~zRȥ:fX\$*c= 7X,M}ʖ 2j*Kk^J}N%dZLUzE}i/ sW$;EZ*Ncl  ]B4!0<EAcW^ᐅ@+I*(Il 竔Eg*i vF)H݊fWE:_ \YkV4W9/eC6d/6߱?H$fs9.$ńML'FvAxZ c̯a!%C}u a\aSQVvo)]/d xQPtG|F̯NE[nz٤E-NxV$jB^%ʆKaiILF@NڇƋS(ʉCRV՘zhhB)/,y ۙ쪢8|l/w8')(=ÿ.U҆5m4Xh8eŽeiozf:%{,9|S#wk#R{kW1\#Hlm޲}aÌ lpb<v(wh89ybwlX^CڡE=pt M7m$LsFŶҘ_39PIxglngA[BO"4)Ӑ]y0-$am3 lb=d.jO$o+M { RMrM CSa b"('3.xe;P_lGHf*2΂rPa">%;/u3$bI&(}$8MZuoZ J:YKd.\i}+.M8qve kZ#T.j} _L-'%  EY~[.άį< U3ڨ c迠 Ӭ\l7b Ӭıj.q ,oMqӵz7ڱʜı?zx[Ӭ7͓2#~~70Ys+"ja?KT/)H'ӅQ{<+)j)i66Ǽۀ$$s$¼ع@E}F1Ob3 lvٍ߇9x%{1ovݩpjm+޶ǁ?vpRhd2ԇu-Pi .6-<])ib*.5 bWM|w`s*,KsP,ĉl'|.jnYԪl'cQ*cWBW> os[a_j/F!b5Py#]v#t՛BOm\{=<=_01wݹoK3 s몁Z38|OllVtž ԝPhz1Ǯ,(N9RXf 6v{8Ui҃Xba8W$7|]wݣx ,,9:/4 c ۏzUYx8Cp~Gv—"I+wW'(v:!uuxUj`è[khkK1*WQw%F;''$$W1kXU<tJ`O~ @ #AtCj=!r WZ,Y$)>쨂n끘w )U0s@Ne"H\eP OޑY=\#k1^kgn~ԫ> g{/{n P=w"އvp/()c>b΁5Z@R-=Fmg.^Y `-@%CwZZX҄h!F;ֵa~,?`B, `zBY~#~ ]u =v(RI9; -نMNC.\'5U U[zqO -ަ`u3@3p  Cj8yVkn=l{sU{ٍJ- ϩ_v.|Ժu<݃k4nr !K'^ Nh8I=$t{je2i 愆?qFﴴ?9 ՞~pIv6Fh" tGF*M lC,s}V@ _!Asvq?8U 6dդ5 56bS b!:,pQA 7;;d=t8tctNS3!1.ĥI &6dԇP 5~9–8ѶTw}.EDu HZ>GM%pseɺ;MM _y/= k0N'",\K9Q_V2 97a@e5V b݇9đQY$fL0\"oܤP Cde61gP6iEXGwR.X =j6qkf!_v"o?u&= ;~Xl6[=%0j&"=OPsQhJX,i)9+Z9 7 \yy'KZ_f;3L=k͑L 2mȤג S8'&w#g [ .*JIV8" ^ƨK!J 2B] IVgL_lO.+g 㑚g-Bid8T{s1G+7 <}5,ޭ IDAT js9GiN38xU$B*hYnV!pW\j3YS M -ZCbF6`\*(p[{S.tS9Oc2=$5IWᾤ|DF;Uej t{ZoAO{jz7>T5;֒8z,$At . .c^Y(ٴXsa(0%bNjYMȕh y[8icp| 64yk񶹓bģ͆F^cJ.RJ;MGq| 7$3[LuxJ-jyl,PQa[J*s?X6'r;2N[GJG)F pJMU(JOHj1FO1D#U=1 ƇAhT %iT$~W9~@8É,5xxK4XZ\;;R5WL&NIb5hR+=׶m%a=l77@!z C6?Gur1_6NZRqUsmmkظ5_s|%p~GXVy :1I1 ŵ 0"VQ_o4.!zg{m)a5債Fа}j-^6nm+o [Kا,ňowMǪ񜖾=pL+ǵ?R6SZrd6}j~hwGP+)U&;V7&}Ls&xd &;iKU\ ?5MD"A*n]E&HM;PQwꪉ>*N <✬RMoH<LaZ 57Uuh ݥJNЪj-9N$c2wP/O+snYOH0@w{%ZsY#:Yk=^;sL5hʹ `U_K$QPkubp,ɹqZȍ޹ '^L>[4pxgC5\؂yK I´w " ?W.JZSQר2q;<nlxlɂRԙT2lX8 b?a[g bF-I/tm r G5mǚ#5x=MVrF"$JPh8օr@R1S,{?a w|} ֓+t K{!B-wOg'$h1*C*qz1f" #jj Vն=8V$1^(;]rdu}5 %6CE#\# ɥM>o =ʱzX{( <ӹ Ԑu3KMdZ;zxWoOz ~_?^q~RϾ ޛƶEʈUBC!W3IH#$'u$62$ L:B&م6M 9Hꪮ:ݧ!A6 3EBI]WY>5kkȭ 8ɖQr.!Ďe?g/s]8`|ǀ%ڗU /tad JgfBApӸjC1^1j0ΰdsnƄ7Ыtw{d tUi=E㡯%9i2SY_auٷ8d C7FL oq=ɓu1< |W^YPeS]}5ug_b`PuaIu<.QU4y}qWTX]~xXiS R"yEzʏjڇ^@>WDOΤ"V(N¬U]W T.&aZs Ɉƺխhړ0鼼n}sž\R [$ehg=/NZJ{YD tlgp >Pd+vm sk a]兊EtܳĝHTU{6 וYܬd4Ai&^bX03SM>i̬f=wZYvZJQRcj* Wbx}U}m?ꪉ~.UٶNmX]3"͵jH%Q^yU5xy@cʦ/ڙhkl0) 1ksTNE}mX|)4KJ9]i8x#s{YR\fj#Pe t1u< {#v/ܰ-U1^RhS?9YFx|57~6<+@y /KZ)1zHJ VOhIJȨl#,?o,J 1bSyuJylfr9ĵwy@{o.0>nt:yplxmVv.Ԭ'B| sEw: Ң{m՗y50).VWLvtt`e*yS+|GFpXUs9c2/FiHLӷM½ΨTu %:]s arr7wvbd3UzI:?Yfа-1nt8 u@F!ǩ,FL%ۿ? }(n?]9ّ WF)=6wգ5!_7]lP(q Z3Ièku !,H+ J2, D'U-\<_=@a5Ҥ+1KZ1=nN+1gx(1 0˜fRCr|MP0RNvT2Zl&jP6ĥ2`I{QW#Yµ'^~t~ 9~M#`q("bؾ}}(ar /bdgwm hiMlC(!V똗l؅G|輼sZ8|H<@zByjDԂI7Eо)-SZO5@LZ ha1|l,2yՄ լT(^/r1wC~t8@I@&Θl.ii^}sMlvaGт\Y&t9Q = [{(]b';RU&T6QR6 _:=ù#)$7B"9XV]޻p+y !XZVFq/Z:*LɐG~lįof<2isR)խ_VUD9\]ZY#;XPF7"hP xn4~y%9YǦPgݖ#]v|h{G84גgJ'U-\П#>)ͅ&i/3 h}[v IӃ؅\D4~|8ICyF$ L366ꮄ/Z + +|[LM; ز?]S5A~^x#2[,>HO acjݗ۷ Wx_eSfjˌg\g,)vKʇ] Y#U-b(aJ M;añ- }_o킸q呶 ]_ AǕhy? gI OV@Ӣt ";jGatZȈL^}(ɘBsn8Ml(D3}mOCC$(RIvä=᳍K'{ck/:ļ\tl e]#ɫzӈ tռ7WYzuY "}ԆG'E]D_a0bJ G5f'%袃ݰxɼ3O)?^:q`47>ᮄyV:}H*Z&A~u^<.1'-.ɪDɼN}v{{hW(|v{4P@0<."%7eMbYnL0ed\iL{" [ ≳nI0/"LP?)B6 0\6RlY"s}VdMxA#yĎz.,`*.6T^50≳8>AݥUpLgM=Es.72A?)L #{;w > :Gؾ l \r9X}Q HNa6p )n뺎CWTnb K.UڕLhQ=x=W r[+p/ 1 /ϮQۤTyB'1׊o܏xIj^d(II$&q,[݊ov8ג~@?dGӿY3iGe@8[<׿ͣ`rD>b i=V|ӰNnd]|ŭ1%]xpY""C=+|&`Yh:W5Q T~~g=ۊູ$ZC) Ҟ|w6f i.B8s^f?upM<j  )? `4_y=jP+;U34=H`-&e93 ^׾ET'p*`ݕCZ_f-lN ><@hwujn!@/ B^µ?y*|{V`/PfW2rݱ ktESq>8rz}5J﷬s/V=YY YF̠[wV$4_:5 0ڂy5V\@'ƶujTOWwK*qӵz,iaR ;FMJ]E  p1>Z$aD;>Mu^Z]1/RY >T!DILR~x*rS} y ^zJZFWҰ,2`<98bh`3ac_r cYi'))| iԿ6w*vۏXB %7YYإ><~}ݓٜtpϏƀn&H 9)sG;*PZ|s! MHsK]MSOn Q 8rH,OvUn!5lkGXh1_q!/z>(Fsj.ͳH; ;yP2mǃ#SOW$R4bI=Ik.+b $mಙrTh\a`U?H%E>+.YG>׈Yv3.@ӯJTʌTya_y#,%J gdvQUf<ۙ8㑤3 r%)Jąɴxbmj[rehcős4ijw\Qx %J0B H_>;*ie~M^!ȦџT)%|[JiF-^akbbe~4l > A#{g<+=W{EE N!\9NԋQI hl[=3l&l?k)$'Rj a>_ŰCWM1>r}ح(m,I^FE`-P˦⑉K?g.ϯƨKQ#_Y<E_ L+9%`.#%  `,OT8Hp2ˀϬ2@Rz.έ8 :;!}я=^VeT\C,(6v7OwZZhkǃ;/3_$÷–b{XS _[W*Տ1`/ \N%sw|4>'C9Dܰjz:GW|A;mei3`cI: ^pO[c^bjpێsϵ#z`De\" 64wʣYM,g wdY(Oj|]c嫕!z\^Wsxǁy ( EyH;ъR'Ww R 8^'wj˚nl uUw'c=o%Z=>"{ ZM*E+?E-ގ\IvjL:`1x#)Pw!8d:hИnONүphi8 ;,PjP8˯&lp]dM%V=Ŀ<+& H >}=:H<w/x7B) I()B1 h猴7XOcDB@wukj4_Xo$~'|eJtfXtf՘;o#hFrQ N|ȩ*|ձ} YÀ zkM6b^B,o=cMp8@`hJLt kˢzCtFYلm"Xah5Vl?4ڂ߻W˕;'!ˢ1N/񊉱 [yE:̸*V YCѬ{X|Y9VWO} XUK5=@+!_CCwYn$а\p'9@x@.|n'k c[p {ƀє|#y%r:2iaI\ʕDD쯳3w޶w%:mNR1 Sc,`0@ 9V}yj Ց [PC BVYg'e}욜 ֵۯ& `ϾdNy{m;ܤK+b46(UgJ<{4|A"^`(.6Jc =;ymP]cn#kgĶA.9B8pc[`/X%ˆy_ӛ]jF=`K~jsLFǔ kb+g{ R Zyk]hCa;jԍJ,ДP(q.j i%`KNvұ ws r D?dc[(1韆Ay!{O xќYoV e2>r} p ,{Z j )! 3g8ÛcӰaZ|Y9ň~9$*@ԇe9S)ʼshH}uwHLiw}-bڒG;S>?9#a̴hk#/= r,h,ƅSN(.1YGoYw?N k(jiӾ{3wXZJ $ \#hg}3[PJg"RaBh"?dR9k{ΖH4JHLQ}&ll:}>Rd@j!Կ"J ,.z7?;8b/ '6HYdXme9ӹԔ:Yv㯯188 O8U71,"F gþ H7砆D+ZNf-[syǷߚg‰sp}kqd4Ѝ9hIhp:6ٹTKL!> v#y:7wKOE'\iD煾1LS8l~ظtaT[cDW H={N Su@(k*WЪdc<Ȉ&:oQ`471!p b9kw&YP%>ƖRLi1pl}k>]'_ԩS%%.!^  %j6䏰ӛ.TǙ%:;BE-Ncd|ص !&j˒_7%$H,%}(٠_fnX^e"b7g/;/@)s[2XH3R 3ݜɍOа=OZX᧗> 2Y^轈}V,"SojH` 9q8|}o&9SI)t)D:_Uc,ֆH L8) c9 lb( M*֗5(fQ瘩igq*^*1sI2jI"-5N! XNqQX;ya3c#a(f+ mf֋B؁ԛN-:)fId*2`/bH1ޣI t7O8;a=^hڙS(`'@ H` Dȵ/j ޿ڪ=+XJ=-LDjbD^)-LđRS֪E@~($5JưԳ(WI1ıp,f"CJ_M؁TȯbF9 ȇ ǾR4\"#ZFW[Ԉ8W BD!1H)ǜgW] !1a -~:RJj-T\P+~mQcYf7U5D#bPR儅$W츰K'a&B8XsԉI8& d][i㤮dC&^6 ϛY(Zm1RTPJ4YvKgQJqԀ-c^<RP m E,?h*_A r9+hQ+8 u%h$) 1Uuu<bi:Ri{?)}G]}dK_ŏaWIbX\id;_a'C)z7\B}Rעv1jg]\ .Y.s?>^*AtIENDB`bumprace-1.5.4/data/gfx/racerd4.gif0000644000175000017500000000037411217461066013760 00000000000000GIF89aZZZ QQQ RRRttttvvv000!Made with GIMP,o dihlp,tmA |\n@$$% h`` EкbR(xm皦оm. Q~t iz24557*!;bumprace-1.5.4/data/gfx/selectp1.jpg0000644000175000017500000003020011217461066014156 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222X"O !1AQ"aq2#BR6CSVb$%34FTruet1!1AQqa"2RB ?D@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDD@DDCmªq\̖WPڙ:ZE[Z/tUNUb5%9+H+(&".=NjuqM\|nǢeɻ}k+QK'ZJ/UH [EB= 6{H^HsokWq qr&R,\;mx3t1Y柤T3s8XdGFS= FKY# 3wsUj0j;GXԯF;WIPj˝vsqQTmxB+)zH83AGS'ngor Y9eJlo+#L<ʹIByHv}E/#d6^lX _5<m#QZ y2 E,bjtf(ȧi w%e[@h5d.\ rnIeJ"=9ɔEu9,Z5l*p]#$%e_4ϕl+n]/4j0gD=3 OE$x9ćZ)*(X؛ꢫj8#[am¹JSK ؛>&~3 0\e_Zi @{Ueppm&N4u/i32)`-b)(kk$\-3_Q+u=Fg⬓X/pSZfGR>SK^f_nc_ ǵa3~!MWIEReFtlzGxxF}M; YhhQa}^36XR0  $GQI3s e]7fկ\Q*Rxo:ӚOɳÇep*,~ŏS".ܮ8鵼TM3L3Doۡ_ e @{!6]VG v3QT湧V \怶 ˅>)idkuՄJX)a?IM5 Cdw{grn~Ճ_kkj89'Tfu;;F=_w(\jj* O}sulb)rm*I ry/ ]QfkkZI-z-\^y(s:v0ܑR@t_ZTx~+wapU=% `5Ό"W%KJJv,<4jd#%xt#sU,0ƙ$VsEYNqeظp >J>G͉'Kz,ZZ[VN^G$hfk_K9iSq[U@I%gkq^#3mG/,fsIAZlFsq,%6p  TncZVH -0~vJ ٜï;k-#0sERk=eAذd{'R0pɛEdUcmmks.^Y\nK+pWR$uIW {)_eŻ"\nj⊹YGP69y^TuӢ}ѶpVmj><ѫ7YsNp{F " o~d+M<=1TawosK;40hjhCe-.~۾UqZm.ΌݪpCnY;Lj1[E-k]q)]Rݞfrt LtOkz>x^)ɖQ^D""" """ """ ""|b CncIԌ[^:'ѿ(~oQZ$ߊ+,/"ʗ_~ #t5QшjJE1QoTb#3|yt3<}wR[S'W7Mho{Q~7y{tqĔy?foRv⹺Q>3̩<h@׋$ߊDxGKkFcm.bjs_E^1m3PSN&Yd3Ĺt[EP/'iZ2̂/yhJ+J[ƈǯ4µu*>&O<665ò C찹Ee}Syo G_X1YY(a!C,7Z%rjKR}BAP`BB h#o߲o囿eĬ^wj|_~ %/EvJ7={CFcr |>Y\8̝ղ/xtu"mu_!>(gSѱ^ϴFP4]^~3p *E N7^^u)MOw广+QmG)98 /}+;<#OU#I/$O4̐h<:*|*q͖ K lSc6W:<|s3sKQ=60\%{[iq3'eˏ-: 59/tY퍯/twz<R72|mo%ή6681vywxk4V[K#L /L me=N0pIy?lkipN lߗ-1^^_cӪ&~LNUGjIm(OT]ldPvy.rnEU\j#|$?/tqOltƞ6;*O`?׸f;+˯F׍?{O6#oj\R/g^_ wTGb%IQqK!Fa HԏR~d4(6དྷ1Rr~8"" """ "*#[@R%ZF$wW ֜aJXKk\Z,s_+ZI+?^o?\,h䙁2l],ɑI x-"3ZFf܂|J/US,~NdeLC(5Z3ߢ@^q+ӅYѳ~1/ d6ؤOEȖ׌H6ǝ(oZ ]~ܑ| tY-dgC`7"[^2c"dQ n ưtEK{Cu,#+Q'063nA7TTNU tB|&vr2K܈5ŘGuv^cZhW Ha h~ hL2e:iKHi#\@QwQvE<Ɖ;"5xN;c"Yc,Y!B3< .VSp\6wFVF<˪VҼRPBѠwb3ap MHr*e!^vFʞоm䤢rQ6`"=9+:C, UɆB̓ܢ{Ytt8)L(D `EB35@S48KgNnT`)vlHcr[0J)c^fu=sUL k`8̓OWyn ,FҳWX3c 8|v_&jhj<.fpk^˯4˕ 9׷?Zn{~Q۵L :I_^Msƀ g)7hՓRI$j~QI;6s\O2h3#b. zRTSó<@((tW#;4o-;\m0~v(.=8,$btcE!<6}=X\̦5w*8M2=Fٖ0g;6| QYXlG;Vhi5SW9xr.KX"sH#l5dwd}/#mt dOcA.9M.5NXm q>E194z-{ܮ>ׇ 䐋]B:T[ rtUBmEJ=ыMp j)*%u<]εڗjx$y'`TJC+\XFQb,X4y1]2UFjYRBZ "t u+?CD {ߵTq<0↖4&Xc;iK&bwHhQDo9[/%>E2甛N5sj-3 s_ 7k!L`Zyz7sKk2hp(bZfciu2$ IFm|6#TaF i \n5>8HhX9ke_*z^DmQ^DE""a0>f"KXnVI+豇T:6L#Q_عԩi.x|Si\+I%~=^,:JmIgg_7V=dl5zՊ߹ [2b4t~bָ4:Hq,PV s9Ϝ玲6R&,X@oc;s6oQk 4UWKN"7(ms+/zgAnן_xu<J)39͑4{]ܨV`xbM4\͗$Z}dy]Caa%5pp79c]Eq{F躇P&K:\ln6\èȞ8ͺ}axDU%+ |vzT5v'CVjo sOCFDžԽ6pm[@> xꤤ{ oNK㧨љܷR(:f7C첲6FY_Ogɣ""j%pJvMJձG8}T㝂Sb/khh.=9F>e^s}%U:-YFem͘F\5-{B̦T`]Tt>guۥUO^e&33 ktz:y 5{}T Y-y<oöbg{9U~ϊ=)U~d?LcƧEj yM`z0y0x@IɼuMák9;n_ϩ>lٗnF~>EUs|WિZnkLү~ GkESaֹޅ KDk%dNtDȕse4I…_7aQwUi3 EWAGf\,6ϊqhA 4nW^A~m֓_ey{ C{\t[  , ks@R1csxMDr~N^-iO;cuB.׺rmze ~Z9–~e4-4=lXrFY7gg05شi8w^9Ē\똾+ҁMD[;`s;_ݿ{xImfմcE]\,/4GRrIe_8j6< T{%4'Q. ot-h0 U(iT)TxV|Ι6#H*6sƴ\fJIqI]E#\ s77QFRM6ْ5(-ͣq\qYoobx@C|D*>atًrߵp&4i5FBy_ѿfs݌ ;f# Fۅ%Tլ}ωޕq!!ODZ;,}nJלK7@ۅ-7gŒVɮm%IteNPLw꫸.I kƹWd /Vd7M&׹x6PG5at4S0v wR)Aح]m ;ʴOŶuxmu^^Y[;[$i1ʺce;h9/T /T˲+;9g9͟9"ac&{.ËA aߒa󼍄AlSҴtqԤkjuOz$+EFfw`ɃFE\?dTQ 7'xp""" """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ ""bumprace-1.5.4/data/gfx/cannon4.jpg0000644000175000017500000000237111217461066014006 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c$uT 9',VCVx!3&KNx9;V ymmx6\RsfRّIx$>ПRH#֯㑴6KL 35 H!b9$S^ㆫͭ$lv^IJI)G<񜹭 aey_SFouwa-e~G;Ž溟ց Mq|SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULlaNC= $=qoHiYF('vBmka[Q}k)s5hTS͊{.z<[_j 4fKs։jwvR}5ʞGP˸ FJB> : B$N4NVbf fb Z N J BJ,VD" B<*2 j r~vf V F FR$V8N,2  "2B Rjz$&'"r^ R JV:"24. F b v$,44bZVZJ > ,<<4~njV:  &B ,DLD$$zj bR"^~LDzZ*Rr, ,,fJNLn$F2D~!Z>N,&&^r$6 6 v$:4 "2b>  ".nfB.* F>$ZT& *.$ OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO!Made with GIMP,((H*\ȰÇ#J@Q@ƅ;(($p%ɒ["H` l:@>iB a .``PÆ~:` <| "$f(RP*Vh2fF-ڸC:v A !B#G$@a%K4qJ)SzPbʕ!XbD˖ 0bƌ!#&2fΜAH5 lp X`37o@#9UyA' (s~q jXؠA!HIEP",xqt h p"~%xP(1 !F{T'{D"(*R Et`D)$~)lJ*7D$@ XJ#P$fFF%4I)DD+ۍmiy 4sm 0rIAVV+!;bumprace-1.5.4/data/gfx/racerd16.gif0000644000175000017500000000037711217461066014046 00000000000000GIF89a k mmmRRR^^^QQQ|||;;;!Made with GIMP,r dihlp,t) |@ (dtz`6YD(uj5-: !!:E l>&rG 9"k 5y  !;bumprace-1.5.4/data/gfx/racere8.gif0000644000175000017500000000116111217461066013760 00000000000000GIF89a,:45]=7@f&&&RRReeePPPQ***hhhqqqFFF999""")VVVWWWBBB000ZZZ___^^^[[[MMM>>> $$$\\\aaadddcccKKK(((bbbjjjgggYYY<<<---@@@NNNiiipppSSS+++TTTwwwnnnIIIooofffUUU///111XXXkkk===???333,,,QQQOOODDDEEE:::!Made with GIMP,Ā  !"#$%&'()*+,-./012345-676!89:;<=>?@2ABCD&E4FG+HIJ!,a6O0@U$A DT\壠*H0 ^pb͛8s ;bumprace-1.5.4/data/gfx/title.gif0000644000175000017500000010700611217461066013555 00000000000000GIF89a ,\[w.521B,,CD(^4H@W?F,7c(_Gb+,IHbe($(vt$c6T$$USpT'?Uf&4<;P!hHa~V2D?>%$! *,T.*BNNjpNj8:X&4 2 K_u/<9@FT$(~(8N\i=QUcӬŊ[<մH);g~H*ok?yE_p)W qNܤFrCאuYE;Cѳ IӟG?v^eo{5pk[Vә1 J bPAt~$L\rÌD MQ/%%&_''%DJS˯v;5ư{)"H6:REB8e <ґB,bw $#D'6 d\'@e1NQ5()Әu=WB-%Q!El>WHB c0z_)p?jRe9CTCrw &o LFH`UDK}S̉ )3VL@Q (!zI6⁒cB<49XtՀ1/fy)Bp-\mb ).I_ёXd;1H8Vo~/ ,p;T#bZ؜{M@Sē.bU\/X3ˋ #6ي?ƆtØ.Jp8eEZɊ"$\OtUSuA,2'#vk:ERRHU륪O Lzoucf~V ԩM$/1RxIea Y -ӧ-3WE,iGr'0t]jWla㕘Q,6hqS#'9;Jy|1-F踜0 ? Fţn5k8 AaV3ybpB DߒEVhz|#[w<{F+-JM~ԁ٨VJCr';lRC$qiٜ1zQL/84-*3Z'̾ፙ@)Ju~#àc-H>XMI7(-\D C}u?.Y]IQS;ͪyi~U>Д^|۾-6ŋtR\Z4ɇ^rDv:#ݺL̼擵]_Py;\ qBdI0k3AbWwgY{E]K}JZ諕vr3EXBo߼y@'Zv~e_t?ju~5# *"-=Gj!G F)2v(J$w=201ԕ]FX$7/0 tFzd~C.0$,;U2AJT7wsBy54mZ=vt3s|#BPD^rVYVG5L! J{h| eB|3, /LÈ1(3牆rrYfX:mKX~džU_;ے@9͖bJ0ug "H0yt.NQBR{$pNh}mF$r.rW%eDA@( wW%XjBd *u="+3gCOH48;,wgkwTE82UUlx~-0c}q^2fy+7WM4_5VF7.B?(6Y[11zvFsE~2bazc,T0LwW)n$j$G$c(8+"!UU+ىai(I 3'%!hqJOݢ,ZDuh?f52j0P2`CqSB[ۣ W"W fD*m8FrE~EȈz_7Bc 6y.;84E'L)DC(k"yU9tqiuŠZ%zxY#qksi5F7:&觜 $3|!7mȇ@0y$ I/f~ SIJS vhkg@:盚WovCh|3O0QucRst#(җ>03]yT}vعXIr\u1"#^$# AZU6R|0ԘyG,sÇ:9A.uDkhZ%ttip(ږmXl^&[J8i'܈y9G"}:g&7VVbE_h&mXD'F' kqgyS$ms٢%Y. );4c %\6ǥ:SPRic6A$z`.h HbM# njkA!C0_>0ufmU MGRI: #ؘR@ y.7Uc3;3u'+Xo;yg$qU#YVG1|9*7/xafyfXlhf+Ief䙖mӲJ =Yu"c'PpRt!GgdVFO+q<ڢeZ#i])kWG'y'8zEhl6a*^d]$">EZ:/ Q_H*jk"*캦s(JAtB(:Y J4tufb1i$LDRM2jS|ؒ=3; T&7tfZj;g0 +O0Rqk]7U;7g,cV32:.724gy 34B=87‡ 袷K$ !uF< l*q$9'B#•fhT=cB #%Wa-V8K(ʛKV_yb=G9Q7;vCF[,r{2<b|ˊBQS~&~r#G)%{e{45#04[%#+:PD%9:a;i*?(*|:i<ē<#Dasdc%4q(əvlCsiB|.pId+<$f"JJUDUF~TFc3&4z[M{\0՛OsF#*Bn'[2]\.VsvstK"φd$>b|:tE!%bڊ]yELuCd*'i8[Rgiʄz䴐L6,`&d"k4o),ӠDeXʋRmV׶@4X|,jw]8y47M8rSR0U'jGͺ}R5w'2AbK,A тH45,C%D{7tݕ<ȪAbE\1I1V\2*<8{MHסC`#4{ҷ|WQ&cJ tT|Ųb i V+thE6ӨA@O"2]j$rw6'~Di0'\s4P`-vnLBw=B,7}DE\#9كH:J"9t2İ}ڶf|,-:NHh)& 4<"cwڦ=KP~=<-J LN<уKȐ]x%)SL4c''Ȝ9"%*Q)MN )K,3"lذg"BHvZk%ͅ 9=IWW|bV#NAJ*֬[]b yRtknfI[e,UhҥMFZ[ Y:US A#;⚅L@ հS֭P*hRyBJQ.%dL%F`GY<{D'\Gj)~q!+$9mv>.)=A08# co?\jI%V;@пBʐD卵*L5@cнlj9kn4J |H)|8+t7\~CZ7vLiK(U":!S*J%Ī=҇Lc-Zʯ@ -Ų,):ʔî4 3: 7ME#3VYgLkR=c7_y#N'*#j{I[N;M-Cȳ6[IIN*Q+K#ĒG=RG3 0\y NB+PMJSȢ1UhZ{՛ Qx`G|c% .^r vJ>FK"i  Ls9 I'L"S6ل–k*6YʕOzZ GZ\{R$"eDElfڪs׿S4@ST^EU(B # ݞ㥺F,:׈T$[ϖj!3jNbAn.j&PST$-A plJbZy̟,-i{QK>$µhiKj٬v5 e)Tr39h"f6zeu^ NN粺./AԸiFU<[Z brԸ70s fP:m@3)E6:p$$uUgI*SզR@HD}{ݔKEQ&'lb98ǺdYe( j,'PgN@9[LC~A)I1 7 S?XA7r4zT "h'OeDv FS`0a)#VH*LgdH~8S_aj6ʞ'h Kń9\nj+&i88 eV݅k̋Uׅ8AA8ď $YHF:3&)Iծw+^*WK5= mBy$K*x ;rWmEۙ,wٓ> /m-_u5Xy",# 8AuõaD+UmfVHiL@pMHĿy"J& DυNzD#*J4ɠ AFi>45JN e!>Q}MoKϔ4Gg0tR  jtz ɉ~22š41Iv:p qUeUWDpf AN$"'DkUeVH*tk,I(ߵSց쀾FHljWAE I8A:CL}')$\-J.EPOcף"[ B둪"pAuX\3^[1 42;8Ѓd-ADKRC.;;v2בDxxFSYbE_F ա/)NӴETⓑ&.\ROp17Mݵ)D1up;N=)A%4W\$L} ;]Ars7l 5q.vfRܪ34KͻwmB~f[W 0k4A5.`@8Qǥ' H6 V!Z\C]p Mæ6p}(A gMr KK]),=t5{4Vy/,Jr$oީQ .D(&>Z;SeR|NX/pe,GH2cdlƛ!GdW/#?L 2 8R k9Թs|@l9-@ 9Y$P$s>9'cK-FېɳX% W"ԺɖYiA k HۭNm5x&̴;ޚkBj)5ϓ a.vi50=C . =Ó%!=94᏶" M䰽f'H9镵ٰ  ׀> 4$M诖 uA{ 6=q> A9!Ȍ4 f Fhh??Sno,C) @0O Ё @ G@z@ 9 @2+1 kIw1i;7=h=yҺ,>3=-Y)9:7A91cA 1474jBI)'P J9s9H 8*4Z|ɗv;1,s D#K+ ,ixÚ@si3:D8P ;7J+049>߉) pZKI"Ѿ&ZLLLF`LL$M Eb[ -*FffFSi쿄?8 /qD"@+ h9 Λ7O4OPGqSւ\tH0ŠA=<)x l^Z8X{–t;5Y,MB-cx3 5S'4@'SxTM`0IZ+9<$*Pɧ04eja >yʚj+ IL T"k&/r5RY V?7, PH3S3@1`Bej2's(c)i+A0KSFm|nm΍8@;G @s5JS0L :D }Q?>+ %0<6;ZEIK\00d:. ;Y1] I(=)s W]H+eS E 2N U\ 3\ bi[iM,UoN[UUNW ܔ+XqU/bc˭\/\b\-ՌM:sڠOM u H>:]ja fҦ0%Y }`R^ 9|B09-'!26RX$ e]e 0IB.pX}eP1fU߀GRrAIX J'2'XPWN(elV.JUD{ikZV7I Z륧߭~!* TsfRزq YH,}(:9 ,tM_P\ ۴M5HR- ޲ӨqŊuNFcNf.iaŇSޢU SFۊnT5G h+ 0noOo~iXOc1,a 9 l i0#U?~1줖+,т` `J&e-'pdIc#`80 DT/=heUtZ57AC\ƈ0&f* K-!JYoa(,v EP?qSMґN?P,IB5 )OeFsD:ߙpR 9m'< mՓvVcoOTOu9 ؠn?monjWuvgv Pa> 8\~b\?]۾MoXoѝsh7)i8i|ll/ooר1rEz`qcjsCfP#zo-#8I!'Q|2~w*Z<#2勦Kh"D%`S'}qѤ/>}7b7%LBPJ nЛuTQu Eg8lhT_HIjzR:KAU{BTgӤ64uU@(5KvAeӂ fWQk x-^%DF9dg9;hAkiJY;IvnZm5.jX9n tL+LqW{YW82|3AE{NF|gq)<ۅ8ŧ1U.HI7RD)f\a&J*܇fS$HCNp&M7҈<: Sy$R z`I?uKmL0NjZ r5FQ:D kP`)FRI%*?DIvۭ1wOw=bu)PиQnѶ)o>;]FuSJFa,.nQ֙fƓV_>(OnN?>YK,揯~+/ EGΝL2A5&g )ऀJu=¤!`G]ayD ]<dUEr;S P[`JLH14FT"U+1mpih VdA4:v"882 ЈHV]`󑪨pidAjj,byH#THҡ<$$R }sg>>|O4= Pگt|md]/͒uC BEЃ|H_AAO9s1(r,ntL@*DjBgF %z򘑌8# @XzHU;+*H( x-i@YxB!1&/Z#R3hH[?I hS.i)H^MS@KSr=)ސ|_mVn @/K^JQ`-w0 9 s$Jq&[R5dеOO# u{og}Yžo_7J0Nj6Nm v"W )ԕ[YM3~F&&XD={)#M`rHHS+=B\J BLfhfB+V+5lmE|10%HUulr=pE`IXȖsMTT2׃(lbCIF5I@i&du]Pڗ4e_S1oUfnuS-`2;zG0 ְi)C;ox7NI͐wbwH\:0%C~/I_pנ=n~7+8mӣJάY3W{_L¾Kfs~MAtpN#2>OMTE24!4M uPpوDEpKȼŀRjX"'xK5GOh?`%0fpk,Y7;"AeHcQdm7(_nZJ4o~wK˯,6m{9:jvǛl>My}^0C>M>_|֗}˧oA=(|=:w~#dN;3E@4 Z ^LkO\[ `(X9̝Iȴ Yl}8h>ؑATe]F Hh pХEY>ϝe phX<YQIkS" ؤ`,%$,ugE f) jMBiZ u;|I(NJ`:qNm-l@^,!B+x!bx!+b!zA9 'EF텮T Fàמ^!Dy'>#h+W||1_=A=WBA{A@ L_CAr%.X:^)`gQ .IG 6^ N)~%LU}#DH`ܓ܄TV Q\IٜѼp UHȘqi.t]4YUxZDٔ UaOU'=*,XV|ѡN*!2"tH*FHU|R MWx|sxyQElB[ z 6!%Y"bXY6"eY΂X"1,#F_]dd" Ͱ)ٞ:a(Y d/"0J@ Xd+lfg"xfi.BT4&jNC&kfflf-&-fc(6fRU@Xėm]5S||H߸2 P~DNXȣ=E2QɐUO Bͅ @pHF`U`HQ.E\ ;$Zšݠҙ U[ֱihT09I!(ڢI(KSia X+p%TI^ D"Z%!2"#Ye"Dqq} ^&.%fc+4=(~ͩV*A-dCA8&& j):mJ*-ifƁ&[ cI&1~ TMxl}Cx@OLwX}_} n@ƙF$P-܂la؁ V|u aDkټ;`P(9g] Min@>̝Eaq %0>W&]L֎?JC b W F)>o<]\ %z\a#2m"""{`"VTw%/&(*fi%adH2ٞ-"5(i8*-mqmrjO s.5XCtI h6 3hQ 2A CDq熇 ɛgVDHT2+_D( E2 X9vE͋_9PB\˼̄OlGQr6@ 6/&vH0\VH1Ao֡OR,6/:B ~l0$ƬS@fcq ?,[Bfx+"fjCl L54NW,t%؂-OuP|_ӧJF)i~mb"1w?C7(5/j53umu8-^-jZZV*-a ob/6A @U=$"Cn[@mRC =Qgp6BQb(.73d%CBBI-(4Pgǽ.A5ё B,:7:A~[1gl_' ^N [NGXb.6! @3T&5,,‹ 8縎 u-]J^r*Sg)LO@V=p57uXA/!|/ C4@yWNx9x% (O[׹jqq3jum`a3B 7ziTH~Lr9sVnGhPbIH16J}PP2xNjB (ay' w`$:37WHp I)\A NF9nSE*pPڠ5Ip o9{Ǖ7=3>xū nHQYi<@8\ώl$fmu8Dg]t~8PP'C68˸ǸOxu pR 0r%S2YXk" <PA/3N8˫ɫ/!׌ $,jg}95\mq⭦ҦlN&گ=aljQ؍I2e'6hcBV@&`dM}v;A_IC5 $>9%|x~`rT9'&=<+Ta9@xp„<4rv3CRqɚWgԪR%ʒ%4 &Ŋ'< I$ƭN]viF+[MWp A`aǏ+,rǢEG0g>sgϟAQv@K]FRJPdЭ;nb r]RB!?CaN=hДz3)HL%8ˇkyы3.O# AqB'GN@K0 XAbXb )܀B 9P3zyJNU@ Dt),H:3^@1G P% 0I&љirh0s!E2(AA i$h}%Jך' ӂV5$ZJzj f֖e$V[m 1H USAð8!8h8us1!l$; 4LA+ŴN5\bPHgt8BkY3.`T8XnnD~Eo=CÔܛ f-8%=g aC먓t(QB 7ؚD4zdQCAGy:N<1EAt#*.g%? a,#PrI'_2 uaWX/X ]tV$`EIK.#o׿(#i6(A8du.}`<4e{yٔ]JS $IA3a87KRÅ(!КB302`f+Ji\wE`@W؉ 䓂 kU ҆8׏ $K$tk#@»x.2TI-֒xU@8*8d ž/~ 1[ $2e$s8#4$5IƄ(F % nA8dc)Ύfҹ&);¨C':I ҄j-+$Ԓ"B@9$,kʩڃ -{Z4"9 pq(jЋ7+QHL 8B{tTIwZR VɊ0Ms:ƤAl;$;8A! LZ45cX<^ "{D@ a0b[U/#s}"b}(>2b*SJ_duw4խImCٓd&Ftrbf,IQcٖ6#D r # aGRkl3lvB$_r-GF7\@tDu$m{$+G`#TւHI(xD@sntmd- Ҁt$ z&L,gIL.CdOY>&R*HaJz xnTRf +C}&" `" ` ɰ.D0J:hɞ@vzb(XX5Exn 삾'.T>(|!j Dg̊ J Az` zJq RXYw`w ޡZ[FoL;vcd`!L6Fc$nB'vO5Zh8=0iC`o8 :->6k4=8ɓ&$&9FiHfDL$Dc TDEq`*J`yMC(0#)II-HZa ^$Q @%_p ^ʊt ) @g@pEitÒBXCfJ6:Լ#q$X:T 搩R=pMdF:V+?i$zm,82 !jĘ8RjA*D\)mC 2n˺XD AtF! pnl5G22#(DrJr$#!BfA%Q P2FfrxIgI ! 8 'd( ŔPVg<ep#΁6A TH9*"H&a WL+Ȋ ꒬ !r&\fi$/cz|iނ(N\P~`R`H`:a0@C%QCU,)B2b 8V5;#6c389Ջ|, Ӏ5 XusX3{Q ()Y'"D@<  FX 4uīDCc|c>ƣJr?OBomkf $@iEDMCEB&n ckȒ΋!#IrBR$d4gcs!k("ĄAAzl4I' @$u6hCi"uTHlH R *OnVr* pNEQN#6`-, `\Q\It ` @}pO\fHfXo3QyGS(Q)]Nfh99XCU. TvU,Uj-^jUjlUWWWkS675%S93tU7t5z%3 k{W@RobA} [}d@@ @ ` d'Biᑸq6<` [=1>ђi??@ |FqA`bm@Ems͍bƏqB @c5Fhe3=#Orl76EcFOs \'@AivܡZ}y\rG6AAuŠ$ITV3/+%#`Zc $}N,!W}(#wk"B ASS v4T!r/K@d7HXcWC(t}jX38hUWUUe4;&O"x@W?CbbX x7ys95y37;1Xx8QZ]Cfq%  (``4@ ``\!'ftm)Z+F 6lƒc=c+?؇>M 3qqMB̡mڦfBr$qx ܲ 6wzX8&??I$ t$Efk8DtlU"bL4Rxl4 L||pWMLOG DC9Jn"QtJI)BVA25$!A|m.9@d~U78G͔ŧ@7HX.d7sc w%qwWs375wY:a Z!``y~u0vCmjm)%aiFC=Ip(Ɂkj#8;0 lB=-VG2VB36wsXmY9\馏]=`Iz#+OmI%K$v䫗{WRGl䜀ZFXpW6RgJRf6V bn=ɭ5V#^ de4x QԔAC~JtltsPglwc r5Ewy7bw9W78b fm۶`@M[6<rA,B8 a`\byCnE`pKQZ&f{߃df` 1x.Ɔ3m#cE$@n\jmdA @@ '7<;!$8hZI8:HhU{{WӈAfa/=σdy`یhǿDj:IKSZ! knٚqɣZ¯KP^xqdxϺ's+[UYP|1[C-`"`:#mVkį^>ݠ : h1: \ [B DG, ٳ !FCFu<8dG = ni^g [DxDszDNAD e [ $X?@ً}é9%鉿&+PA߃zC 84` Oa\sHLQ:WTN^|ӇzBzJ4ydJ/`%̗\T(%NxM=a-zz@u4@6RK2ky'}.49oyμ5:trqTS̛>5֮,=zy %e& Lu| B.XJ>`JԞpqa{hŗ]%_*.@d%b'CgLbi>EV.\js[49TaEDpFfYEP@ mqr'.ZJV@ Y;)A-4С}>{3ȥŅwJ:4TM4OEtSPd*RE\rOV9Wb}EXekUVYt9fzXR!%c%i]SZf =643#R4'kRRxG8o; $AQ:}LŽ=^Q#F&`F6usIvFG34Sn֠(5JD18m]KPQUE@#+4kjmqHGE #RXPdio" 'J7Hg$Z!dRL-%sd2հ JKuaIK~o'Sp ut.\ʍ0ox7NI.! Q"+܊5Ke1.^4JQ9 ե-3LU1K^IB  +Pp эsCt`ANS7>︣5yOpB%A\A>.7<ťC8a)&SwB[Abqp zbRaъaXeDCو"9%nq1T3x솷<6]jDHc1 Y_:hOz&7GJN&(sG3 FΧu96+Dw]$=k9~ SHxU#:hhжa-hIcZҜδ5 Kzh9 [Td#Q[7-0))A20EU[tNI sE:^OțNYrLthv[NIz1r z[`,D2d A> <0kXBСu5C;1Fb*jܩ+XiLW"1t$L$85jL@ ݤ,Dh\026I`7'#x$$tsttflܠgLvN j4P&*gx};jQkӌwdՆ(#a':ɸ.9#\h M34jp . F㦫z# >ODŽF̣O SB2ȠǸ~033:لq&\.b`ix0j,)-"'wr3)aӢ62OfRd?/w1v17s ..`@@&$)u)y@w&0LZf)4xv Bu vk7 jsFFrxO hU/ :AJg 7vvSY3 SWAQM` ?3'xeXxxiWx׆&yn`D 9syFd6uS\6%a#_"9ju2GoPP @h 2O'Q*$_5_}0|`bf1W 2<􁦠 o xe6H~FGp~ '!!tH4BIu+/Ruxt[^B8ux3voghxV Sgy2l(drHjhRxep3lא H,QI=(YW&WdJ8v#s0 Q4(6*[hQEphh7憐irhxmx׳ijikR9X~G¶ous8zka]`Uik\7C@$mQmqmQD|c|ZQb_!,O1yR (1g/y~oa4%3QSQ Hf>PWbl+uPs&ipkfR%u2v63n'd%p7t/vxF$j&02IR2 ig28&v284(u'G} %3lg RX);E!8w2daPtex0:ɓ<k؆'hwFPeVxc1dkW94zhzg 8G@Ƙo7WF^ȱPA*!$|6<It"0MEv}Y!~o4BS GoRC4nYd[m:Fe-= $b7dؘ)Sy-u&d(?y 'wosv3kQ3Csyz +sz:깎 7ȩhaMR!D$BPjʬ8Ixf699x: y:xIiyǏy[c籄8keh8h(>z9D. ԉ‘&!m{s1!AMA`QU~&`ݤ b1^26 "3h]Zk0 $a$цYmG՗K3b[ao tџ!9\͍Y zpևa*=G.z "$"+[ AXU`:kD "dM>O[ ~1 =`&]e—da}jz=]3 9\&:<2 ~+fXĹ4L?ǯN#Mn闾=9 ~ n'*jEU R@c-v, z9Bj bUK4J«E>SiDoy|Qߤ9ϖ*u0[ S<)ʈQ_,;R~!M8难#-Gʺ( s#bRJ)QNDeb!+Krs̈͡˓^ d&y\{n o'Y%@锾 9zn-Ǵ9Cز,JʰE023OUoWY?N^ >Thq7f542'\TC0J^#I1l)i J*Ac:PXw( L\j*B5eIH6 굏/*9x~N9+uD ګ2fՇ0ةxp1 {~&H؉Yթ**̥#-%!B W/ D!f{+(Av! z\ X`)!R$mR𑒇$NX4n` iC~Y2H)UdeAͤYs&/bN>p`:TP%IzULWFj>0%7 *D,٥J#@DeeWJRƋc{2Ƌ9={lR"0ZЌR)y}M괱H7eʍ g&잰i޽7 ɕ?83b֫Wc@gٵK>{nŃWڵ֬oN/; !hW6{۵m/ݴ*+1֛-A} S&*"[/h3D8=C+ 0e!k -ēF38C! RȨ.ELѶTl=Tj,zˠD! #r讉 +L fM6#`M8$NZ$s$:s$9" B BB-!J+*+t *.TB #"4v:TS L3 ԷbJW]e tVPlWSB*ǔH+mZhA4,5@u[|N\ʵqB%ӕ,^-k,\$uގ8nWC =b}uB sn:O(s N)M1SH";vZYJiųG2l^zл!lehmOO|gyˆʶ3֎_ ~;^3[ip d7t+M+KbqI]׊T*;GVs'PO]Kψ0`cOR*3KiU4YT+_메# ubnDګ?i7IA8)qN<].2*REJQ8kgsffZd9{2J5(;pA)5L< BLqrAhQp|_Gӊ2L BX^ ŰfTNYB)87*Wr6&1l5vJcH`v7MR(e;qrʔBglŒK`35tQGؑ5N }@Ô͐FZyTGh(R;q&=đH=zPx9/qU@!0 BQr7\|OjTW<͗dXLc~2| ܷ"9GP*G&$! 3UY\VHB3x]LƊjEe+ Dlg=Y+P# m6AMԦVjFϊ7\91sa/Y!N5P򒝅lzIf= %L&zm^]]]L45:W6 4q7*15\cul$զS*XX޵Jݫy7V\)a)Zyl">i+z #&f*+$GddSܳu0d3أecsaw aeDNKOQJUjy_JMz9ZVuWT8S]]3|~WX %'l1d+A0kr&r .@<߬*$hɿ} oɱxSmNJ `GZ7L+7 jֱ5):۹z/ߣZ&z ms׽rr=a+v_'Up=aֺ#щV sԦNCf_ K#+Ҹ˺j5ڢ@S2г 0="13,`6S@6x)$i6`>D,&y3tAP[<.N#?_z9" $jB7K¥R^ 5,q"(,h2ơ7 ʴ|ڴyѫR|S)-[s<892@ɳb>J@Oj>r=8,pӎCJs:߳ot5IH_狾s3X#Ib&z-h:b̠O\H5 >B{󻄜EDF0@94H7"G"[5$: x1Ț9 5FF vB:zHC,3F1aK2~ -NA3@Ӱv3w% @L 0r V 2A27P?KقA}IöËtC\ʥ t|EB>6",=1 ʹTܹ IAs64E,z$¦2K4{Gb>n 5.C ?XTTtˤ1L~ #,E||F1;,\t#N5Ȏ.Y;1X@Fc|CבRKFY"S )hDDGx͢+@Lk,A ǔk _ *y_"s"K\B^ܤWtV{!NiZዞP3!8,M:м*PH$m6i_yX3UHI]TDK!u5d͌RuR713$})ɴb;=5SA.wO4]-!}Сe:-5GMl ("I]ߋ(IMUZ6;UEMM30$Kt>d-՟\ML?LyLaOiWle`"\*Rߟ=WV1s_<1C`CTP3*]S)̈#3yuaj$P~c_/KMɻ)$V2ݷP'-^Ok҅ؾb5/4kaP?8'ݱ]%X܎(򁟋AcM eB64:HFf` +R<ę<{;5RzʒCU_='f?e B-aU:&.d-Q\V S,-qC=D1؝ <65zkaxNoZa\]z%^]iU,:ޒ+ՍAjg?t˒=_TJIBISnD;&-SuL̸I.kk֠SSsSZ}Y+^jMLyƣyi趝nl F_l4]1^aM\ZÜ4̳&?}։fdL4O,&V3'V\MhYҬV:-XVPXlUc"]) 4Aɹ3x iP F[^Ҵ]&[VgELjte3jòa~>InA@Qrz TNkO9]\Sn:lLC fНS0Q_&DڧmMI5.͈)ZAdғJ2g+m:,`+4svaIiNeH%R:Y.g֭UM99:Mn&ku\0c;d3alb. b.r kl UİÏ.,IyLy I_OOpߺkDSnn֔[=?u< NÑ~ F#elFu&ݼmm\YLf<[ OTej6*kO7 kh++CLߠhdlfvgPRfpP9@":lhǤ䔸ƉϪ{<[6bI=ii1%/ 6h 5.|jKZN'dmh+n/#db?z)?$vjl4z;Mwy'Mp9 dmUzyTffn).!&O4"˖._Œ `͍9Ҽs'M='SɦE*ITL68̪Ve>QM-Rə3̞}ʓgQF4+j؜m7ŋW¤2f3R -.Ƌײ QH"Uru3KR{. -Z[qF;z+{!ڶFy7޾[}vxNLapYVItIS*U.7,hŘYHWFXuPٱv8fq\ltk}r?$!5l p/0 M8 ءpB)tu"h1:p6B?=H pfH4 e$Z碸᧓keLǝж$)9v;DG&74xF )TyȣئxjX(<CqU4&3 g}njffPr[B{ً)(uԨOqDǴ%zd,v1Wi]sJd7[җf =ȷ~vAo6!R O~6eY$b3b D]5y%a LPǏ9NI5@CDzdu# @kVT Paj׻5q])%[‹ѕ R{ԋds%@9vŖ5ڤPȂvtNiFLjtT>'T`Ytw+o{qǙ&Q+ŪT bhT^ REE:ض-j >jU!2eX,{`%:3n7RZf4fo߻ğHo2[{_tqrJ!O~EݤL"Ifظ\̶Tۖyaf.l喥g5VKYd|/J9~M#%xXd&c^CiX33(IIPVDk6h44أggi985IMS>o<7/0$7?y$eB u'k9RfFM+H`9Hj\YK m[k8EVq}AHצ ңYƂ[7Hϔ*19r1we~ uVAlVR굯n 4a|[`h2p#_b)wWI**N wQC4oM|q#ZW%x+]wm[OO2+[^{T_?=-s5[M z;"v隷ԾZ휔n(R:k(䰜Z_ Ky&}Mz˽*&ډAX '\uSݱm% _q0/߫Tq ݋Hţ%N\(mSr#TK̟_6]x7vi2i]$_ɽG.==nߓc_>1'v?v˻^jy~+ƽ?a'ӬXJUqglxK~[[.xPPAͿ-lUR`^Z9Vj@_}صY_e ` W&TA1 .?O`  AiH p "a:^=aP <razp}Hl!acaH a MJ  D"2b#߰uE(#Rb%Zbaa$^b'z'WXp"()Ki D)+b,+KR-b.-!O.c0 cL!>/c2*c.r 2Bc4b󈏤ؠ4bc6 լ]6c8!d|8c:r!9v:c< m;=:O>?@dAA"dB*B2dC:CBdDJDRdEZEbdFjFrdGzGdHHdIIdJJdKKdLLdMMdNNdOOeP PeQQ"eR*R2eS:SBeTJTReUZUbeVjdVreWzWeXXeYYeZZe[[e\\e]]e^^e__f` `faa"fb*b2fc:cBfdJdRfeZebffj&%;bumprace-1.5.4/data/gfx/racerc3.gif0000644000175000017500000000226411217461066013756 00000000000000GIF89a>*,:&$F.,N.,J*$F*$22"*V:4Z.,V*$N"F"F&>"$22*b>4b.,n24j*,Z"$B"6.*bB\&<&^dfdz|֎Φ.R\NBBd.D& Zd2JTR\ N\B\*zJLZ\Z\^dJ*46:D6D.D4" vVT~JD>4.4,z&4J, 2vJDv:4>,*$$",n"$N"$B&$::"$.nFD64"$ V&$R"FBz2,$  r V.N&&,$b"z$j"$>*$6.>&$>&,!Made with GIMP,H*\ȰÇ#. @D(` .P@ A„*X 4la.\ D "Fh ADC'PPE  F  O̠AD 7pܐp@C10Ա=|D"8lQ#H$QI'OD2 "U +rK-[p 0C!F1dʘ9&5lڸ sM"pZY:u1}C 2 /̃$=|(P"omQBsAy(dDFYT"2jHLBI%q 0`Ch 'x (2%] CO R'J*d0(pDҊ+R HEIJ,p,$P-p  L6E;bumprace-1.5.4/data/gfx/racerf14.gif0000644000175000017500000000116011217461066014035 00000000000000GIF89ax$$u $${22x,,;;//''}}}vvvmQQrMMz::ggPP@@33**>>>===xxxsssqhhgVVfNNqNNnCC՚łii33//,,((999:::yyytttqkk`RRYEEyUUm>>sAAx==|885511//--,,444666555777qqqEAAI??VCCY??xLLsBBw>>g00m--r**x((~%%##---000222)))111888sooNEE\IIaFFfBB[55`22f//k--p**v''{$$!!,,,$$$%%%...///B""F JMQUX """(((&&&'''!Made with GIMP,À  !"#$%&'())*+,-./0123456789:;<=>>?@(AABCDEFGHIJKLMNOPQRSQT?>@X%-\x&L!1cȈ)ɓ2f2B)tM5kش) 8q䨄˗0cʜI͛8;bumprace-1.5.4/data/gfx/racerd_big.gif0000644000175000017500000002742511217461066014523 00000000000000GIF89av~:B"d"d4B"Zb*2g CSJR"* ;2:zjrdhfFO쪮BJ"*&*2RZbj嚂Y~ 9| " Y:B2 Qrz2:9d"*OJN26|*.Z^ ,~ lbf*2 WRVrv厖FN.6 ~jn,"&*xS&.V^\:>*.zBF^fdLONV Dnvdfn,&ZBF \D&.26>F& L tBJZ2N.b>:&|t*.j &.6>̂|>F6>.6:"dD t"&*2VZ D t .\t\\FN.6&.tt z~>B"4^bDNR ;6:znr gFJ&*"&.2VZfj즦!"W Pvz6::&*  g.2 QT*t}>jF܊>B, D, \DLFJ䚚tD t v~:B"l@@^]tjۡVvǓMz~ 젍6qڨ}Zr߁r6V})ȠOۇ Fi>c(XoG!CẀF6Ol*Nauݗ!zD˔TFB݆ui h 0,0)Xj(ԋ.8e>^y j J.e`u֟uaRiV 8!1t P.+'cNKv{bJʫRda?6LJA1fdO! / G,O^>s%򣁍k|.۱2 ,\`*k[rg0@OX2RI1a[@qyϸ uq*cIH&WcX8J+$Xc6²ʩ1`q,"ܡZ@ߏB3d˱@f}haCFhC5˒}CkwA6ieqD^w r<2@$5q3(Q#3R6Yc Wh@lYl /  BqJ <O ή/r07!va5d<2b'E|!|_#Hp 8LT 2_bI,819aJO{B#R  1|a_ %[&R8X c 19A<r Y)pH{G7_AhЂ8 h$h @\ ;f ɡD 0f,BMl" 5jlih1|7 t#y0CF0x0!p'^{f$lΈ>PuR JHP M!al"4āNz`8aK!ixBHJ6֙Pf@@  E!ЌKda T#D ` >r/h JBG @3p :I< x1#dAWHqAPNLCVx5`mda, hQ::u}UD9 L,bg-t7_ɣႪx53 #x@t`#IzUHj5f|r3$ bG\{Df&d!Ci Q@2v0tYmNeQpJȔZF^_jlge XQ !!P,@`P :קwQs%j!;C|1QV]2Նd[ՀnY;U:֪ ς&7R#+ʏ1dHg@^eń\'iB}?!iAC9. +Lx2 QDl#Q#@BU Fvq3B>W(  <0eDv@Q[a BO  [7P^~b[H@܈[$c i5אF;:D[äwtC`h!1`_VC(PБNF| T2YC#BЗ?880+< v3 ᭑4E5$IIm5Vg<`yX\.!7H S˫xA B2Æ Xz%^pxSd[ f0b0*lt1M;|xT2%o(M9A K_u9/` fh {Cch#1V P[F728؅{&]_ϫ֥goG"v画>萲@*@kD3jhs`Ѹs\vX=C>WIpa~Kƕ^7^'#DUdX8&=F);?TbE312jB1]RE4 5odsc25#oa)4&Vgeը/7!1r V4>EP8jvv|[306CnPQf&oܧLe Jݰr}"XejSWfC!#S#w+Gc 3 ej&G0 00}A$15 ol35>Y0 7e^#}Vh> IZ2jr ҇>G3q 8)X`X RG. Jp`"AXwC99c)`@@M0:X OpG`fGBBi&g s3@QqQ]kX{g .'a(ǢLb <"fP Y`@TvrQ7uEP #` U2u],c  ʐ" NXQ@ÐpqQ[aSvc5S@['G04aS6vp3P~!zEu0 f lP 0 #qPشt"}{Uu ]3&[ @-P@ BXP0  ! )pΖD3{ *7S;5Pbtq~$ Pxe9]V9Ip9t fPbpg jP52>S! @L ou.>cG"pb| ͩ%0m@ΐ(Tw !o+G5q\ ([EH KU GP!W `0 JR @ SzgP(CP)zGzp1Pg w Ͱ `#m G9( ; y 0k$*IV3 :>(j U)3&^^ o h 7o$7Qِ8P `C)P[Y`wI,V2W ` P*%p@kB&Ր8K41 ` z0  @ 5PDP!gfO0>lŠVV#{HǚÀ @~ºeQ$ps#:SJ0 aEhX) lp;c p  ېNPm 3р9`[] ݐ4yJ` 1v b0uZ%! PHKP^]MN.Jp`?P ^W:tx #j !p 1 }= }8 0n ru[$ | lP r0>8i 7 $ VP.iպ(Ft G!u w\ [ѻ[ &Z '@1E Jb@ p = ~ Āp{Q@3`~9VCߣ$ ذ [`  OR]I9R= P"C Eg 0`C<[:/rQ0T m ,VwOKZ^z \Uzp /`1g^hOi ` ׸DX^% `xxEp p> p gp* G0cHYzp@Jl p G5 (   O@ 0Y0 Y A` oB'w Ig#@` ;WJ8WꚬvOЬ b12 t`kY  -@nN@hw/Y!oL`m0Pgm I?Pw(P2̜j"(L Q*@b5җJPǖe;@0t) /0N;4\P@ }՝o Օ p`\,wUP>c ֠Q ~F? P Zq ~3[dN"P W L ) X]0Iz!kԱqawX`lE0 f ppH~Fn I LE|l4@ {P}.vH{i [ z jIP_X^E]gs^r I 3Z?i g.a…- dhԠa3v מ?# G*8 Ƞ> 8 p m`!pS,zeBXBlx j° ,P @n }R ` Cp ָe+wv ?\U 8oUwb (ޏˠ5 ]| nH IsT S(?U'_ c`(?z|J \ӏ گl#}  ְ`  @ < 9"f !NMolOu]7Q$ Q`svz֐Y&P5^(/Ұ pl2?$p Dp2$32Y25px @JPKNH5"0U{wI> J0P U` 8n)\R x {#X^V`S3*p3&?'Ồz0:>[{k !o<Ӱ  r" 1~4pEĺ=rF@[MnqP.we ,et\U$"ʦC:{J PkdLC.u&u"yѡg|aD0;qpx""FNv+gqi֡fp)#fāROؼ3oXvV많;ƭPnj\B *ŃeH+snd03&BX!Wi5<,8U! HPE`30A3 P!j,,8E(aZ B(7.Y;j) Z,`-f*@&,a ځ'3B+Ti:Y-rBp,) 2Ta$!%$vgj!?WgvQ#_av:b"X$a,ĄǛ$w t a U: k9ˆO CA )4)`ͷd/K'P 2a޸cWHGJ }J@h}g0J*1lEf/Evh;*a"KdDc@x `4H hpD Ȋ(ZTe8l"H &<1(bry)L-GYb|.&bɣ%ւ'F> Ɖ{>,y! I}PF'1Y<h^f-jy 4 !9xv~PWwʩkU_F' ?t;Øጢp1a* _pw ŃqHZ):@nl3G4@^0#(`F: =c{8WDP?@2N%tb= Ê6m|Uߐ$_A3$ HB}a8BĨB- ϣv0hZ HZ86N]tl>4B4TҐ$"r,[QqԔ*2Sz36P!X!P ?XT ~c%8vLe/Ý萆LXGb 9{"&cQ!PP9aQ&q+$Zq@4iU+ X*"Cb i-hR@&}b*nbp<{@,p#F%q sJE,g&1]CXxƃx(aǎJ"F|YtR&;y1 , xN63.i`fL(1ةL 1rk^čvaEG3эT,Lw 6 2Ơ Ka "T($awHtpv'#{x@@d ? 1 ؑ!k3@r-?!>(؁;(&U77 @>+=ȅv[;@ar)2Iv1 bq"Ѡ-H[Pl .J}OJxkx!jr (x#Xiz*RށPiyWػ#}y0$nྉ }`N0F( h9+؂;<ѨIx*(r0-W Eœӂ_,,-xzClp!H:x?4!)ق'h=Ȇn;hsHqchhp -dYsIaPX%(=7%f U`20)E0hȴlccpsXȆY-z6=rv+Ȅz%eH z v؃Km(JhuL#P8pHFf@"X#8Y9ȂRȂ':{)$32CCOahax{7:f`ahdGG@f@?`9ɿdߌ j_ s.F 38h؇v ⬅-xe0Qfx,ìf /r1;O-(7hJx&0,P,15@xZiB'p%01+ 0@遆G;Z3s%P(c8PLKrH;؁M v@̇ph88}E`%FpMXxdpXj GXhxIP$3F@?oW /.# 0؁3RSN(h>xiH1t܀;OڈrH[h)%GP;,8_`"59K95h. #;GE%d9!0 :nKC(Oh qP(xj+ X 9h\HH,Qsh&Np0eЁK4j@$+`i -ЂEOh8$hN{!~`._ՂhxKk擃+>[脅UU%p-Y 0 r Eh 0}vX7 RdZ)Ҏ9',PI؀7fL'}DXyaȅ#Ke0hf[da,fZ,h>`HOPJr3,MHpVhG؇#7MptJ 68x}G`ˀ} 37F0&1؅ @ HYd؂G'ތdU`UxQ8,H< '͕Ӕ0Y 4a(  x}'p_)yq%xx,1Kx$́x%znȃ$HcYIhZ ޗ(MY@baw: d.كGh-nU/-؂n1_ZH 2./0c-N+9l h_o$(u^9R +؇ dG(KnŒ(J`H4U}+1؃qbcbe5aiw0cfxm;Y `@a:bNw(fli@fbsՀ0a @$dXhX]\9xZX h@f5" (f1Jl 2  b _f&MJ hXFfj& P|6=;innoppiX(aIg!0ױ+hv&BZyi '.iVV2 ٟ*FiDASg]pE N_xpj~0^!pgEj@d!$s!!vPLBk`)~ %ɖlSȁñU(l]x*gp]ɞȦgʮ^gn" 2؃E7NU;V i٦mlng|v^z@<)]`pw5#"n{ n]4 9_ ]G %̮o&R֋vpօ1~⪠~g!wnn)p%wzǜq>J&`{/H7g)r(r7' -sj7n9sPr+7t=gZjۮJPTkM +T,.ꭂs9u n3uApq-?VPeR>frUOl#/:詷r\ tCTgלG'is\o>ql>lgt&]!xXs âfx^B֊shhwq^8r|mivkwVZ >pivCwPwtXNi @Ӊ?H/-V,{!gdl0*wWgX_ƛm؅Eۄf8Z['|W*nxcx7p "th(8^G؃hgz_>G؂)K"p-0&XKNomv"5psp[hq0VfO`>PА^ͷk!()8KH f؀]N 7Pi 5Z}ܷRz`n Z|'$H380d䖕jy:jS%ݖt+8`˖ݶvMp\7r#Ȑ"G,i$Jz΁66͛8P <1'R(ҤJ2%y1CA*m%U׫WlD$ZcӴjײmKj լXWEm.l-ܸ1Q uU~#JJ10ZÚ7sN2Krc.LZٳ;nzJCé];Q+b~7Pg[.n23W3båQy=xϷ/Ǜo=ӯo>? 8 x * : J8!Zx!j!z!!8"%x")"-"18#5x#9#=#A 9$EIX@;bumprace-1.5.4/data/gfx/fore4.png0000644000175000017500000000470511217461066013474 00000000000000PNG  IHDR(( H_gAMA aPLTEzE-M,~WIЏaX#nrjR`GO;B&N-<%j+D9az,;*uU;!1&E'r/b xWR8c=~>+^9h~-+I scTJWa)QO>HX`.,&HwE:9t zb~eJO '!8%'B\eb\qJ{Dmfl X q+IVIaV9T`6X.Mf+FRJWM0*#$9#Dd1t\Or*GLƚD%+wu `$D2X[V_pIJy ))MxXLv%Bn.aVq?)B\cWc+ETDsT@)7Y_.Ӂr!`Ҁ#^01,@+rMT^UzN}{!ta\9LP1)9DK);76) HphPa.}EvU#`!6V'Ad| *{\8U{sWhRI`  y$8HbI$2I) iv 2TbW ͱ"},G"1DU:b6~_RUw,,_Wy܀dIHVchE͚DqfjTs.!NӁI;GTNq(Wr7TrT<<sIDATxh  !"#!!$%&'()*+,-../0123456789:;<=>?@ABBC ?4D(E;FGHHIJFKLMNOPQRSTUVTU, WXYZ[\]^_FF`abcdeF<9\f:UeGgdehGgWijk N'lm_neopq/r dFn, (2ןUn$^{:5>>>\6Ly34 _zs:پMMLPO]m[+eV3EP3DD{${fQJ`&9:fپׂ $4*P7?y|<&(VUhe#1NN75{yyK|K$>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>K$܌~ɲ4j?WE5$ӟsLE0 t@I\./ B]=\.eZ)& 9G]I#++#οS@.7a̓$g09(߇E\w4'b4Ee,Qp &8eH]JS:릹LM-n.N33V92r)̥)02J㟾ڋRGB}˶U|1 + 2W}1ٶ/+V*j S.R>a),t9'rijeNвfJGly}flIƒYjǰ*r_c^0+3!v[a7J3 $ P|fg<,.u;;旾 \/t ϙοzjLǎA .L:wzEGM(xl Ҕ#\N]!hIXI73ZCׅ f9,VҔ!XNSNxE!8ATq`x?`-7Sakga:^Ka𴔼,%ǁhKW*0 =MҔҔȔh.0 TQ!X PE_:Bp/ݯe} ^;yκ֛*kY((#]2rs_ց&rrHJe$fRra|)Y89@7Z"BaQln=Qֵkodiaj^KK\CDPmrW ZNffnΎ`Ap 9ې?a1PyE[]9d~^.N 'mlg|`ߍc> jE'Mَ"ikji P.D& 3E`̶9Y.t_ ?ou|?Ң睙HŧÐYP"m+B)Q3 "eWtc7~RQK9Cvy2T XTOmt9[sAP6 N&i`lm\|oGڨ+,) ΞcccVmm 1xtgn/zlR򒔔`6{5)Y Kɷ*PntizRi䳽&%}aP4 VӔ!$aBPV4I6Micb>|[Jb)y8s *p8G4.57;PXQa4%/%=!X#ŏ9CFl P1Iir")_> 7uv TpKDm!:i4"apucȲ8^*Qc.zL UʡP{m̮]/|aRR g/jo{=RСRI- 5ӔfqTds Va:M6Ml|;Id@+$)\X⼸~Lo)])y2n_0 N.A(V{>ccLRr52%m9+vՙ|+c^zFzn )Џc^h*IQDJ 9E*dkXaIfcT7[[|8#%+(C~ǡERT<݆$,z9i. HSt Ex!zJA:ĮFrHz|B @yӓsWV}jR%3z_y o7e)e rd3p0nY7xÐCssa+Ķtc{X<++ 1}BaP4M$&&&8R.sӡw~:WFӏSA>33+ja8rkzBr^_Z|WK{͕◕%Tr9>|Uϳ,A-{|EA$J Pm?7I,@*q{#KZ`\6b-gkSQVKICTH(b4 ot:lL1cE_yag<U`IJ>0>fBLNr)\ CZBE3q]$QMJv@BP^qi)Esiz)ʱbkɛftWap;_t?C^,1Mr (9ٶ:(/܉0=!DJC^mŨnssxPPjiQA@EZ-/JK35g''4gSJ] 2iۼOGPz_566<ĭ-)aHB\ܮbÔi>-kzZY?$Np-()ƉRr41$<Aj7ee,kk 0^jܣ:asPG.n|0vyP4՘L+6$Bc41YҕB`G'ÐITܗ)edY*zhFVzfBi+^,u2ϴϫvA&aؖŘQ,,=04FGl[EǂhE_"B2Σ\v+iw:=IEב% TL|-Q@>h.GerR J 0V@o7=}K4j"\>o61 J{J%haQ1G. CZRRc}7.G`ƲG_G;@0X5 ~n'ne f}qfA|= C`< cqU[/1,4%*r*囟ZMuV͐)v&Uj?9U,@Pnbs &29p1Imkd{65^24MF&JIE`gh>䵎zD[[Y=WԿWto GO^t:T3r! \eTq0 5Av!(hIPtVWj-w_]3[z(Ҷh+4٤鐿v z;B74W3wR!-Z"L 69voD.UT(|x`|i7<|tbBxK:}2VpRaigz0YQn|D5'DrxpurGqob! ( Iov:(%C Roh}8xHi3[5RU~mv1Mo,)ǡ$a0EzHHI=I'Mq^h>%csIrJ#/<^w5q) C Hsu M$U[+N!XҎy`%+~ 20({`űaUCn#漉rz1_!Hg}{FRiUԡT(tӔ P)l"z=>A<&%t1P ̙`Eץ꺃r:oKHm6AZ3"Pju.au 4>,;O9Tl"IÇ_Wg^oQ$d6|&Dg1<,1<:B"ѵյ(ѧowGBd'K^;oVZqhdUBKA#6ݦi#Q1NW*a˼L&*7\]YC "E!fxn+9:Vi KKCPS>yss_ Xԉ_G&P)BƈTE{aHX/z IBr] 5aJ<àvrZ*U3} S ժ2vҔoaȜmؖŜkcOE>ޘ~ӽY]=f)M[a۞L#A0M1Zv*!J%bs9JGiJ3I9ʲ6 F{uSGM gβ ap% m(/;;GFh]Bmc|'Rs Vt+i8B/HwZbPL3G9TD58u? LL,Q=ïy~wM|9;;KD8i0Ud'67zGYœiYY]5_t:T55HǙBwZ<4fzxOr\.0dddk\"08$aȫ6?T3/f)8gpj>'#SS8[ax>C33ecE^4lID#|r_G(ǮÕ Fx>O\ʑ1b vz -FKt,瞕*J9m]o7"Z9%7-}grփ`U##m .0d*-66Fad$Y\n>ƛxka/|-Mx%IX`IjU-J(h6ib)F+/VdEnX|}T^\ /O-I,//ѡYF& _GGuχso?n=4SՔD_ܵVaB" 8B<+I{&ʞUIFU.6\vh׺]BP ,*GFβ_ DIBT&²g1ޅ-.7(8s wߣ:GQ*)#FdX.+h(23p++ X0Ί(zmK]vN&ըx64S% BEϴ#g< ntQHPI/xފpFG\0d*jJ%^c.4<\"(⇧Y[qLˮK9#B(u- IDATӲH\d83&EwZDJ~y8yxRI(0<փ'yܬ\NfOɲ!jGIx lls}-s4}R9)ކ z&Ϙ&rDɇUfw^gu*$<T cdMϿcE-αpJJN6aJdJ88g]zaIO0:ǷL~QdGGﯼ,I% *V_gu Etv*dE#u~1p &D=<%ssz Okii6[<>{ u:>-c%YӤt☢eno y黥;;UQJt|N[Jx}F271RF ҊP7yl y\(QtR21-\`G;W X-L-KF@7Ig4ÝFL9f20003VL|4o%z[Ee&A8yLOq8V.sui/>/HX?{oPJ4ىPƶm&4e+1 Q!? V$`Y)jh5D{puy(8|VQE1 M|W+c9 Y C>kU |W-gfTo= E5uk5MzJqG.m)iPp7S+BA}2Ls(Rh @HQħ Cvr/>QgF#]>W(= *EZK:1w`Pk@s0T<> 5R|ZciJ>G*?<39>d2HT;n\8=:ʧmsNOjA/Օ$ Mr̚&BpTTZ"ME`4& m&mF&v }Gr N>gw_<~" xYϜy޶G?[OrYe A((r!X1} l]NG >g)ۆjzLM[Ed4ű,l 3 _rV^_"&}婦)"s\n^Hnbn 'iFFH|$+[[ji' V~\@JɽA1KIq\Q))pI˶qwo$7QYҝfӲ(KI8ĮKu6/ZԀF\cBg;X]=/'&Β=1(Sz|Hʓ'pLòh!k׮aZԴ)%3bz{#B8,]|=MyEJNHl{4KKj@ګV}QA%l _{+ytT %WJHQMvlLsn:]w'  YwS|sv"Qz//+vrRFESP&X i"F;F!0束K<ǚ H1lea"uoBoBiY |`Y|(Ón"Mhj/4,&rv;WZi7M)Dŝ|15yB0뺘IZO'M`UX^bo&/Tj-[LWYv-e*(rlb' /9 % `= P-S_Fީ3&$66v6M!#6M,tA!Tu!&vͥ$!˩'oU#EhgM_%”P,zx~вHLnik '+ܝP J4X (bIS&u>V sAZ99Hߖpڰ]Rz&uàuVڧ |I^} 𸔰5`fv^663 |HJZ.}T*jVVaTX[if8Z7GG% 4Wޫʽ6qLӔ g&~q؄V{khX7}pwj<;I1} ^BӞQbC;T$@Ža8/5!}ھ?. TTJjǡ9]_7n;?'D& %t]46˝msʶҔf&sR$\i$#SXYlW*Tƈs9, ZAeQץh-Mߘ>zF`ݲeۮsgh\y.f5@j_1㻋mf|~9vOvl0ҹrFF gQ^h\$= ̢ƴZJ $nC͎Ժocna[+"Pwy{=B!p3({/CK3-a6L2fufY(1%JS֘ݔT9+t笱v_.Ք A=нa(gqڲb6P|j ;ȴ7ޫm I4e8$qYNOiv!&l$)2˦Jvm^mrtJ%TP $@ ]SO̦$B)]T{T nnqض,N&/w77#zu Gda [l:Ι^3 |(&pqg;+VSK4 ۦDŽBpn!{#^WàǼVrLT=:VĶI=ǘa:#fs7 nYQ4Eh|^)(P ZKsu=m44mlS؛ȰnbrrxFfݘn*7%۞ xs,'T79fS)o}$7mlŢL`;cTp\Q]N3oJql߶L:R, &yR,vAǖt:(kz#d\Ce!3߽; ^LsaP\*HeJ !jd=,>iJSoZӏ|NGh )jMٺ2²8 4Ð\Ǵ30 ŝk))IBĥ'k5$SviB`4v#(E${|TŹozlKI 켏ڀٗ,|ԶqZ!iyRBJ! I Ʊqcqc1!e),3^r$l0jRq8梔5MX]-G$.]ZN-cP.c' FvU!v)FF)a16lZt+'lqǮ A]J6G=\䤺Q٤  jccj:9fd7܈eYJdAˢlYՠ< =a_c՝Mgl)ҔIc폅?):r*3 v Y(!Iual&/!Ӟ uz*Eeʟ=8^ܖX,yƲ2;66PcR?faAy&&Y[#NSFGi[j@R^s(jx J֐Y#X~m`> _gu]mߧ<07"֊Ell#C詻jk/Q}cc DUxxnX8c:h Zެ rhsh\F&Q>=FC_@ ::]jU\,ϔҩX77!JS< kV*j޵'Ci[U˰&uZáBZ&qߦ9?h8 ɭRVaH$0ErӚ?,k^8p}j޺?èIT=~vI;Ԧ;ԭEs'Gt,].3պO> F kBe/7!i:;-I'm6ߴmRD& Q|ԍPNl:Y+Qo:|g^6͹iOF=(~ݹ'ў$ TA]! Eb*>Y*Y-}[>KRW3MҔ/I0ÐI`Z63A@xbttBA:ϯ@&˾jYlyQ$J%s9b3Ko!u!3 i8Y-WJ"" 5'1_ߺE^߂3_Jsx>S+HSxX_ʺכMz$+ZzL9eXDuZCݽ}8ŝ~vgbg4 5FE2\u.C8lon&G''):ߵ,N=4upSE/u \>Ϙx͜8&t֘(MRH;' tb w?IeQLy3չH}M=^SZTE:U c(Z ju.pccؚ5딖mruiz|ݩjl |wSQS*=NO.AJCe|\]z*}>P,Bx.]Ǐ".)f>Ouyzk4`h.YtƘFw:ʘQ*޽.lC%$JAOM s##j,K!ڳPtX]]e0m[S6'#OKn[0dtN_59h 0:(}vom2q}p8jJ$ k(Es W"V9ȥK{27qH Bjj0^sÐ >$P(PMRy>n"s` exw:t]P7RNFe6Ҕa0lc&IjYtXG5ҔIS~j~.|r]( )!jŻ~ֲ8X C813$v׈"tDzKWW9oP6zSEO毘&iʑR1LQXCE6?wo%yy~ƒgUfUZJ-K-3,gaJ >{< 0H=9cpXxUe-eTUZjˬcq7|fTɒ-Y%s/n|ϓB I(L?7_{}Je@ZZ()PveEp zN8 ?:5bߗt]Χ){ ,w,4%hq@/(׬Gp]i(NA V=vKKUr9Mv T"'{ȬCNλ.JuV-IºeQ2.n6)y%:](<$%FG$a1# CjaL90D2ו(u8%ݜOyy $وmoJU WU.> ץZ0vVVq `o2($ %s/k}h'_9i뺼f.pz 8f\} IDATizss节 `qҔ- <2n/t:hUPNjC54g<;  eض)2]'t掘 (+B\۲Ri(b!I({.NSmJ%2E[FӶn%_οɲ/)nGa5S^(QQaFJN"_3`7sFiJomٷgLo酾=y2ދԝ7{F C{1(LjV_`2&'7:iSSS8O.k5F'yl}q,R-F@Mb򽢣xs,G=˘SU>;,F((R9VY+/E7@I7r[Tgq$b&Jr,w`Y*aFi(1K]:u&U 2LOKlQ ˗#<ˎ_lZ?ݛ c/]n`ff`c/\9~f 9I󊁙T0mYܮiX%;Mn%&lmM2yb|ё*X {g]àRczp'Uexe/oi݀$Btҩ+Қ6,M1CEm= gTB`0#Bs(:Ӥn,"{VSe_MXV`п KIBb> zVS+ȲoY 9??zWurz^xg[04?܃l^c>i6%˘Ն@D9RE)Uݨ*RMSEEMAU`cB CVNۭQg76|M4vJ~uُ;wߋA,$2zu4dY <E\2)xKa7msC tS!}CsVӸ4 UGY]=]RCQ$ |[-X\:jbnν4WDuU.M_5 ԋkQsD\}^(yGq)yXxߗrvL6a"ٝ JJ6:0/"ƖTP2li6$w5`W@{0tdl"9vYQpÝw_d>d~Yf-s#agUޒe:ż #˰Lr(DBpF(e\",^2v]>k6" XX^e:FGED^>< >+3(:*we$62Bp޲ G7IZYI6T,;bBg7 U@w MSfQ##Itd&-9ʊԡ_I)<4ZIT |ZmX] ^Ve̳c! ȵt`Y lVcn(iL 2^]]粮skN+@V(m&Nt<Ӕi]燮n(z VrH$x:̳+ƫeC‡&'O|~_ߞymvY I,|en-ɜgӡԀQp۶ѬT͇s!x^gm4ET6G:IEn:te+6 N/M僦ɘa}\dubte1b22餡>jw?,d؝N =l] |n{%-kI~RaR]-?D*!Ja: EQNC۵΍8nv!zQ(brE0p@x!@c0dO +xeE94>NWQlR,Τ)UB$(Df;k46u .\5$Dz67mK` wyGA(oVV9 `=+e LsVCbvvϗorv]yك b|,WvtQ:-*z rY:ߗ9+ӟ^'bMkml ق.Z&A cĖAdZlj2cvcfοqNy⃊c0\ z ##?@˱+Ulۅ^q1JZm􂮗,wLY, _`b{-6sAPAT5뜂Md"M +$@sYU8fUU44BRv^Q[;el㬝 `nYe#l5&4qL;MIQ2~KC'} P (:a{ WmY{u=)oY-/QD_Qkqr~1M&8wL6o޹4//"<]iY\}vJXM"Eu##pԗ}m϶pICAI}H- GI-$E&[iOfggY]XggRq^<6s/aR:u~~Ο($af(i!zL 2Tnkv h!Ն(z8Qz=.!{U''c?=鯭rJgP*!fe&۽oNLD&XB2*;deybiԶqIR %Yk5\a*JSV4YdcFQ_U/e-P>MomU[*z0 QWR*P]k4lz=V` <&DkDUG7G-M}Q!x+B-â(uU-)Ay "y.]b|6$C:RB,hQr->2@-+M{\*ky`%5Bjeh4KK$<(]WV3ql䕏;)`n𶺺A_z<M Vٱcȷ2+ԴO7ԛMQ u}g9L~096,+@>+W7K%DLgZeO9.^s"0*D&8\",e\sU4u,a-9!_@f!$- -<I΢esc9)8YGެiͶq1#v^T_1h\JkxxENJonm$i=W:YQ Od|җ&ɭ7e`@aQ;iTrԬ0iT[iʄ&K]shT*`Y\YFt\qL~vUUmkܨ@TUU.6>XCkB]$uf;=i꜃|&/n1_bx"_ K‡R_־. [6eSOYit qFg;F+$ò+1m6yCC n^X_g38Mʥ*YISNeF-Q#7ob])a=3/C_q"g,I9YVDb)?j]žHR:9bttE- 7UVWT Qpq@+@{Ywy6GQ;qYF,7kk76c*bxu`Pc [+bN(C͑f>1Py`[N%/UoQf'_ Wۛk 4eQ4.YM(Ii( 7ߟvv\+}_ HU ªU*@E*i( g㘎TE%F>Ue!Xe*2//*r1 (?Ћ"jmYD`0 EfjޫjS@$yh`^(!4˼4DqcD#}o$̀A:2;"'Q qM[Q!0#]{u" Oq'肬oQUNuc9d9?ɯ}9 Õ 2(eD@4FFrDF EUAU9yE;NZ1M.;J]&pP*x6Ȃ5:7W|#\yO/RLۆ4ɓ,LMQٱ33<2S,&4U 4qGy9y},;jIqLfJ+墷_GG眡rY>Ȉ#=wN:lj01!uOP*WN|\kayP3(2(q&eYƮPW48Qt0dg[doJ$rL IL3׿/ {}1QY?;06 u9$@N4tS* | u:_ޮu؎,3 EQ&b&!z4MSwJBEEh* / Q:+*G-mcja!; yBBC9zțwT` ,+ʍߙt?KC47m`*+<ù|ֶ_oj !?t/l|Ň`n8~\yk {%r9I1Ӕ>wnTj*Bruf1ajG/{ժtQ$ᶬ&ϟ?.^TeXYƔB(+*`6M}Y.:eR!Ϙ(b)V})EՏiJi)g$KY F$,6A@t~zθ$ H>8Z8,z4iӤjYe("* [>zU` 'T,㝪34t 'I8u^@ @:4& d Vecwnfm}Pš2HS`Tµm&FF(+ thZZ/yOꗷX?j}B5[粌NLR*qۥlG0k5bB#~]v[Rb@>;.EKrqv<4m(X8jUD8'6uɃ5MA ݞ'̲!{XO7uT*Ɍٔw TrB/]zceL޿.6 7ٛ><ܫ+ϲ_Uw xN#sE'C39)n6zםU5Q/~wj "9uw tgf1M<_o@0d'il!G yv0=uSSWVhz\v)^PtY0lrNJj3UTJz=KZdKOSU☶\W) Q$FrUkB Ci `g!G6cFZ#EzhCW*qJUGqpKV=, ÿڪ+$# BLQU\`4Yg:SI@#t  {0d9ߞ22%-ido$́Ѳd7}huV#6 vYaM43E7 eV+{sa^ߞMTLR|}Jצi$ 8<5e #Lɕz:2[ri0k6X\dNMDv 弈":iViG6 aIҶ2uB,Z~6դ.԰e޽]j. xDGczժ\waRu^Up Ma43C|Vt} z]żl`՟u8th۳j.߳w: O粊 .pMn0MMZ67"Gy1 y"X0Mff`!u{=Ji>Tѻu M{p-k3:{Dzt☖mV2 2< }фtWB!6X!:~qN(jqBd^2ӃG`?,%M9$ MVht KڀEdKpaVˢD㖵垫e*BuR %$TQ]gQyx)iYNޅt6.|Bf}x r͐^dֽL*{U՚Rխ-M0j*W="Ϯ=u,}!&֣H[ns}w}χmVcRvimllxl'ɪ ]g GR{i'縺G-4 ;TFF(ggd4y^0D MVVrdlwdz0@Bʃ?IՅ_(CFC|cj}l!éVfMNLf;wʶ=k IDATF`z{z^ی[-'\ Ǩ(qo5)kkE%fJEsC2Q 7ٳrU:i[k;on^0MBוqA9Iºlll{Ar;C#GGm\vDRHY$0G/u=;^H>$&i ,Z \5f^r|e#Ih>I?e$=k]s9Nuׅ a7۳,zG:X/+Qd߶VK[BY *,{6{UEٽ?˘2.6àDHRk-ߗjQEV.381rѲal)0(Cq4j(¨K&]U<^A:2+ OU9**$זu{0\Rb1nYFPM.##W c`yfn2N?וW+K,R dq>P."ٸe$itMrӡlv64%ѴKdo`FQ(1KQdqVTDŽAŶt҈"J$[>{Z 1rhW͵fG<{>(2ӞE+rw[~?&h1;jsi= HқL~3pUDQdev*z=,K]WAӶ}vǙ^2'DQ)(b/L ⴑNhJG.B[((T{QMc4ߧEDye!3ꊦ)" 9pY2<|PjG]P/"pfAPP/Rcȃb($`սDG*_~W_ŘQLQx6!Ёj#IzA@р(h B2 㷶JQUVUFL|T7B`1$g]>EYpc}zcқN>]g*˘MyXݚ~6*n~rZ=g=ȌwVD᭬вl%gpcLǷk#Gb\WbE)A9'x%M=A^ B<FDOޜZLd v+W@΄eq,Qť0f%[3``t{~y0X~NQWG Q4{ ̑*9ns:OqUӦ @ԑDF (5~G4?U~[%D*HSɤmo^$n ImaHI-+M ݪ/I24eFe9 x1\J$ZÅ0R ;Uoemzq<:Je)QDZ99;t6p=ИSձA:V F]8et' 9Tbã[}/gʶzupl.sXBQrtM0d4{]U>$ۂ!~bǶyRUi.m0$!QbY]KSb]gIJtW8^L^Us86&K9XI]YqA:餂Οf\W:^;,U= &WQ%lM*\??}G9#}QquHc戒kfF:;?+׃`J1&9ec o#M9yH p(揲5 ûe&!r|=,@wY)B0p_&' IMCqZ0-1i2fYFKIB?*$iJA2 (Bh]76AZƊEQ놴$t iw:4TU'&d-Z"݋m5Bש:t0#3 Ǒ4 GAbrbf8YfkjɃ>P(qU}&RgcP=Oc>!pi˕d9=]I7P)cyvM #'"Z?1a0X~Q4e({K?e|=ITlKM|% u]V6pQӨU**Q>=$MS^}*v m<E7_7/sݑe@3MfeT zp>h2˞L.Oe$t0NmSW0d- q76`%4QJ%mF<Sb<E|LδeZ -EsYv^0FK^ cZtfJ%Ҕ벁[יN2-[կ_!څuzvX*'On嵾a#qlhȩq3KA:1i2WY]ޮg!C!p4MmOk"hyFRpu xV >=j@|K%]t"3Ihitt8B~سE*4fO:a(ʊt0&Y4c_Ƌx)^P3ũI@]ry^ǔ~a(:&*>rH:vhB"ullxMLȏg)12"D)LjCU g^660 3o5C~SE _{c+WУܗ10Չ r,$t@QBU0NSF`,;Vg,'ɮ'ӔUEaVUez7xE}ZˁF9ۈ"0Mb6Mdi[|![cV ÏoVU8&v1!@$FtlfBc(JeI8\MεN44"Fr1kY4!aïr"|} #{k Ϟu4ۉx7xb'h!yB KӎÔm{4粬4Ҟ߮g]1$$CZW%MYj@A) y:kQą Z,BlolLѐ͹sRQs< fvV/>` al+-`sZELOyya<\$/F1z|3 SzEk42x*0WHt<"w{I 'Oe ,.G;tC-eǑ8EԞ>+=cGh EAQ)}Ȯ]Cy>-4 ͦ|Z66Ϝʔ1T=R^XI¤A,#,niA:g4 l7)v‡k!:}tύ[k5V,bt:>]E agr͞K(iCUpVڊ9\ߗky1>~Dضr,E]"}_@~g܏+-. Ir (=oHy~}AZ k8—MvKLY[{wGY\IvZ~49= 0%5 ,CΟx{\ܣĚIVU,#NSj@ݲXG@׶9h,1BUCV-ݰ+ljǫpi۰e!B놁Exaeuq@=ta,luyL!!8L9E<؊qxR1 6U!$щa,<5jPa]@="|L64m۝4ϫ,fd! k2C ӔqC|b[ȃ(0@#+*I $*b-8˸OwӔ粌%Xߥ^ՎgNlrG3$:]뀞m39>.c {)8%UMcl0@/JJA0K#[*mϞG}lL:Kd7>.K^/塇T1Y򆡓KSX BYR9r2{Qd:_8VodxʸmSN* `NSǡc*>U_*ʟާiPfF(=$,:(̨ [eKLVs͘ir9MYՇ O!uy _"bYq5Mr Qy<:|gvcrJ(FGk8cT}R̵,т4eVs<\TQC c> Yף9o0Gzqz"iI15%JE,ҁ gѯ\,hi:I|"LHS0MM`͢kWi}C,`Jtjsx۽"4Y, \\_~Uy}&>:NS6}rjit;&92Q} r?sxgGj͛@SvNU2˯Vwu裯KW>t|$dOgWId]U7M\!p{=L "<ޑA]w=ofV־tWURKnIe,ƞSf030/ ! a`R3l3@=Fm1[Z%z类=+̻ǹ'%KVWʼn̬{=m`hJy;dYk&f2edKihiCz(r(_un (psjӉ>piHSlT 4j][5@q!Zn}<"`KpmS C~3˺^4((j1MݨKcH ⛶mu8XMN'y#o0*4R..+Ie@1Q,ڌ &ʁh3"8I$MMS@X%uֿQCYu!{ͬ CnRF`Nn([[c77c8{lNSQ{,{q^zi[ccG\2+C{7trN._VFTkzue\{ThE_GۼR DzT8 +1]C  ~`n@JNGUtu##ʕ,^tW{s%x~v/5*g׶d':m~5z)αQ@MJ^˔F'lw|a).e)yNbY)2Muy5 r h,+lyz08d#I0,4ivu=e8.,=z^4]BpBJRT38xbnm4KjZY^`G|y]3s)o="1^Thv;\uJ k.2k^Wi?3C;bklvps/ʷ8N]Q{]BجpIZ;Cr5 aH#II\vg~쭜/DE.:j2V(0J5NJt4nw>FVC}'x>`)-1pYApeeɼN{ Xv] _|KQ0sҖ~FR9|S;ar˲,9.|>MK$L AŲHm$4|I 5޵8?H՜LMe]ZZB& ^Q"^^pe({@l#E>WuU@x`i955PuBJB-˘Ba1Q,9Os;Ls:#plm ShXdٍM hya4{gYj~qeB-'c8ÃY7t^;5b\8P(p@ME$xfly0#RZTjp < mh)j36r{&ϛi\v 㘢iPt].gxvFq>܉ eG7tRn%~) wa:g-)>]ڭeǡ\HSx" +oj|~X+ )).v j{b.¶Pi6vd/%ףmk{9r1U3xQ^ߧ2? 4P()x,ː_ јJEjP[5gNAJG_iet ~9hmnrW[. 4YG}G0N94؁UT},\DY)CGli0*<6rY݇Uz%5R h{Z EĬ9[}v)=/egLJvѺ{*]{t^BwPpQ2 (8p3jS~ |i6ץ02Bef5!(Fj%6WWye^V1 3 Z Yg=Eaטeє\k kͤ(f.s)iL㗥laJ$xZN drÐvR}6)plE܎~CKgm(TDi$ɶJjf˪y4C`(^bTu}"*b?Qİ3fۜn(:Swl~k?SɉV* R76k>8Z#۰>]5x]=]NNs6ݻUzq/IFG2njhXTJ"h(HG CCl=X0 EҀjykU:±7 ֑{%ITytT9 ccz5b'ę3o-5gD5φX4vZ@rllAdz5l-ۦL:^/ g@?s1[sUfl˥FirxQDq< tQB,e"՞.-0v AldYR|ᒳLvIBYv 1~o(@vaTd#ˈQixm)4e&m4ie))ZӔ &6ox{Py> pqnۅؾzITMSJmG c; x2 p"2eBr.>#S6MdM siJ xhIj.>uA ,I *[|mq>5 5P VȨ3U\dcuP?k_|}ӎfs[pח!X$IArVVJA7_-`*j޵KBO&mn}a$Q~UmWGq"O?Z GNDOa6bQmZ$QkQ,{ضqKP2 ,-8VF&IOSvZ~HNLg}!әg*Tdcc׺jŷ\B\D a@m'Ssn4vU`I߿re-[Ҕ0hZKQDWzssHyLGFGFX  jAQO&W[וsD!QDF1dL{w>]c2 aJC|\Aߊ1gz9=vEs1:(#җJLa%F=䭐(o~ sD(4tϽ,e+Y`9øYSY@Hk.뼭tS>^~>x_A9$I~BqGWe]g38B-MOZ㾿 0 # *n05MfEb.{|!@8O5 [+kҋ XCeكwr<|_m/2`LN*jc8mAn$3V/6zRc&|_M[GXp}@2ƐVkYmj8ڨ]w@j 5r~}Y8>O>XTTRaG!u4R_ETD1]_lޯ7 qݟ+#_[4`PMI:iӆ,SwjJ9[[PY78#j9@\ d.y!X&ˮ܈7u䇲l[/%0s `,)nM(˸[6\x& k}E8躌{ @ͬ[3;R*44'%yWٺfmJݷGa< CIJagRq\, eC`,䔔Qh-SODEkUEБ+F^v9aЂTDyǓ,'϶FɲvoF頮A1yJK"@9hvP5 f*Hqgqp'廦iҹUj=.qL- IHEtszw>{βx$f{r:Y oc fMSE/{ܹS>.șGco. 204Y!%GFsxXmժJaZǜ,GG8VUFǾ6 Ԕi*cG~򮻶Ɨcc4}4jRowV0Yݣ(x*Loja-Q6v^')yќfqo}}TV;F(Dƶ".k,[[tĦɤ&ОN F;jB 54jdӄBRu_na.ߧEoZ!8k5,X *eyX& ߐdvV~j$IѥiF3>^atr*AE!+MVuK%v6>PJoTc4}pl[P=Z~T={eIr]î{xAs,v 4zKxv, M [XGlu<q(L[A.c0$ "#G'8lLȯoƬ Lδ+IQj'i7i6jWL:$׍EHIe1PR+4Tc pBF?0 "7i _CT<Al ѰR,": 6} J_WUMcq F1:x6Ix 6ؑ =N2L{v:tQmPx{=qM_/}^omaeRnRsፌpȶQ?4̩nZM AE jy{@GZ uxz]i Qpr!G 'OeyyЋ;5")VU[3;5jcdypuO/Ʊ0,9.? zOzx? LܜqXrM86j+6$[xQ?^죽y>jdPG&h:sj@Xo0 i&0(ǽ$Y` iXcqܻm58bdo0pДPk<.q+8-FчǤ|]ev:d~\]y}$j~J;bˮ5)NFr,Wa!Ƈ- ?[;uPD$ئI\'8#~Qty[ :Clÿ_,. Ϧ2V( jp9]`66(SNSyt@\sfcYdQVrNyK{E z2{GFv:YY#qVmϲmc.0p~ܵ.N4Li(}34T4ۢYD:]h =Of%ˢhYT g2!*J kM'|y%WBH ?~h (|8j{ab=:me|"Zx,s^5lH/ 8~F=HS1uGlO4/PMJRi[JB'Ieˮa _l$gZ͟|~|./>1_㯾 H?p,=.7.c1X2 >\*)/v:d(#52ԗPѼgư'Ye4ͳ=)$b4`̲_ 啯R]ӂ"MT+2^cfR~l; D_J6ײ3I'7=e *W*1-zv9s7QݧΞe&}UN뿺%ic\,Hft" qQ}$IDATǏ"D+['Z;T#>p@R4Q33p>|ԧ;"ͦqkyrԚkk %M NZƣdxgo$P|THRFZ4M-R.F9.z7&;v,3>2hQ<2Xs}ݲv,ln0M*j^JSM^rą KP]}ϻN;skkZyZ$ kRiԦ0 |0# \.<1aWz=< e")(Au wM@NOmly!X~$X~" 9RI!Hg;& Mӵim\vs[[Tva4QĐe1e4VZ'I:>3Ǝf}lǤ[*o٤0N"4 z'|mAdYET-2̺^E|.:ǻX@`@ q#u;n=}7,ë́8v 52m-CY7ϨG`N7`<a=VIӘNM) B@%':=< _hDUD6440nY@TA; UR9 sTmXJuqHrտ&='Xv.s6M:yk[=IIמm$ItUkWr4%cM@LgY ,?T.7+q|]Wo4_ǖsi:iMSBpd20: S(TV!9(wXJq3ժzM+YiN ʹ,صk_uUӉj* ]KqLdiJ9@Ѳ({JE>ڛ8498ZڳPm8{h D1)+rE9 .`3I1K%E]&ܺƚɬL ]VbFP,M+aE ->s>jNPF:xE4ϻiF4/ G{:Nä)+y)/eV6 {hz,%d*q< +Av[*y<_^AFG?' hNn_G)JR.ܓ?iij` (s0M>[FQ?Ob_vtEB)MUa VrPԤ^Hzt|\m rãjsdb9cTu3ieUap~'xVk)lj̬(ôv)#EDr/B@Dz8 B=o!J=8f^g>M)>;D9:iK-ڹiQ>!<} j9V/fZnJI°.{s:*Wg7ܩF"I#G7wVVnZ!&&&SԧYV4Ɋv@ (HE6ÐbSzyT,JN1Z@E]7a|q߼~j7M<) 3 mu9t;6 CEIB׶B xyBsaqTﵔTPJ& >Ðtx"MjM©zZa>2.$A,wdiJI l$IFzRM:Qĕ$,* WgeJ4KS.el0  k*Ec/A\PB{oAm=ݯDj#}d'Q:цs)}Na4خaoh=CC\h6Iz=&Qx JI=WNQFGe5:uO+#^,fӖP.Y(PXt(1 >Ql7U3xiVp"If=gRa$ts\-/f+9W8>= = 8_~ckFli `ґO͊I  .om1_(M;h10h,&DA7FҔ[t/HU޿_-uC/!z]:_fxn 7j5&1t\FG!pއ} ;|)㶍/%MVmNzWt:tz=,!ףVQ^gi1(嬼M\/?Ҕ^Opip)(:i2e밺Jf?gom,olCܹ&}}PxBaaEޓ#,p]MOj77mO4KZ;IXkY[ZbVJOhҔaβ3rX;IcR#ݦygM~'ߖܑhA& cqL)^cB)z߶xC#M)SK++,& RʾO5 Fr!O7WCUi8kOL)"4eRRaPAdHӶ,RҊciJe4M R2,c4)17-<%t:i-Pq g(0RZF<{tQjGOj(p晀 Gea ҍcY_-b1xZ1eѱm:q̎feC2_U֣^=!$a):x٤E A9|=;X5Mve NaH %E!BE1뛛,+h_(@9Hp܁C]_mW϶*Om^G  i(i:/f~^呾ex[rlV{LAED\f؟>u&0 /!}Qy`x8skr##l!L(KS\suvr6LYF>SGEA#g.ɹ{1b0nI„Fomcz7_oz<|в(4׮viE0R5)a",;,bsVnә0fАDƠ,ПNSf= )9#yRQV& A0Xzfnreﯾע׻OG}Y`mm`Ӵ_~եK8JYA Vjz |Z%VL&;mznпVL,<0|L^ qL5!TS2Ih2 |ϝYdQ}slйr&`1ٕͯt0K\:4oKB)-!֮HI W|/*}RJZȯژW$< xyB !0d YF+Mi"Y !I) .Yi-DRaTʭBPsne$%I?Zm2` ` Qe`!^]GɩZ_: @0YƉv,B` RETZm(/JIgY> xMժ)!؂aLXYFHSHS|mI#Em,#C9 ETib0Kv}u' >&\RRh=-iv7ܗsYgߺ *#͇Oz 0&% y)2B“oR(&)F:>o>2|AC/{ DzTmHӥ8>.ZP88Q#i|.iFכֿ|YBP#ys\}7mX\vےX\\#\g[q-K4]; :הeSG9W9!xR*/%[R2%Siʗd^h'&M/\>.3a>b WQ4yq)IeLhc9 ^!qFFN謀X_ѹ(Zc|}m> $l!9Y_Z24 RR! +MRGXrgMM1Jll8^$$OӓT/ <)y48bzRBފYd@Yk؍c e6!&RneXYVy#Z̻,Xsg clI ׄxkzeyNݻ/,2\8BZR.AsVsS -eЁdF.BifQ })tW\HyKUe_`JS3PBR Qpu)1.Wa;`eCPkzMB̌H9h4` [PB6$eq2\iIGjY p1`d%MhUI!܄ V0M!KRn$`(fmY/۳d5M&Ӻ<61J*!0z4I߄d'%kB+w6ϤB\}+ WgYv7M`kq- C[[v,]7 A4fׄh"'w`1^CLVXHdl ݇{v:xN C6χ۳ V&}h6{ӽ>R u!O1L[\1pK1yuQ[QT{QϵoPmu]79 %EC˽Pc>ҋ=Rzb+דJ7j]pk=lv?;́a;.~ ڭriSz73)i09Nc-r}}(%cpRL.*s5,1痎s~ `gu:d;-ǡ6_p1`uk()?l"iu1|bg^\_c씒_VyT -@P|T?½*j|BזUbLLX;40'XQ*\0F]@&n4f1,D֋3Xp h>j5 kCimgؽ"cKƤfoZՑLqXpLl-nS+'xe!¼1R XZCIH@gŅNrERV۪i}7;ی0!9ΝQ[kε۝c}}lqsڍU@d pqjgoeGF&Q$0 hL-WE\;B2J!gm}`iܕqLQi c߾zU?xFPaF[P \^#0|kC !B!B!B!B!B!B!B!B!?'imFIENDB`bumprace-1.5.4/data/gfx/racerd15.gif0000644000175000017500000000031711217461066014037 00000000000000GIF89a LLLQQQ RRReee"""pppooo!Made with GIMP,rI8ͻ`(B99.CӯAGmARIԹa$"tS(Hj[ *@"A5U^qq ik{ ij  *;bumprace-1.5.4/data/gfx/star4.gif0000644000175000017500000000047111217461066013467 00000000000000GIF89a```cccgggkkkllliiiqqqoooyyywwwtttnnnxxxzzzͽز!Made with GIMP,L@pH,ȤrI 0gq0 x XE:t< lbd(aO(Ez3OCK F!qB"JA;bumprace-1.5.4/data/gfx/laser9.png0000644000175000017500000000231411217461066013646 00000000000000PNG  IHDR (VkgAMA aIDATxEnUSs'R"$$`Â-$HH<;aKRD@H8x<מqZB}{}_u|c_~OBPW-c Ch90j:peʄdLRō [wȓe`qn:0iwSP1^p! TDj". BtUE8+قt JD}[WY]f91r{|'W F$d J:1qoY]s$qW.pкɤP䬱eY꺮E`@ڹZN?cIa&p@gE.d*_<%wOp1:WDUUE)XjuHPIT8ԀWM'\ q@2v!;GnZ @D3ptڽ]]UW^3ΠB',7tt4hyX"RI !=#uiIH3Xhmꢘf7ں}{_B-gҋk[Eg8u]&~ \pϏnX`REio@ X QQ+(̦y]f^/D |rgLD4nb] DhWv&3k@l|zv^۲8눈N:fDHTY&i{xDZI$1"Flqҽ7s5!U\xǓK>fS0̠L))!}Z6!Ofl?{>BVGIENDB`bumprace-1.5.4/data/gfx/fore13.gif0000644000175000017500000000231111217461066013524 00000000000000GIF89a((NNNMMMLLLKKKJJJIIIHHHGGGFFFEEEDDDCCCBBBAAA~~~Ո⇇ᐐޘݠ۟چ}}}|||{{{zzzyyyxxxwwwvvvuuutttsssrrrלԤңѢϡ˞ɝ!Made with GIMP,((  ôȣ˧›ػћ 躦ή<@žlr߬N!$ h®mͺ$lN#0T 1J0qE*Vpࠅ/`Ĉ!c 5lظ#$)f? "dH 1b$"\GG)ԩUs\ͺװ)ɢ0ڶOR֮wdR j 6 7nᭈMɲe%LM:૗%ǐI 0ݺǚ`hGϮ-7)p>YE'EcX嬇'W'Ё8JyÙfR'PGutU'_(R@_tVy!by_S8 p\ٵYDEo!ȕRL+PaTa!)a{1/(ͅ1 2p@`5bj9# #`œAFXcj饨29Zx ev,̔[囖d^g\tgn^aED(L-pE'~ ]Y0HS ;|ŪZ~Q5 Wj[LT <ƭjcZ)C~+gj =!.{~ &Iyzc+Vנ oc{qA K٨ mNa {oɢ6gh2ǁ;bumprace-1.5.4/data/gfx/racerd10.gif0000644000175000017500000000032111217461066014025 00000000000000GIF89a!!!"""sss%%%QQQzzzRRRPPPzs{!Made with GIMP,tI8ͻ`(d &xh`BnV!tk ~?4I@ Lj6.+Q1n'e|Hs9|4`|~ u&}$} % ;bumprace-1.5.4/data/gfx/racere10.gif0000644000175000017500000000116211217461066014032 00000000000000GIF89a:B>08|6?9&&&JJJLLL999 -uuurrrRRRyyyYYY$$$888]]]nnnsssqqqjjj___QQQ>>>+++ZZZtttmmmaaa###@@@wwwooodddNNN444}}}ggg111[[[{{{fffHHH%%%IIIzzz~~~EEE MMMBBB???kkkiiiVVV```lllTTT666===;;;333!Made with GIMP,ŀ  !"#$%&'()*+,-./0'123,45627789:;<=*">(?@ABC"DEFGHIJ9KLM7ܘ?10E?SPP+3t`y KpܲFL@'8RЗ8s;bumprace-1.5.4/data/gfx/fore5.png0000644000175000017500000000753511217461066013501 00000000000000PNG  IHDR((mgAMA aIDATx}[eY]־SNݫ2=33gP 1 1&A0Ƙ@L|2&`4G!B Q´ }KUwU:}8uz^/$P0F]p~)AѨe=d1Y,X^TUq619;7Oxng?h H=z 9)cY$՞ 4 D6F.#kAd6N<0;C@aꕽOݽ;ص0U ID օtP-rf瓽bF!y-c FA>M1#W}ҥ1ƌms1dI8Wy: 'b1&h N. }\Ljtk>w—:'h u_23Wܿ?~%]|䑕nlT_sg[F'RZcA|d0"B]-,,\v癙ln濷R*8w T,ǔϒXy{.?/7yk/DWTI"Q) TUK7΅O(?♳:g+5Ft_\O,ZWŹ)Сi+&esk[i0I)Hٚ,&RMФn:Slmu6a*/~&F=_7>ԗurJZC*yn0FHII1"Fm !iAҒE&z4z:啒 áڵ=tf_p@oPL#{@Z֋BJ)9X)1E'0, Yx+mX{Q̬7F)rVK?Ȧfne~KCU5φک@UdYt;\#*XչZŹ-EAS)#V<޽;JpmppO\{5P"MƓ%Dt{SpԐ9 9kQ!xbLCBSBJT%K3‡U,7ni_>;*nns˫7\B {d٘yAs` EQ2T *Z.~2ĘB\(rR2 =D,1qvMϖeݶ v,֖A{,u}cZd&"q9L&}׫bC%U@҆0Z5&4)MVvO(El#&|(]Uξvؓ>FDV{ln=5P7:G{Z#2fJJ" !Vv2}OLLj(˓'NtdF][˿55oԂt`L GE"pPV=F=q3o|.^&5R}tIi[ f:d4eaRJ"cSb̈́[z)EY4SEbB"h-b ߉93 mP%DfZKglIQ(Hn ֙ >bH8'0v g8sNWra4xcst2ÖB>;⍙m7:mz>MS,,5WqHk-1*Jh@"hMgOťPG=oK߮@SzǾ{а1f^800w{L҉m:(4I(=b&$c<#NI1xbWV/m?.vO~ӋO?!*;N ^'zKv%c1+@6@CSpYDLQmaDʢCA6+N]mېOYcVOeF|C3'i\DX]P;_y%炟BHOH-F~]!i}j8uΌ)#nJ<Ļ6zAݝZe94A~cJ:nNﱑ{{._3">dN1A5e午Q6q}_Ξ]@>q啊G$7) |У~Nͫ_bK׳jsIU$bl\NYu_>s!` IIpEA+vn`{Nayz_& ߍF[)Ief\ٍ~R13i}(rscA_}캿1̯` 7fBbsn~Lm( b:rnpan7{}]>xWmӑ7/LSk>7(çr&*!IENDB`bumprace-1.5.4/data/gfx/racere12.gif0000644000175000017500000000116211217461066014034 00000000000000GIF89a.+5|w8S?RRR{{{QQQ...9```xxx|||mmm:::Auuu]]]$$$M1}}}qqqVVV444)NNNtttiiiFFFkkk^^^sssZZZEEE;;;111UUU>>>222jjjTTT888"""999 ~~~zzzeeeLLL'''WWWOOOSSS===!Made with GIMP,ŀ   !"#$%&'()*+,-./0&12345678.9 :;<=>?@ABCDB7+EF#GHIJ0i rH$*`r Y"-\4Ne|PcPP#͛8s4;bumprace-1.5.4/data/gfx/star2.gif0000644000175000017500000000047311217461066013467 00000000000000GIF89abbbfffjjjiiihhhnnnpppqqquuuwwwyyy~~~ˊւ߷!Made with GIMP,N@pH,ȤrDF8  Dp `cH. ɄHX fj6PCP D!L"#i$SA;bumprace-1.5.4/data/gfx/racerc8.gif0000644000175000017500000000227311217461066013763 00000000000000GIF89aB.,:"$Z2,R*,F&$R.,>J&$62"*~*$r&n&$Z&$J"$JB&$22.* "^&N&$J"F":>"2&&, r.,V24B$626"r>D24 r",J$2B<2$.$$,^*4  "~N\FLNDN4>,:<~6D.6D:D&, $ .*&V\^dfdfLflJ.<NdF\BL"." jlrl‚tʒ>Fd*b&r:L.< *" bdz|Ҏ֢6NdRFB\&&jt.FLVd*zJL^dZd^dzfl.6<"FD>D,& ~VTNTJTvNTVFL>>D&,,zFD>D:Df2,j.,b&$Z$BV64^&$R&$NF2,R.$J&B".:*$F.,B.$!Made with GIMP,H*\ȰÇ#2 @ 8 0h$LPB 2h@%08AE*T`EC/`Đc |PQOmC=|`qk ? "d"F Id &Mpd!(RPR,I,b.qB 0bƐ)c 4?~Yf!*mܼG:fYR5r 􃇂 JD"F=Rk';v0I$JXr% L&p )|R9'J't2DORb)B[T **"(PؑPF)TZ;bumprace-1.5.4/data/gfx/font.png0000644000175000017500000011434511217461066013425 00000000000000PNG  IHDR.gAMA abKGD pHYs  ~tIME)Z IDATxwx\?moپ%rbNHj+H 2C@ 7@HȦ&Ym}ǽWZ 13gf̜90a1`6f6a/򹱠xMSiގO̵s+ܟ Rf-RۛyEZjO_&ν]"-}m,۵|scg/˖ //OCþ$0z-{b9W_dsߴK-]pE}=__k//֣}¹Ok= ~ }`wYF|aWrn9I/d8O6oH/q ܺݥc/m0.-W9/a>=XU*^q-!9B[;.Rhk͝ϛmvt"ӑsFFhcPb %2I@|aQCuP. s%A/H0a,pY\ ?c؟O#-ZBm,nxh=s +Ahf*\/vwɥ|T=sU{ !yl񅝅=;mZ_H]yg?شdz涫}( =#8!fC KY(x]Oc%nl9/Tǒ,ۀ$n@."DK)V A\4V%G܎&MJـQ R|av ` :1%ssO{hX{Su^{k\63Z,=~K&0\:,Treu #u>VU4H{*ư3ʱ3Nv (vJQEcjnڲ=Y<~7 .Ggg>VCC|an;ߍɷ";bN:VJ6w#_gǴ{mbg^Gֻѱen[$ۅIzѨi>vm1J'lpr6-k^Ynt=ṓ\2^Z@slp?)I.]U(%kώ|{k:~ @̶#^{n͞;3]ً9H]HP{]^XMo mI~{_xn@ @|ae$l(2X >|y%I6ߺ¤D|f"!+h6mG.iDNr 1B* W-gn{~q3- bu=Ήqti9u"`HOQPO AY5޹K ~~!90: @Rbw vSIPMe BFzcg/Gcrۯ1xߋ/̍%+LȎϯ/4LZُB?Tk2{^/̖ .Ve_m%瑼wRWP/vg"18ga9;~=h!2*2Uuӈ̶?a֜AQKJˉ`gzBP 6x6]9A@>ΟQre[ ; HM=J3>4¿+XF},~ȹ鵙W@%Na6uuKpv ;%Glp YlCy ']9H/rRCW ;{\$5fzxryN$1Xa%R8]NU!)q|k W lo)3L4tbKk4^R[mj3f| "2YShcBa9.N04!vwe|rьU](DŽ[ `V{ ψM7դL|H޵m"TzK \v2\kcYڟ) ~@x)ݥ/~QCWp4-eUP3d;484t־+(K~d V0ȡ+m.ҁ(jcB+JJ0 @̱$$X8\]\ x'q<`;)! 6묱m9?.X䂞 DsyRi4*6-Q2=rEza{XdѨϺ o,A*X cgl"-}g,DsK>3nVLe+`%tXrUc%dugk-o>v'ۚMw Vg,tpWR-e+5T )8R4NY2\\u8ZϪJpgg;+n¶K>XK`D,y2񅝆-e~SmaɌ;}gnj' 6!~Xyb V%bwW u;Lcy7Mpkr8,8åNuͦ1'1{9̼2æi$ <%XL|ag>BLrR<7=v9 I4McɆmvݕljƾ;PWҾ~ >'RՏ.W7fʾˆ~mSwfA|cƯTu艡 C9j^MV{hiP>s!~yVF^/],rəB_a"ql.3>R{q$.ޡ~_9h]0Hbnʅ |^K%kQq=3ð~63L቉~O7K?y"4hp>zxL19$CQ)3H+t;_.¦15\Ԙn(za%\QLNm;] (;` \~o%HYIX, W.t惽xiMgG$ |7#o#]4y7U`kS_~ oVZZ/ ȯң7E;:w[0dtocw^\ϝnwL W |J8ޣTmS)p7X'c9F|0'WNI^wyX~n?ǵA k@ XHu@'B[b;ẌjUcW]T)PFR̩㽍m~2> FӰ\o(PU2&#j& ~wnE71S~TbL  I_C\gȚg_ $ Dx##ƟMڳLҠ֯f8?]3;imAϽ;\f5f%~^B[!Uj!tIjGSdCف_SQO`yB[IUJݼzک3*xiY`eAZeiopEu*h:&87Goj>)*6"qԌy(N?Л[rz$RP_UKl2icRu>>t{PD2.? iqdO"~F7 T.s);kWUGW7pz ={Gun@7_Ki6.)0ĵ$ԟO}ShkGm+>zڪP%K&`кb dߤwڅe>|e dD老aHcY oοC,;x/` @4}^SboƔ77e m[F%-kot4nxX~0維Z ԓ֙&&L$NqJD27?kf*4=uCkiΙ&rR堵}Q/Q$X_BB[{Njk70tK'>I`yxWҲN_ѩ޳.4zCTg֦u_ܥٺ8Y/.jGSd2#4~C8@E']_M_@MLHO\Z7~2Z'm@Kd:7řA[en+Vh:N#^G͙ \W_ujsZ3+c=:Ϊ_gK@@0>h-HƳ~pŷQ@ߛ*f{lTh]1O,'p#d碙}!%_,_g0?4VyX/zTy 7&(=$Um'&Hۏ7vřrq T2#6ޑ||$:R֐U#jજFuyNH9Q֎ؕU j.f"QvF}:1:7~ݽh|{)_r*c!p.owcX[ތQPcD17^hIsތۛ1<sw3R|/X29qgLj+ьҁa@/ @kQ@"`H&=zd|ff|B[BswtUG797 r? j.{HhkvV1 y=$MMT  ʈ;Va/,bwI`]/ʆyY"9^FD;:c Fv[VW]PkWRGILjQO39 aTn=+hhs]'p}`f[#*ҕCr ;K&g 4[V =R*e/N :/tz Wο0aB gowh>lU>)ao۟bwk d ;GgnV+YC~3w^saigюά;ie's 8iJt)XqzW!pNq07m>FӄvmZtAS޴"i}Vo#ͲP+ZBW0qg/yIBx0w9O);x-Vv-d&<[0 4Wlu㸋bC\@4.{C ><>c۷V僮QzvcS%26^RϿܲ\b.xVC[Rhkh=%$b wIXd >R((a }x=Y 0MYV56isZ}5,\'jqNEAqkTY'܄CNX68 sѰCR= j' m |CUȦܵE.'`NrS'h~o uϝxi}ofK3֮eUQУ]A]kynPHj~ƋjykU?5`YxZ .0LD;:s{dg؎ߜBtθe}4r9>#vh|HeZ~1h9YEZ{tH\$q1 rt%TdJ6obV)U7s)sfWrcKeX36xv-IHDdGei2:2'\UcbI']g'o}}(6q]jJSdď3g8L =CXG]1-S6|i|4eNr?t-V¸OyzK֓W&-t+㙚6'~Y Ipg bwYĖ:y`8})2BwL*O緝S.TIS:?}qo27RS_OF2-5p<T_?(I߿ML`9x @bR"?~WO`nٗ)ԽSޖbd6@a2n5 TmTygS.H3hXa>Z[׫좐|ZSc,x'/ȵA=35.ɇ;M&}aUh7WyqrjmTEg׍ۑo_^x I%KqIw܌\?TI.}•Lm[HzZZ?IR?Q]PZ$TJrX:h;cnئ=?Өt~X#M,5M~ FEк7qTy2un9X~-R@!p+S>-T VÖM {l yr IDAT0EF^`hUln̛G?~G ׽멺YKg'osoÚȼH4.gLG#u>\x}#䳉ȴM"O#kP5)HQ+ RXUO-˃wmsq)k^MټqkT2fÒ~ϧYwX~K)vlθoLLyF5PpFY!LyMS3fV5ݥ[hG 8NeOMR[Ǭ,2 ߥ4^X5 Ui3FrJ*7oT?yqPII`ߨ_ྂւW<:tQD^]CTIRWwq|łȷ mY~%UpDH6A m.F;:\~&1jLeL^*RnN gG[č<=qd,3ssb-V*pO苰퍫= /PŁ7޲!]=䣎p|^b6rzP\OmO,4 Sr@Rh-ND(z@.w!iPiMyP4=Ul@ m!vtJN뷨E5UzR+~,Hn5 E[NEk/`iI'RiZJ*J<hG=(=kߴhGgVHEs^΅I,1.`DBijzVyA`0U.FI!љvSTxX{lJ Wg<0gW?VLhkW-.w)ҌvtRf;a%X\S7vt:~voC<.Cc+4tudvtJ6n櫃K_M8-J#NrL@=f*6ZT!<.1g l|n$U}uGR:(s~8t{ʱ3E@W~*׬VC7}+4:$&Du_|ހ3XF=w6(:@ףgWPuU2DV=QTod sNZ_5-EeWn 1}(LrƖwP {!KgTgR\`(Bм$B准Na)4i/#a8Řq *Ce"9 n\so UFN^3?u8PvbGҬW{OhOO"vwO#F%6lR$WԖa:Q7vL o ez${YLϱk5(:z ~W  )3" ,#bICxeٰRѲ=|N/lE_ͳid4WDbV^ TP'풱EYJE6QiF*ҊN!01Two'DSSyb3fXϮJ @1ķ|V~r w=\ǽϥçwgu\ق-,ӼU O ;h'w_a}f.'woEOZ'&JFw3 `*vjT2vd!8?Q/}ʽGb ULI %u! ;6 j[:3tA r0~w2 ٨[_E;:#ZLE:n2zI7/F :/bhGgmzB[{C.Y^/_. /[J6:}/J$W/0v_o>)NC$hI"eϔSO{^|1HM"{)ga fx%Kۑ=9l^MadRO+,KUl h0Ks+1w{Ge`J94=*9e1ԛqI `p[P|泔}?& _2h<- K"á-иnl)oa=B!}reIm+ j5Z5;? Mj\*1X( f&T0ey?Q5zkeU3},)ly.>)<٠ %0k,k 4ni`<)SV&AV{&~z*ƏKO-D. SNiz'}`:V%DLz k&s([z>by6Ɉdd|hԌB`FJSQ VV0UЕV`♄p\oo|ZBXOt=ngHUqҽS`5)zWp)> 7ϲ9&?:ZQN/K([-Y?W+Fd[Vzڄd$<N*ѳ4h:=tfã>fԼM*OKz sXO{ziD|t5Oڻ4,[ xh9'!vw Ot; :Fb4i)QW^HϿaEP S@o")͔ EԲǟ4շ Ԕ*6^9~m?I/j"[qf)/cMUxzXyPS_ 1?\]ZlM|!(jrDŽԋTU{.ZBMGxLy_n,܌^7Ph.f_Vfp|agI%Ӕ7uWh :GtKDv_6 O唍w\b)5qĥqBx {P竛s'o =s5w0-y aZM #Λ-,/_H([.R.i0lUB3#ӹwmbXhk+G9)yJe.1RLs^Ij[,Mzy "W8[H]1W`zOSLJE(|Aym &9Rd/j %5~|H@}`_̧.p B[{Ж7߈ W7aD b2RI^.&b~i8<&krd5,`P vwb&cGD7vҨ(1l dK^u)_U3pCMڹP!rflH(X\dBA^~CHNr `./<ء~H(%X-ZLfNqL;_xn;0%+?lȷRb680&RVA3bdTIOZyNȹ#-\05͜#N\>2*M)wD@ΛU!쩜Zos;PѺ¤]ksx3[H]1ݯsDP{WH()uWu $x zrxκaxW\=_3G i t *JxOM_*wtQR=٫#H ]= lHto!}$o~ v'sxǙ aj哼݆,NĬ@ K5AP 4R:Z~HM\ ese;4hd`4vە(]Jd-1ͧ[Mo1(CG G 4IB*P`dYw+s%%T-ʝ/ s/1dfےwAWe[}iW[4d,f(~Ĩ[a >2q8[Ȏ#mY0u6o<{X,"qōe7t!OɘuU 1(@>)Ci1dqJ65Ii顕-.Ӓg\Q/!}GVhkd-2po|| o$Xީ,T+ 0⺩zYZ@/O1TɋY}7RHX.7u+L>l} Hgg'+غEKMbЭ+Lr}~m fϼp% _#gϚegwaRhdzU%(N+1i\-d^ "݆ѕ6FH%>[4=(m>7^7fo5aEc%=Xޓ~3俘*+fm>W〫ׄcN<}FiЁ%k3I:&<6KPOj4xM)Gus˳@$ !9KbʆNonxUKb|B[;SB~4O^O_L_Y;KF&9a#Rҍ åV{ڲ#5?hVi(%nHϪM$b!F7H*4)V9U8x.@>= S"h_>2!;֛yV.I: m&S|Qw5oUԖ['v۴QB5d{mA]? j =谓5Cs^^=.L8r\񀖽 uюN]<NJ֡BPK:ҺQR]=K(;įv$rڦ$_H/hÞF:F/62VN mNo=N&xV PSTR4%=<*.DJ9(&U1*Ysx^=@1&0.`\ݖ)ʙU7Jy aHX1i!58~:;{T'"9\@$_L5E-#.Up,>f0V,L_NyT<nOePhDRR/aOmzU՚7f700Msb^L7$ ゙/?;@6 ;E _6$0c{J?4].Yޜ f&^G0XBFL)e Vn$q`'cDuhkN+Wsb@fRեr'`u0$1hOC>';Kl\P]k|8S[(cf8AF ٴv,{^huek"Ԑ绦E]I:Noؔ3{j}Q%qQ& E}m>1<3#zѶkSȶOrN[m7*)v#J g6}gmA̟ j'ۇeIپqPC \di#vw ؔV~ŦdK-2Yz(du|I=ps<)r4o q(!$\C#ҟ5ƍwא"'4xsv>wԹ&L=[KG\i_q&/SĂY8!L~yfUoPΣpƼ`[7Bƅ5sQcpD 7YX@M[?>Ov<4)<,vje'Ъ[Pn}&Da]Z} POkqJvOwxHL?]@G +ZO ~8SgAEsRl^s z 44&IbFP3Έj C9#ԕnY&D}5@nWd*/$p-Kͯ0zaL`$?}F qohn9z3m=PO )OszOK?FGf# UY~C-ddSi tg%qՍ }@M}@ VUشj١wwL1#ΎRB榐1딨kCʷŕC_DpE9}w#%ezF殈-_ m0dB[;o~6y?W:2 ˾f~G񬻲>ڃ|DvgHւb!b^+YA+ysx4X > ́@j[/ J?u6W+,Y_b‰<<74PtԷGPA%u!kEyRwa ; 򳃼Oǟg*g;=H~}wGo#?>^{GMyJX=]8`cuڗ^IFsѼq^?\]MzWzbT#@c0~ހ}n9hE$93q'`O +{sف .0+Y"Df QDO_va%F}Q!3?}}9K3y:I7O.;_>dUWL jObUXҐqeDb>Mg4Y?L8WVM|>,ͯ#}W}gϸy<)ތZk"ۈz_ל1k~t|>x+7$5Ds/6> 6/m^] `'|@0?uhB)_}섉U*h#t wNɞi2TX._fQr 0dP?8-"Lza(KT`61RpLzDW 4 þ:f} G mڝ }*,%}V܇]5''խdC.u%X ]>G0qH^,a%S $h0u 4KV9WQ@m \.[4oıS~Wʄr,aIBlJ(Z!28*^T#C\y;<}*@4rVCb+G s6X߮=jom[މy4˖g=D7ebz{a]9rA`ll (zk`ɾILA7Աc[J)5!&a͐ <u@*#!r%n:lr'n(>Mbl\!37Lmr3|UY]uogGU?owz@ؑ$l22,JeE\ ""YdGEAH$I֭|of~|SuΩ}yYMT%S L\#OMH~)pe}h DoWlDH{0`ha{1ts#m>. 0vǭjp& =1jQڇ 9h8qh)F)"h{Ro(@V9V`UpQ o-xH+Hy+*۫E!JPDhk}byE+ޣR%ﻇ^9ذRsG3MCm|N~hE,671k-+nd:1;sHioI1iHR/Oݲ!9v9rjgxqKjtV3}]T >߼_8.z|d4^\qiLr{óEoT;co|'-tݠxSpz[{2[HwjEjuKIx]Ti s*xk8$h:WaYKiM}$G~!RCbd* ڒ`F-k}Vls(0 N_N>ʹ45}^T$i<-jk$.9vL \QLq~uz1OBRvb~kv+t;ykMZRɷt÷t|vB6>:m٥bd0hu)v-v)SXAwD1M)cX P4Dš> -pк"ړc*7KƉVx oCgj|kwh3bwG bx'b/ֶcsK)7њ ( PcKV#ުq_A,RN.N!^ zz6v\H_WL_J_7dpʋ:qrd  _uȕir:=~\}9DV9;5k9}bRNk4Ky`#- :`] mZh]- :Kke$[)}@2HXF2JB Xh\_rRnBnyayo}I|~Ⱥ @[$T׺:}Sv7&GSMW<+̱>16}Ukw`h{!߀.ghNEDy(  ? @M~v}Iqʈ)Zv"")/˵\TPjEc^u'jE-_~=XqOZTfV߿7#]]e G}y8SpVhO%X;E1w| [|&0s3RgPG/u]p=܍/Dm>G+O 6sC$QaPav|i5dl 587#$r\>WxIH^歒V(=>cSĄx٦imZzFVaVaݱa_Ï^;WG\k,Nwknz]v:94Trp6ȝdpךKc>r**UD^s\3 w>4;$r>SW4|sJNyi7L̆)"R43Iah" O(&ᴕP?hsc!M85b0,ffKz㍜D6KU{wVE9R5U?V M{6Ui2]I*,[Vܝ)q֬-{1[<]<:}ֲKt^FX '4=eZ+]TY;n՚&j?,[Md9墖 |W ?j$w*l(q"w!|e kRbIFCXs9֘P{ S{3NFv6?An~p݋3(6Dycm ɋG̨q#t|8UEqt07il  I0Ok"CQ<w)ikɃ%ds˕0|Ժ=|c|O + \Ku|Hw*l  @Mt1Fvf'8x@hޭ;>[ћ[lH+bA9[4>6akfٛ׋[rv{R# E{449[SK =ꯃ}$6!eoGV mfysѾ>Hr >vhE2)XL7 eeDZ8h8`76?>P' ± E#F `r@]#mإA)Mktv|;+_2s~ٱf*(BGO!FdIZ0~1xbs%{+_R eT{vG&ׯ%WF5n80myk*7]; }x *utRH$JSIᮐn:tX$H% PSRk,=3ckWF\=3f>my@Zb/P%ׯӪaS-6嬭T0|29l]@`aHj`Y|`ҐP4(\?0ε iQmОGK>:œCrqMo?N:װ܆$c" 0 t!‹dSt]m. /X;yu,mp/bx~6M,q5ț]z-2kW9aЙ3HCAmoF)"Po]̬uZ*u|(dwI뤣<Ⱦ||eIbx{)$&-u$<<W W @> '+᱔f=^#oMG$gH/8_<[bQ~ust:;a7aSJ_T]rzИ%Ne}ocg1[U,KV(|c?:t?kl/KjqpБ"I$8H$Z?̠)wg, pG{Bq*b'e1sYDS m:no5;-)P.9d vIڥ?b6 F߫9& TV-KOT6ck,D7OӖE՘"ei!16S놽S\* @ %H1솇0غy|`V֗QZlL:~]ܧNhc0DOv>CaSAxylx<# y"ʂ.˲-2@*mK̎5c:\H /GGmjˠ0+7``xFl uNxpL{Vn`$Q3dIZdO b߷g ]zn8[IvoǚQsRE'yk3+OUmVRHsS&LL~R v3R•?+[JE AkοX O&1{I8;,i!c\\̦5{ &LQj2ϮǧUgwph`66"~oo&|RrRY90Yb}}K*RsH$;uԹ &)<{##'y/ǿt\IE􉗒1d;l\0׹!s8xtk4۠0Q݉ѹ@i[w ]8Tfuˆ @(AC*; ڙ;rWuG+_}/ߣv—nޑ{;b׬ǮYj~p4~,I?^<6qZ]&*;픍].f]}u7Bdz@sC'دnpDAOPH$sZ9c(|KK&;ѠжމF!K@߰ `",|e#w7;e>zPo'trNO@g+k4;Bv[Ju&;" O 3Lrl bkJDY)k[cۮK%95Nj| \m3jIMP%,,#dz.dQBUذ0\sn{cx|vIHj~0# ر1Ao'Ϫ%mxe;ž`g7 uwlM%Tqp ^:FZAqFRQe=_6h2b J/Ga~9Qw G;p.QWk 4EnU΃._>sbȺ䐵9)d]y|nt >ŞռKMjg/EĀ>\mH_\<`n6~ 'ׯ+U (!7rD0PGRb  9Ȭ`B{h+&T׺>mZLhQu&K=YI.GUеŰ(XVM w}?I3sOƦꨦSL] 607rbgSVja<\C^O4YyTʠ@åN}ytf@\[eQ4,28a=6fFYAPP# ]P:Tޢ>;tP=O޸ Nuq6%~vގڤ-7gن`ddʚ؏BPZ)ڦ5(ݨ xI=>t=<8% Ka#{i9*:V;iវC ϒD@lJNTjpG;BCO&I%a/dO ` \r1eހ@}뽗ı3^I9 B>.NDAٔAI~:1q  SH- m-pPy&Iq4SӜ|$=y;QA* cܷ0oSH-yca&~}w"h˨%;iI|4y`e.(Y>1G#Ġ`9)~[7!4}C1"l3SFƳTŀmR$og2KLgp.V 7vPS@ Ar~bDl~ܽBh Ju9N/69ِц;];R~}}&TֲR[/|RfR#o(-OKTc]Elzp&RHp >JvvFA ۶"(g4| zK4p@|*Ys3@\k- 6[LMQ'xW}OjKS&WH`1;{nU6tEeR@+U\ t [3&ɧm"Py(BsXj4TD V #ޤZ3GwB",//>KM ;Bw4, ;I{߫|CH^$ED&̲BRYw.Y+]ԄX,xJWШ4^N~"ʻވ M/8Wf8\F/':#K}8Piw/DR+ץ K1$7 a Xa j  긓 ,PHR]k;!_mN _!HSsy\8wc/.|$%YK/(яf.k5(Y L3ppE/`q~!JrzaikDnݒ ]q6-0Ï!q`2sEo"HHB1pH(a%1(q6ܸÜg/m.) 5glƔQJQ\PΔdEa(Vuo{>vţi|{\y6hRO54 @a jޔ1w᎔<x IDAT*CY&\78 j'?!حOM'4rRDh2"h2&-Hp(‚c!iQ_IY~!*嬨{Sϰo bߦ{I倎\!־bH4I\xҤ؇s3m2,!C2S[ݼK$F'h g6Kd[ J?`IeC/;1( Z.%Τsw&ߙp~FS?bJxRcgNjC>}Eqn6*țQ'Z:r ,<(Y3@=x!sVhcABjRCh@΂ck7rߣf5*d՗PXwzB pUtl(1`Jb,+މp,Vi9a.5/zMY&je.~O Y[oP,ZTh݌فZ @+PKK|)v?@u}ۓ v@x\EFw56Rg9"/ 7C*xc;4m@>T,s]Z9>B/0hn87V ȕmgDG*gjD 5]q_9OZ]ґ +|F1K5  C#NCE_[tR5$Zt,Zl, 6Q]mkSF?_C= E |s1Z'ucv<%2@C ԇ9{>jG4䬸0UcšGO1HƺhP+daYNkVbsԛStʨMVpEڲQՙߟӇ& >0):N(SiU; %zU4^ +L3IV=Ӫَ/oc_Tu "$6}0&娰'RmfZek)=w|큼 Smpupg'NoO<}=x7d%r<\1\ivu_Ԅײ-wM%;{-Uwӊ(w^&/lӃ8L>d80CC>%hb Y f\? rc-.M)='U04g! bɋ-9gb!@.{` յegE, l}L#. -~/ei~pìA_5( -2|pӹ@׉ke"tͻ#k7,ׂb X7w0}Fϴ -αs# "?Jz}.=2_"qJԋ96"hzڲM@P =:m5J{UHHAF?sb_(v>M@@`^VQj[ƞ[,rayq@!H@W; 'rDjx6٩m-pw `O DΑͶI$4QReɿ(BZF.#-ŮadN*r=,uL%TGԌ$+(#hge/3}y4eg4ipEz]^L(aEj'ScqK}݊~>D_E+u%UɮђON"{;eg$4l Ҡ+@JgtH$a3KmHq`,_C1=V2bD9@heRM]TxVXJTĦߚȿ7dWK]Sj 0&ں#~dKZ &ޅ[<# VtZ@m'gX{ڌݚ#Z ðJ׻\r̾2ks :\q }'dD%GF|nf+q!8gLz7=2S[GSu45s$$s*tdZ[{ָ0tVLX"fk)?'0\n.`8I:,:;A}9iɱFk^?=R%HIѝV'BGŅ)42O @K+9i\]||K|HJ/@V4~COBck'oCˢ.x@u8-,6g4PdBcŤcW=8 ؘ+ig5M*oEԜN",upu=s^Ym'iSt §:$YVIG<3\%uߊDkY;vS3Z{t F5:K{ykȕiӎ] xpv],޿qK w[Oe_xW)vO~?at H͹}aKT-e崡]K[Bc$F_̵煘R1w8nP#stńKWECKP阣ʦw )sǚo?a nx*]ݲanyz;/'pot:_Ukv:Tf:ڥ_}֩ivSv͕v?ukw[mn6)Q*L9 MY8kТͰ{`$~]Z/k,-7YWUTVAh=HUm{&]jֶbta׶Ȫf>2gS5_, 0o?7XuT$6+WX`ٴKL(SpS j lU߻ߝ&ʾ=+GSg&+m:\݉ѓ%^05@̔v3/VFnG9)8wd50%Vl} V4̈v~^umQT Ug(ۛbbc "WU̯\ibg-azABKx""2ѧ >xC!r[`"+#MY~̝|IP&sJH_~ɨ@RҎaMx,?mߑe|,JЎ ªk4-%S3r^;C.[ .%gPBqϒ5A`_k _-ZXS AisL/^(Cuu5+rRwRy -<QF2Ļdy~ [RmʶrS,3|s@h;LADuI97Ssm^~cYkRov^)>"?7yN*q*Gy5䳏N;&-jD>aTXܶF BtxEJ9'RU27M4OxX2gyy14W uҪ5\>@ҋ41\Y+-/䜱(hM7UdpmsN+ 3v-QV*/3u k4H=-[}NL/2KBq>:NOw)+WTw?|sXnVe`^Kѻ>;3 &I:0 Aj)8 bJNL<9jk(U[vX#Y -nBMZɉx$:'~>q2R_ceQi@o99)۶I7D[@%x) Sל̦slp5&+`(h  WR @KG*n澃/UPc9zߢ׳} 8b pVÈNޟkf@͕Ư?/B_t =AR1!^xĞCgSvEB<0Iu*+8t?O%ق rw+Bynpr5AY&ׯd,Ø6@jA#7n&[+bmƂ, 5-ƔGMn{Bq:K9(14F`8".~'m>oӪ/wK%)V3 ɥȓ =ETC75#5# WTFRG5p7<֛]‹pQw>s,|;e7ޕϠB %3R|3mGʜ GL9mϿravm}8M #m$Dpg\)fqww<-MM=7Y G+e,iF\=K*9 aLs _EM&ׯO_7\._S^6_FQψ^Z6~c[j+t_kyԞ$SW2z]G_锾R8ȴp˯b]T=#W xzA.6QD7.G\!/&c#XԽ6Ez?ShQeqڜ*tSU:0󲯇8V=0m\xzfڛvޚ O'|[^Lژ}} Y?GX*K-/B"kXv&TiV zF~%.ߦåM9aܚgC q;XKkj()D[|eMk}/֟`Ưa$yeC0A9k<]C9V&q\r.VK*UiI%Q~so?=9m[R@[hpe,GYTKS72Gݲa|x2`Q;݋BN~݁9g%ӉFu 1 5w|[;yi$TUZ{\TSSf\fdzN$uewA Wi5߾]LeW7t?|n k]56&} DV"pzgԡ| ]^Bc"Qg[kMow?x wtq乤n#|.Ě};L> kإՊK:OU3v;K -&@"q@7o^cm7IzϞV>}c1✘4}W2Lf,c)-=?9%ΞriYVp8cJf.;14.35?ϥOWrcvםEΊ/00v !!qQiAiNfxGd;WuMܑ bRwlhZ9ڹPbB_{?b} ??\~vi Du>7k[vt}o ;kᙑԃ5"l 4sTߙ [2>}. g%06P)Ya;u[&)y:Nd}9KCB]puS4n,hye5Wu_~)1C(F߸}1Y ulr$xZ۳'2f?w4zzgOlj=ݒC VSPH7/=#ƴ'seY}Iմ3"ѧO};+뚻GG!_nXp爦:h}?Oh{g%e2V j ۩ps,i jO8-*uވ<\)$-=fᱠ$&sCkw[6r̦WOĝfS,絡c#8gLil0k^hsj* y9rpA9ec9XE+ݟm, M˄sii`Cv1QE#bꫛբ?7 74sϕܐs@0AC_ߐe֧Q1odڰ]AGCE1moݞ_ׄ~~_(>[e6V ]_& o/2ƆG>Qb`a-<>&U:reOQ;9UGhj  x⎤uQ^|a#q}G 0^{5..p ʵ1ӴS;kqMLSK\VRޛ,f$y nofdkkΐe"3BnT);%X-3k _H BPu`*l@ݕQg:ۃ|iԝ>Z `RdooNJdDyQ:dH5{&<>P`ī[} ;UV+ϙ'c6#|l]4luo?:%xٓ- =+cb _滂Or83 3N2IDAT$qUwMfw#}V9'!%mgDOVɅ sN9RFB6FӁǽ?1}+W7@zG)#긥4r(P7,EzQ%&RgR-HZ2?fuSFTv_DdßI_F\ZV{0)ȾAT-G HK8@j/j`9.ZErTh|:LGJܙ58/f>?T >µ9<#4yBYW-N0B7Í#%d (4YFyw>`ǒ Ge^Fue=CΓk#^I[oxCЖ^Q$֟:EPTy]|"ܯK3_Hhq \>LwC[UA*@%JiF?IOa:gzt18CTeǙ4+X3԰U (y.m^*nE)?D_{Wqw!$e m1ǵsLIpX_MfNjⴙ&tϤN\7J'vIlM8DI)^xxK>B/9OH{ߵ~ E7OJzMpP)o\P)Нeu:ﺇtȠwM\ ɝufYsT;LʐAӒ:K΅˻Sǝ_0tTn|6i=' Q `apA+Z+z>wg~STOFjS+\KMB*63~#:(oAzqe&-c|5PM.YZqPLH[/ *- s|kq?ڌo,ze-& sdCY2Ag@ں XTk,%޿+g煶NWVofYpTAnꤣwY`4Z%dݣf;sIƒn8g6F)۴Pf2et2*oկ-}gYsI(I`%V҇ ^A"h@* l:!`O^ DR n;)&[W=Wt/[w9yΜwûT@f@ݠ:AGF#w͞fC^{4-xEj+L\J gTmuic4s9w;kkr-6TŹ=f4WAuZ/hK+{2^+!gȓiPP@y&u=$wcgzi73 zh˃޴4Е?vVfx&e* GWͯ޵h$\?O4xh`Y-t\,]|?_=&evyI6i F6g[}ai8҈϶폝CIԉ-P&e\.KWdppllsօ[Qj`2X,'3tb" hbh=u;!YdmC7Z6 @% iPO6{6Y^܅Jy4l8@/6˺*P h3_wBj4o5wu]/;_^Ż'ʟˋok<]{^(ەKsXɷ_n]6nXOCHO WnPYpZqP0JÖ=O詔9ynmsx'ֹ\qh](ڕ/ī' h_&@e6j+=w Q:'Ynj ʠ2j@mj+uZqPL7- 므@Æx&@2=.{'Y՟hĴՓVva@Lw]NgdžIgF#@ -_neS}Ǿ>I>hISZ,efy;#5Is= ݨt8އ 8q1m6; z %z5Ţhd()Λ8 YSiiW^<`p@xm5s5$2+Ţ (3mPDDig s%qe}Ӛ @DdSL@v 4⵱K Sr2ouIeo jy~{{SXCPgP,f#MCwL?rM'3rOZd:>VG=~eypYGjp<Y]㠋bH TCaK iF^`tt gϩ :o+15 }` >vɊr[ [ˮ$ qS'XTOܽ EC )A gNF5ж`q-n)+J(lv UZkUᛣc֊FG==K|K,]i5G&u#\,qsSSg b seg.GO[g[SyJwǢFj4rQnǢhHܽ] U1 teE~)(p] ٚt4ϻnsa^|U*I[iUCjPO%DE-f2`A)oC \ /#q~k` \PRPd^E #V6fϊDVOCvczfAqnam~6lj4R;kb Xl3[?bbњ@0MduUf@[vl>PO>f@I=$9 *{7t X\@0 se.G}Zu=pׄ㠁6]xiX ZA 6+h9XPAOjl O@c}&Sb3Ԅ-͖&c$!'C^mjJJo*o:1k6uߡj =}t9ë?Bjγ|"DM*3y Mf灈hfw}[;7xm[$hŌ< EqVFBW M#Fqa_M D%4^JA {N8 7j1{y4;G!m|^蚲餦G41qdcUվLDYn>V:5)OFe6u>[5b|G2gOrP$b97gԔܧ/_.~lMFgu[̄YPfv JC5 keSAt"~xti2^~馟y| ?Ţ>JN%@ %%@vRAEb X w܎4 #5/1蠋`E_ĆՀoFEb X!.iƳ\o̟B Z,Q}{~-}7^1n# {TLp1;:0斅=CbC2ۉ$~R,[3$D |ai!9"fl:_ufb Ƶ}W{ 4Plx<%,DiYEۙ̓N 1wHo{8a 3dD}_>}UQ\R)湷 Z,Zd~ED>ZQ+0"!PSJX|Z,Jkqlڷ Vt϶wrN]*_ % Sr`~,[j(K>kB]iivrnzvs=㨭p|p } _VTPCaz/*{z4CUMM``˰(,\,2ҫo Tfe]H؈7ZRݰ!doF{)n\(jt^spiV]f];{dWex*; RMFWRu.F4[kzrkճ֛sW%}?{& 4f lS/ M;|eSynѮ%;۾;?8%n05ZlV0/g9'X7G%^ZmߵF0(BǽWAoy|knd}7֍+ `s_mm_<֔5$ GYK?/W|]F#vLMg6 9(.(-[g-*IENDB`bumprace-1.5.4/data/gfx/racerd1.gif0000644000175000017500000000041511217461066013751 00000000000000GIF89a ,,,,SSSQQQRRR!Made with GIMP, dihlnB jh=ؼo0Gß1(ͣI򚄬a Ί[l|^ 8=ݼL  w% m&'+x& ,)G!;bumprace-1.5.4/data/gfx/racerc5.gif0000644000175000017500000000227311217461066013760 00000000000000GIF89aB*$:.$2&$F*,J*$J.,B&$6$2"*V24Z.4Z*,N"J&F&>&22*b6:2**bB266"nVLj>4r:4n24f24^6<>&$B"$2*&JL*4 $.ZTZTVLf\ndjl6>L&J\>T :L".&NTRTb\vl⒔¦:Jd2b*j>T*4 &:L:T.4*$.,FDRT:.<*>T6D" .6,:,B4B4~FL^>LBBT"&4, :4:,r6,j64j:DN2<:"$>"$2.v6,~:4z6"^>4n.4j&4b*4:$6b&,FZ24:&$6"!Made with GIMP,H*\ȰÇ#. `D (pA .XA D0a,\A~!*nyH#GId &? D2J+Wdie "]xA 0bƐ)c 4j~iт . ۸y'9t꠱.^BYG>p@'M-D @ "TС4@-b#H$M̈́VL=tI']xEC< (d (PC)C EH ) 8Ё* KUp+d C!+@ ) !&PF)T^;bumprace-1.5.4/data/gfx/laser6.png0000644000175000017500000000230011217461066013636 00000000000000PNG  IHDR (VkgAMA awIDATxEIe?\U5`-lXb5b.`؀m܃5Wf:/"Ⱥ{/~X'oӧ}A?qȤwdK-{88zh|q$c O2`*J`8:~'Mʈã{Oչ\qG p L1⺩jV!4"He.B)j3mEUt{^P rZsΓir=P qAq%.ZЍhy1#޴岬E yxYǓ8Ƀ' v'q Bc/8EBi:6 @k M!0d (IsN7iゃ;f|]EQ[* e8p7tլwBi}"\ I1<ڶ*@d<2ag\Z\,۝FCuu5{=1Zh[U꺪=qrWKb5 #C zT]z%+ ޓuɃPiIզ!r0.g/<\pJYȂ"I򎤔2QwҴ<{q'IarƒusB31UeQl.^-^ UYU)k H,m30߶UM-nkeSg<2cD^z8_l5:k@{`STI8M$~/X4zˢ4jmkըzZ V< DK& (#nf1;s^+K?@AB0CD4E 9$ Kjd(Q詒2JUpuظʕXXh¥ .^ #˗0];bumprace-1.5.4/data/gfx/fore7.png0000644000175000017500000000714411217461066013477 00000000000000PNG  IHDR((mgAMA aIDATxuXI%GV=s{ӣ'qUX˱LiN%0@z@̀fIųGhLyJ]5C B!y^8\L6vlvVt 'W*'MвYHf5^ @Y\dtrW Sun>C*t.p]%u4 kols@G!\M/,$UpD R O vaLU$ȓЛrtLQtKѪjXz (G.ð6c*L1uJyRuqPH)l6TéU.@^3M 3)I4I<.E!ib1)˛ FK)A) ee5 \s`1-V, VU$Leiթʹlx(hA*=\rE,ݴk/k @d1ˬSFA(˳íx `8667liUqeQFFvFwqT +H^DyfJ" QPvVjf7?n88MT֬mo8\7~6" *,DNle%0<ga( hŹ?_\]MxR2I]S i+odTo2m vmYfS- YSsM)s%b֤JT)IF5:J48z|,Wՙtp,]3H)AqlZT.@y^Z뮩(* æZo{@cPMLmV<4$}oU$L-YM8Yq1<2), Rg yDȫ7 pp7p,O*γ,\-~Sfu4N,|$ GKj:-$I, Cm7{9&tèzۻ1= rN^> OG_ygq7˲Л_HẸRP)a&!ϰ.8͚ހ2U" <{rtOF>̀˓[YsUVE7d C 6\(d.x+Qr~%+` cW Q]ӨT 6 ǫG84KybX b>?h%dAM7 p-Pdh̺&Uu)Sf"/+x8fI'i^-(TSen')`ꀭj`b HEBRt6/zV**΢Ha00"I,/Ύ~2~m{{uY*3]3jn pS6خfVM4Jyι1Rkuvs'_x8}|:=+2*]Nh)9q~lvqI(Mߧ`rmi`Q mduCWfkey4ǀ*%z04RND:8E̡)*+$DʂRXDL;F]NvuSEQ0FH8u8O? V- nh[npTô(tժ7APKPR( ǩoy{}woO^ ttZ,(xeOivGBdOSmXyƔA<񍁺 yNsGaZMy\ ώ󡸾/BFw}gkkwv$J4Z$ Tx9\2E4gᛷo/ >/(xE04J G&-c׈D>cLjn,_ւ`t|*,BRJTœcG T$P*u/g'Ϟ|чzg8E~c.L0! I)Ys5H{>( 0USA[QsP;Sx£J!# j>;ľR>_9p.fӌ'P(#H8pvnޅSw{@I! Jٵh(_;y<q#vꮳy;wvm̯?`j.A 篦@^I$sJY'" M4ZݞkZ_s>_]\<~tiڥ]wݽ."Mt9"$2*&j>LJ\FT >L","*b\ndzlֆΖ.F\6j*n BT*< "jt~|ڎڦ6RdVFBd&&b\flv|Ά2JT"Vd&4 zNLZ\Zdj^\&.4&FL>L .D~ZTNDNTBLJTvJT^JL>>D&,$6>D>D~6DR2,B.4F.<>*$6"$:"z246$2n*,V"$R$R&$>b64b24^.,BN64J*$J&$N*$:"$.:&$!Made with GIMP,H*\ȰÇ#2 @ 8 0h&P`BD 4l B! %L؀"*V`ᰅ0bȘA7TCG}HР-y&̞=|4tQD1j=`,#H$MT%LO*e]hIF'O(#R 1d )3 *"$P'AB)+!!B@K,"+2,-b-*8. 1L6!;bumprace-1.5.4/data/gfx/racerf7.gif0000644000175000017500000000202511217461066013760 00000000000000GIF89a""((e $$((..\ [&&**..44T##Y\_ --1166;;N&&7&&Z\`""d((i//~::~??{CCR66N::FHJd**i22o<<~CC~IIY99X>>[GG7..#DGIKM##o>>wJJ||U99WAAZII\QQ# % &K##M))P..J00|XXlTTo__tlldddhhh(=((?..A44C;;211555999===[[[___cccgggvvv =33-**000333666:::>>>]]]aaa+))---444777;;;???^^^bbbeeeqqq+++...111888mmm'''```jjj\\\fff<<4/Z/bHreukQ⽠e(m4˘3onm„iK|qUf]7 Ӱa6rʗv\2dРqr3ݺ(Tg[<:ҫ_{€.}7v .Á%=7!0"|"7 Zhb 3d"?!1Ha%Ñ3Py;A(5x#I֠ )dC(&UyeJjiÚ eAQDeiX8!_!E'zְ }⠃nJBj).h)F 'Zi>=HJG8ĭȮ<20< FК"IJ.LDDN<QD!TITlKXa"+-b͞k^aBĴf+ŷ` |o,.kq>/:[ps/̰CK2\W,1]-t0s̰[g̲@TOt˯N̳/ =dmDḾ;bumprace-1.5.4/data/gfx/racerf4.gif0000644000175000017500000000115411217461066013757 00000000000000GIF89a^^^,,,***fffeeebbb222000---mmmkkkiii888666444___ppprrrqqqooohhh>>><<<:::uuussslllCCCBBBAAA???xqqvvvTTTHHHGGGFFF{bbxggtjjollJJJMMMPPPWWWKKK{TTmRRw^^tee@==EEENNNRRR==RRWWwLL{UUy[[wbbthhA@@DDD**11;;GG\\[[[[]]{__**BBJJNNPPRRggpp-. 1188>>CCXXeeqqyBBwGG**00BBOO^^mmy99x==66CCRRy,,y00x44BBw%%w((w++Z$$uu!!u$$YsX!Made with GIMP,     !"#$%&'()%*+,"-./01234#56789:;<=>?@#ABCDEFGHIJKLMNOPQRSTd ,Zp%0aČ!SL(gФQEAmܼ#9s1)0cʜI&@;bumprace-1.5.4/data/gfx/racerc4.gif0000644000175000017500000000227311217461066013757 00000000000000GIF89a>*,:&F.,J*$N.,N*$B&$66"6&$*V64Z.,Z*,J"F&$>&.22*^:4^.,f.,b*,^&$V">:.&fB"66:"rNDn>4v64z64r.4v:<^2422.f>L:L,**" ^\fdrlʂƚ.R\2j|.nB\.D " "^\fdvtҊ֦2RdFJ:T&&fTz|>FTN\Rd &< F"$J24V.}(.O><ќP B B%kx,zIF 5rR$IPĄ ]sah&Khp |Pf-ԉ'(`' 5!CR * A[NP*lP)*tAD+ PHK `PF)T^;bumprace-1.5.4/data/gfx/racerf10.gif0000644000175000017500000000210711217461066014033 00000000000000GIF89acdq Nabcv((w''qn% HGab }33~22r""TDC_""a##@@??s''Q @^&&a((PPu//s,, <]**`,,bbv55X%%9\//_00vvu;;6[33]55uAAc??lHHvv]99{PPqMMlJJaDDlOOffeDDdLLfNNhPP_JJkUUttiicKKNCCdVVbUUi[[qccjZZuue]]NJJxrr|vvzzicc`XX___aaassswww|||eee^^^[[[]]]ooodddVVVXXXMMMnnnrrr}}}TTTIIIKKKvvvcccEEEGGGJJJlllqqqDDDFFFLLLtttzzzHHHxxxpppuuu///jjj000kkkmmmggg111222```!Made with GIMP,H*\ȰÇ 1! H`AE 8x! >` 6pP9 BAs &NH,Zxat 2fh*8r4ձG?1*d"F I&M<)TXh-[tLbƐ ܥ3hTQM.n#'r9tXDi @h>R7]r#D$DJ^^5U$ez/p;bumprace-1.5.4/data/gfx/1player.jpg0000644000175000017500000001112211217461066014015 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222d"?!1AQaq"#2T$RSUbcr0!1"AQaq2BR ?+F=Q FR[ խbLN-`*N\) 3X͇7E0q2Ew8Q3Z e8տ,:OGHZ" +X?A1e0) m xq_fo/'ά"D D!QVo,.tT#0pVV 2 +) QE^GTzǗsPYTO8*3Tg1<,Qq_fo/'ΡDM "*{9.: l8nxfo/'Πڊ,7ZąRqQLNBmmSuoV|:zpyTSFwTE,?|:I i&E^>SVFu y<=*r| E57~YY>u^I]ە^0D.X7r_^qpmu%[$b%7wu,P7 $Ȣ1 ѯ%rdɢHE2&ѱNl~9s5SҖݪXT{G4p1 ϰRHvp:hϫ~)N^ GukMNR_ƪ-&6IMۣov9gl RKN]$29؜ukZ7Go^jݢFhO]UJ` /Պ), wrIwiޮ蓶N^PR22/"ԈPI&bOMHIK|>4JrDMv]c.C,#sbIjE D# Vxmaʰ\4m\*r.un2m\:}u4PB8 -KLBE2{*Oi],6[%6`w03i&P|еZp?NQ\4F8[۟WʢE^"niH;Ll3뉿|o:g \3_K12? 3Í*}8E$V-9cǯ>T(ĀiqjM?]Ni*1e d{O&>M0Xi G`L2Jz?#ljN "˫.Y.qm5mHNadSymt4yoaػ];G g)Xca3ڶRd//$dQJ8$*;1c 9+ci%UQU'hm^F;acd2Ƚ GR-|Gu?韀*{;f8x̟*z-}B4f9Qw> Yjg+kgT8Eun>˳3f$9$mh93(X2OW[Y-`O/)1gu\Jl 8ih\R$Q5ڝn6Y+̯_!~vĸև]l(y3?Ԛ."2ETiz7 q4vq[{lQ vRmuj]bM? 9 83ΪPI$rO3Et@bxQEiXV7h:r-Y .b@J9*R/3O x#h{yLٷX0j-zD{DFq)?7?q%%Ig&;k O(QAELtKg)sLl{3K.ԩs[Gm%͓[&x[)wg)5,sF2&c)&IOo̝-}]9e mX> `[[pGa#wβֶ^]*rx:ɫZqH뵈lvg^X[dkO,5mʺKz[E@ @R ejBY e,@`g)|N#p SSR7\YnA5:Th1Yy0$G1S4AUWOUNB^6nYvbrYOEbbtEM66em3`bګ-s1멵獑ܐp]m'dp}鰹2 +d"oC_N/-_^[`4pyz)PP 1]zb 8ݰƎ*7<#ݭe8=G'ēELIlu-#c]qY-#,|i"+;(1~> lh^F UB<+6" l}Z ZXK`902=j7P$1 @Y?O0@{#XJrQLQD!EQQEBQEQD!EQQEBQEQD!EQQEBQEQD'bumprace-1.5.4/data/gfx/star3.gif0000644000175000017500000000047611217461066013473 00000000000000GIF89a```cccfffgggjjjkkkpppnnnlllhhhwwwyyytttmmmzzzјڲ!Made with GIMP,Q@pH,Ȥr) 0gq@ +0< @2+|XHQŒL(3RCO CyL!"Z#G$KA;bumprace-1.5.4/data/gfx/Makefile.in0000644000175000017500000002662211754254551014023 00000000000000# Makefile.in generated by automake 1.10.1 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ target_triplet = @target@ subdir = data/gfx DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/acinclude.m4 \ $(top_srcdir)/configure.in am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = SOURCES = DIST_SOURCES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = `echo $$p | sed -e 's|^.*/||'`; am__installdirs = "$(DESTDIR)$(gfxdir)" gfxDATA_INSTALL = $(INSTALL_DATA) DATA = $(gfx_DATA) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPPFLAGS = @CPPFLAGS@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EXEEXT = @EXEEXT@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MATHLIB = @MATHLIB@ MKDIR_P = @MKDIR_P@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ RANLIB = @RANLIB@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ ac_ct_CC = @ac_ct_CC@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target = @target@ target_alias = @target_alias@ target_cpu = @target_cpu@ target_os = @target_os@ target_vendor = @target_vendor@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ gfxdir = $(datadir)/@PACKAGE@/gfx gfx_DATA = \ 1player.jpg completed.png racerc16.gif racerd7.gif racerf12.gif \ 2playercomp.jpg crashed.png racerc17.gif racerd8.gif racerf13.gif \ 2playerteam.jpg explosion1.gif racerc18.gif racerd9.gif racerf14.gif \ fore1.png racerc2.gif racerd_big.gif racerf15.gif \ back2.jpg fore11.gif racerc3.gif racere1.gif racerf16.gif \ cannon1.jpg fore12.gif racerc4.gif racere10.gif racerf17.gif \ cannon10.jpg fore13.gif racerc5.gif racere11.gif racerf18.gif \ cannon11.jpg fore14.gif racerc6.gif racere12.gif racerf2.gif \ cannon12.jpg fore15.gif racerc7.gif racere13.gif racerf3.gif \ cannon13.jpg fore16.gif racerc8.gif racere14.gif racerf4.gif \ cannon14.jpg fore2.png racerc9.gif racere15.gif racerf5.gif \ cannon15.jpg fore3.png racerd1.gif racere16.gif racerf6.gif \ cannon16.jpg fore4.png racerd10.gif racere17.gif racerf7.gif \ cannon17.jpg fore5.png racerd11.gif racere18.gif racerf8.gif \ cannon18.jpg fore6.png racerd12.gif racere2.gif racerf9.gif \ cannon19.jpg fore7.png racerd13.gif racere3.gif racerf_big.gif \ cannon2.jpg quit.jpg racerd14.gif racere4.gif select.gif \ cannon20.jpg racer_big.gif racerd15.gif racere5.gif selectp1.jpg \ cannon21.jpg racerb_big.gif racerd16.gif racere6.gif selectp2.jpg \ cannon3.jpg racerc1.gif racerd17.gif racere7.gif star1.gif \ cannon4.jpg racerc10.gif racerd18.gif racere8.gif star2.gif \ cannon5.jpg racerc11.gif racerd2.gif racere9.gif star3.gif \ cannon6.jpg racerc12.gif racerd3.gif racere_big.gif star4.gif \ cannon7.jpg racerc13.gif racerd4.gif racerf1.gif star5.gif \ cannon8.jpg racerc14.gif racerd5.gif racerf10.gif timeout.png \ cannon9.jpg racerc15.gif racerd6.gif racerf11.gif title.gif \ font.png highscore.png fore8.png\ laser1.png laser3.png laser5.png laser7.png laser9.png \ laser2.png laser4.png laser6.png laser8.png EXTRA_DIST = $(gfx_DATA) all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu data/gfx/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --gnu data/gfx/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh install-gfxDATA: $(gfx_DATA) @$(NORMAL_INSTALL) test -z "$(gfxdir)" || $(MKDIR_P) "$(DESTDIR)$(gfxdir)" @list='$(gfx_DATA)'; for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ f=$(am__strip_dir) \ echo " $(gfxDATA_INSTALL) '$$d$$p' '$(DESTDIR)$(gfxdir)/$$f'"; \ $(gfxDATA_INSTALL) "$$d$$p" "$(DESTDIR)$(gfxdir)/$$f"; \ done uninstall-gfxDATA: @$(NORMAL_UNINSTALL) @list='$(gfx_DATA)'; for p in $$list; do \ f=$(am__strip_dir) \ echo " rm -f '$(DESTDIR)$(gfxdir)/$$f'"; \ rm -f "$(DESTDIR)$(gfxdir)/$$f"; \ done tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile $(DATA) installdirs: for dir in "$(DESTDIR)$(gfxdir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-gfxDATA install-dvi: install-dvi-am install-exec-am: install-html: install-html-am install-info: install-info-am install-man: install-pdf: install-pdf-am install-ps: install-ps-am installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-gfxDATA .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic distclean \ distclean-generic distdir dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-dvi \ install-dvi-am install-exec install-exec-am install-gfxDATA \ install-html install-html-am install-info install-info-am \ install-man install-pdf install-pdf-am install-ps \ install-ps-am install-strip installcheck installcheck-am \ installdirs maintainer-clean maintainer-clean-generic \ mostlyclean mostlyclean-generic pdf pdf-am ps ps-am uninstall \ uninstall-am uninstall-gfxDATA # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: bumprace-1.5.4/data/gfx/racerc12.gif0000644000175000017500000000230511217461066014032 00000000000000GIF89a:&$>*,.&$B*$R2,F"$J*$226F.R64V.,R",Z.,J$B"F&F rr^^:4Z*,j24n.,V"$V&$J"$J"J Z  zbb>4v:D>Dr6D2D JLNTFDvJTV>DB>D"&4 .2"~JD:<~2"$>2r64n.4f*,:*V2,b64BN&$62J2,N.,J&B&$6*$B.,2"$!Made with GIMP,H*\ȰÇ#* `D 8`A 4&PP  j BA#Hb.C 5l4#;x Ǐ@"F Id M<%STb ,ZpQ¤/PYF2e̜AF6mܼGΜtع'={@Y8B!Jh֌5$g1Hy)I%K 1eҴiNԙ|Z9oX ݊QJ:jI*PܬrR+GKq,C,)2+x@ r .p.+.Hp // Kl0"0T"1P1ǼH,B^2$JʀXf\v;bumprace-1.5.4/data/gfx/cannon17.jpg0000644000175000017500000000242011217461066014065 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':U.o`=v Xe# [qan4 bȷ^ml|*]FaDaOOsx۽,B6$g{8L swF[ x\18'4UXɴ˚V Yb h%0##Etv:G~ YiP|ϧˁN[# 9|X;ey#+""e˝8 N*GT-)CZ~#g> xBG$ $c`<# ʉsg:d,P0vpxZg/%ӴE.2lR[ mrN3q$4rvq=8g֢*iٻ1JPp+}tȲ.acn;E9@' &J}>m(`dv@HHuUKpNaI]8PN㭒 QH,cY*dvȒhy~\oEbk?-3W~PQEKzӊ?bumprace-1.5.4/data/gfx/laser7.png0000644000175000017500000000227011217461066013645 00000000000000PNG  IHDR (VkgAMA aoIDATxMnUE=ުG?hwX%(L` #!1>/@ $ďBq]U0C-jO~~~}$ܡDiDdggNT]N9ڽ@Yoc׵ }lV]RE&ZgE^NN^3t&cXaQm,-@J[D"k%ya60yZsӶb&XEPO{`q ւ$"^imlHj<ʀOG?QI0r4flj;$&9 Drg\GY [p2!8ZMzr-xyhEY>BHJMR?3|H5@ L"c蜵hL@*bkH@h.Cޒu\N.%./Ο{@vZm@mY:% IUx @X//mVצy7M8|3 p /*2a1gGIzsE +*,/N;Km?v@8qYGJIAeo;h0fAPZ crLIENDB`bumprace-1.5.4/data/gfx/completed.png0000644000175000017500000025753411217461066014443 00000000000000PNG  IHDRa SgAMA a IDATxiy;˻4Ѝΐ.)Z-)ClKũ|KYJJ (*%NDKrɢDIqfshu0HSu 3=,swJT0I McZ'"lQܱ}["@86h܊t]~diJ6c^C!q)aH={[pe;56Ey\| &X<Yۇx%[$QBh"|UJvbo6Q:NF{i qL6^j/' hT:F/6iZn5rU= T,+8HA@ECMt[2:B)T%d5 5sj˾WjԡמEhRkd!^[;p]m[)Ihc~("Z^^̲?t) ,шe}۲lm"dg3nGش|j5Rd)N#R ZpW) 6~rI{wjƫ1:DI|IC++J &k؏_*Ȫj"*S>OѓoG&c$A7SSWbڣ'X]/uR1z6i8aǔnPPntCr&io;L-,P민lbb8agQt((h):qh%":.'f"[Baڛ]?P:^>!&l?A侣u[d[rZ<Ļ!O]!;F2sMZtjkxvEz*R {vv {?Joòaq,_j#&lwȇ}ғ5m6YZ CY)pxU"k.ϩ٢@h:iwXQtS|[,658_o=+n1q@ N{洚![q/nhW)))*]2Fc4y~<Q9J]8EJn DNʚ$ըMOZ\dB NšBȰǨIppݧ>sKhĭ5pA"{${ 4>Aq?|oe̥ZZ" #mym|<Ɲ4v[-Dn X>e)zB,Bl+)!^٥wO]O݇Ӿ6/{(' * &{LTt=𲃳yNj_ RLزw6,z= h+vzY"'eИ8[SYj 4wykaM tpyum^$I{e1[} I)$&Yr;RApG.ZO t.^Y*t'2OZ߷WT4f$Svǐvϒ?A1ËO ?FH!jSW͉}X\I\!w$! ]ӕi[iҔÇ"̌r5¢$Pe㶺lN3E#<7(sHhB; XmetG qM~\.?x47!֒1Aucpw1/2LcCRQTеuyvTu\Ry<: Tkcd#IKr"h,kv[I [[(hQ !G2MxL^ԓԎ {opÝ^Z8Hh82(|/oX W8c :KKΝ۳mQGիtvag@D.U ]Ct8ٿ1$Iڭo`!`#hLaq~lPBΠCXs )N!l<#ج\>xq|p֛ov:;p!m#iLURS3֨pŤ mChoSe{3I& 4Fa-e/^ܨ2;ƛ=Lr^{v*BLQHYxyb9N&.^sBW$z]M{q*XUCvS) +%F ) -C>p]'ivsvNne߄alqZ],K33DgJ\x`n^$ڌG0aAc#<)Y3yos'O18 : /\{{^H*`} "=|7,^ZB]8%r7T{lq{?8pl8 Amz^7;LZq\|ndXKe͍/ʢd$.,fC]ֵ¾wOɆ+UO'ׯT|IS6x?`UzfSCvU !Ҙ(@^* +5ʯUH`YP9e"rH*ڻ7˞y, ȇc2ssqMLJղ[ȟ`-^@e6`ϕ[%^A6^oe%5Ǚ%^hkxtwFʌt;tdk !D3\Oш"eNG:^D(M8# 鳽r\\G{ ff9r?O+g"nEY;/X\":vJϾG0yr5E1E"F&N;eѳ l0{|"'> β‹;:g:s5)ǻ^06?[g {EdiLzS\qk x2>SGQ %iz/pS)+H!Fj׮W y`-CWA՜ovu$3a/}ٖ`Qn }Qhek AÐ4Rs%i83CA>zjxnΣ[h-Q8>&Hũ5F;QAغl~Urs;uaGE}nCZ 7 W؏E#8A=# Z!JDѧU$̳!(mv> IDAT&l#Fzhn]C.LEӘBMZ7ɳ[J%V|E1FK!tȣ+xRݹһP DxkP~U d顧nDhmBHʒ~uvE* w"(Z2[g/"cGǎ :5)(8p9&B*qE?A@{>S0X8)3h8 kvY|0M&hM@q<~"$נ ክ7 pPHQ 1O֔xyygɞξ.`t^I1t.^`H U $$E`ќypGW]qej5$.[]S +ѕCx/HK~f=&#$57\|饪|REuqwi41ԫvG.E;iZLsL.plR~N[^0Ġ¢ #h8mԜ5q*ԁ#Ҝ`Οc4N}rѷj(M7pҚcr'z.!MN6q*4aK٤Bmcs?>y)z}^tsPj"߬ɥSJ?x~k`Y"(- fN1\YuЫ>:m~Fr1GPFPܕrlEk6agqM<(l_ms[-F9]Lz+)?EG#֎a"5k#yp\y}:x26B3BXk[K">ѵ Oψ}g慒gqBe fK<^kl00sx~g׈vsbMR!. ~KYht\ʴڳLqSt%`0%#1;Dȇ$O!iϷ\ ?Ey0JnV@:q-ӦQ;f?dm{Jf$cY9xh}ҹ]ګڙF ?(jxl6籶I:X!hD99FnO7H/Eg=њYEɢtf3qvpp]JkIlL#u6GӸ+قs,E8!PGk@+7LF(%FAx[41`?rt^b%Pfm,_Zz.6_3D>lWew.}Z)EԴ4IR/=+0%bG:ޏWQi6Couj[[0y7'H1An]t%c`wK<,cs@40Mդ1=2( R5BVFLa7[^Fk&dz7A)Qp<0_ܯmz"~)UG*_"L:Aq)~5%kGՊ5h/)'QzK ➔ "}*gR>_ygqkdNdC0pEZxѝ-0Cr0Q䯃З]HQ"=MD(A>l}HCB}ZI\yK_Ś$Z[L}l,h:YQvxZ}?3:%g0Nz >hLO+?UX x;iXO0x5_}@ol譮/C.)}P~UM$68B2hT)FJm4|`?z(="_y9ly,~ t(M![s&zEJ9Eiɚ~i<$;S5DbɒsUYXc`ŀZ$h%SUzLV HAa@甩d~2 /~1=M|g*[G?~?rp݇ =$_\oJKsMuM^ʿ _ _y"BOy_uK@ôB"o/G2Mh- ^Mhx!4f<0UFHo4L cP]:&TAtEYgQ,R*媤3z`>9r*RȄv=,=cF]֐&H5%B\+~ԃ(Iᚰ-h?N6N)q 䣕]k~;BSHi CHM>pjîk 6Qv}S݆'(&dp_F:19L)@"­ts/"N=`6a#l8~l:`@G!1y)>X5/iٝ[,7.~ʣdÐ"q2o.aËd)WI#6c}OG߫_z}6O/?>},G [,]~eE% KXVO*y4֟Ϣ}|s5 Fdk:jb-&QT|"]T3 3-DUSg+d~E3S,1+eyq%Fa?{!rŅ8˼7ubm'N.//GO?GTZSpH}"zZa[Ab!nmm`hǷ{d쾇b~\˛4|H^'qu:ssc=xP]_٠|k,:D^&a.n *}vsHFm%[^1`(BK $ $77JbB1 `"ے%kFNouA2}yc3~MZJKO7|.Y; ڛygY#Ӓx7M)ޔHŒ?ykd`?;tv\ܼG>uPecG. sl؍pz(k1(5%d'ۤwQ)A˪1syxUŅ ƅ$Emlrk|_"UJlSƎ;P"c`K *4R_+5efRTH B5ˊMt0qr1 S`:FT^"% 9J $%W*P5 ‰!rKG3 RzQ Ck+G{'ER^1Ns0Ơ8+sѵv=:"IN1gL05j?9&h>qpcvaxc<:I!ANGv(^.ë4_lȠܰIp"Qͽ"х1V"RM)WʐB@I #C,N^&PZ.r11;7/uSKI[U6B YQ׌)Yq~bMՍݟ)y5GoϜ NRQR \xV@U#tj:/.$UF@9qHh>Gtc˨*`lzHYVF"CjseI]0uUWXSu(f^PdQ>)~z}C7l:ܺ !@y7H32Ƶnwhc2;E2hX5_)C*|Lk;;M]-##12J*=aqQ^=V>~!1ҽq/?BUՋ>KQK06ᴍ7lXE3._ x _1Lkk&"P/:7TYޥ@XH6 hLw\bEƞU1a"?TZ䋭rHvb~Ձj6v=W4D+\/|W7b՝tM{EK?~sz)Wgꨗ4R-Aq!ݶR+F-,:= n;9!l1[PYS  lوlnfPCV )Y){F4Z ȖhzrF̎N?7n< /[56uy 0Dz DѴ> NJ-m 8gPz4D, 'm">Z*Ho-9^!?寭>4ukR,/WB.uMݒfw_ rs|ws LUnzK]`+qlrid1SKj~ iKpint}͙pV\ۡ;쿍.epص:Z#6|R)3-ة&1A 2hBCuNA̓Ac[:"WEfZ /}h!rzqJfҐݽ|K 0 @HX WtF4C=Kiub@;4ki98sw'q{ s ˲`YLӄau)y7OPOJ3u(k T!  Y` BN^՗5U4")P,E(C@±˱WZ܃o߰8=]y_G_%SQ㏠Zȡ{ߍ @4+𼣭pKs-E"Kȵե&AiGyRYJ*gطF8ӄrv/XG.@@{U {W>YC)7 R0x$uknw\(vzɶ?y3ţp0"70xC0RHov a! ;4޽Vֈַ>a Cu/cr^o)JcLרS.m"z"pM<@ ח<^y)vmzjdφ-][_^GS(PUuūYN=2bo]sXZ֬xZ.N!E ;@bRO&E:#b!ƘrT.707yWx;EFPl¯BOf / C955#_s~㼣?H N&5 U7 Y (NDP+_ E.W`ܖh ,=3[kUjAJqe0ECan%AA[>xb/Dʅy`\+Ag8-ppH}jȻ/ۮmJFfm?w`~Wj R @,ãC|AχCTKǽs2n_G<\}M3UAcIK 셪8K(bhՁЗp+0=sU3boX?rE內I#;?(PA5ԧ_1دnhf׭F^air7", a8pp6s#<H pc`Ê  G/}"Nh-ivI}ѫQb>=ymҦWfE Ue ?1C;/ܹ ͎̰bO>c+wB~!yyf&\Jj@T&!^@CBH9 Ec` FĆp{Z bvS3_>G;Zې?zh^̀[%> ~@50M]=3Jq_猏Ow^InFMӥ >=;C/8+6/ˉ )u]U1)RP*pj)^ ¥ P`P\1D(|A`K._ QMn,W*3`4ZqH\. Wo?*iۮڣ|_$l>a+^a+SQm܆-AL80Ǚ! dBnz QVAv.JaMՈZ``G\U(`J]@6@pM s^zc],ӊ!ʼn d̜ ޺ǏS6jԨq\ `@4 H!|X[+Z ^i`Nڼ[MXP D*)$DgO@mٰ"Qn@X{ Ln᤻Q^j6M^c]`hreڙ,!k6="r U ,VO#cԟz꒖tF>s ò,D"qb1Dц$:prۓg{i H L g@Y@bmP>H)R5Lsdj}މ,)|kzZ_"=o^.5@0uf&zйv׬vOuB\ {c=u ! @!xy T i;V!֒kp*b DbH !}R @Q;Hߗ-w þGuP`X(Q;P=!k9TlSY7`ϟF! Y.(z텓T=-MsKPp=̤x EWr~L+)5'y]hY;3|i(ܿ yLB4IRW)}ҚZ٥W_J$NůGb0b/Ͷ6lKk@(Mf'tp%CJX a9;h^w#"aӾKo=s]g߻R -;d@4AZ uh_!p;vM #A㖑a̎amhXlnD">pʡh3"*GԤN fG( T 6"ٓ @]ˣN4@}ЈVKan'فXsi0C >ҡpKkF߰." KcCO;}wөf`VF8(;y}k֯foˏ0zQ@.FȥXvel I@46-q1" xCÒ(4Vҩ6U(.BMIU.kS2rrnZaw[L!rveqb@&ۏm`@>7[z1C LWyD _;j P P"L=P, qRi|ס+ Ek,L0""3@zj년5-"N-觿=k:'1@pzt />F/Rx?z"836++eqAѲ̡nPq^fA\@5=r Tc4}  WBM ];t'U[ºKA P[Wc"!(d`ZTVtSˌ5Gvvn'Cb3/ Pj/ZӼW,I!Pd*>tR8_(/DZ]}(/?cR26sԫXw-_̪"fz`@yχZ=wȪt7,zKyc?bVav=y^w=|ǣ/lü[O_הTdžn;;z S)&Uܜ }U[6l{yrSS5ݦŇ,8ǚ[^x:MGYsˉz(F֭ѭk1КA7?.jE^$I$BQJ,e\3O7\u MWl6!9nމjނ kSz@nr7HHN][y @Za8sE[!() 2vW5=bIn2nZ6 *A/;Fzgy>:YY" wvxy>sZQ(TKn~U: E'tٷ/GaEo[mp&r 5 B7z̘ [{tk1_\{Cy@Yג)uF6G[ J'+O]WRhxN>)rEvߡ^WP+D@ P98 nv|+~(P*m;/gi6|3ܸw~fȦD"\TS'N5+мuy~r&Ѵ_` IDATB@XPNXfTp%A5 )5PdZqמp}WOx]z +ϴ?Zv$zq('M\҅W_|sӤ/0>&+ec12KoXGom%+Q})h4n4_s}XUL\u|*MY--"uLй\?Wl_ov5 AWKB(i u^r9>WwsFڷum݈ &[wD?~'US54U_)QXէ`mCw߃uE{7IUט/_=ЕGowe1"~~vfz~ m]D LhasF/һ?&^[p~ퟟzjkYm,ݎ/k:1QcO%TK6b@7 b{ Y $"pb oZu)7=#a- odG1wٗ?rcӲ[-=B2%_ܰkg:7qS3@@/Àn)& yHIԋI(V@35( ğ|86e85a&#wdT#'JY"2\{^ ]B9B)-Q H NëUa'ޒ-YX,;݄bqh8/~=_}708JX)(IԙUk"+ZJ AJ5]A>G\mT|`RczT.F9*;qmН4DPd&\ݝrx nf>&Μj_^(LDj 4(X(UOn?/v9?N}QWm:p HxuH܂"1]!In"1ٹ(jm($Al5ztcocI5U|TЫEj/Z)y 2\,n $ݹ=ma4l YI2OZM"D`k:X_aoG_+bЕ2ya 5ž(U7W}7%# c VP4;e#pS~+'E_&o /Pt61q1uۇn3E>wuSR|Ǐ!= +ELcc_1Uښyһm+?wGs-ͷb\ %!Qf]kVX VEUm[w DM/3&^?鍝B쒫q-swްҴty{׵g *(eyws69bӹə{6) ?UgJ$c 5XmrYΝ=QKv\˧̳nF}1I/2;ׯQXs3=k+ܣ=}xەOWa9{rw"6M]ePI:vRGm 녚`?t7V1uv;WwuάTBs"Xi%P ۿqF4أZiO>/?яR;\NF "Hnفj  Bb͂ ?ԇyRT> )IL(.uYanz7c E@ $CG~W|̒-Hw/u]ƿ~zOnЯFY:XS;EHEgPf% D'ڍЫlzq @bfE҄IfLaXAe+^~݆yum69أݗJg?yǟ(U0:q_ӏ?c kkL{J!pKxhqSQ@Ġ+}!xȹsIԮ>%-*`Xo`HBˋʂzR إslH!&^~Y!ԫtR<5 Ucz4 준ךзw/7o_٨ab+EZԙ +l$A\ TCphn/k;~Cv\3B!Q:}t|!Ӂ\|z4r\NidFjڰ‚2ٯ]կ f"2ۚ e]S/3֣IT<;.kKAwtWV-B|T'䩞6}I&?)>z~?ǡRfّCٶ$jE@0uNxr -mm^E_7_|cLC޽8{EKTCl!!̏I5[qU"Atm݁0Ukس=t6lχr-M! o>9璿z덭2\! C%ovYUU4~S3G] W3S~DBTO[DN(L"DPSbF5,d!jчGlI4s ҇ޏS'˨|9)Lʷ.}/G)pqB07V`\E8e`l_˵x;݌TгE[2,:w ` A5 Aֵ,Xmà(4)4FzN$!ٚQǪXۣM\ׇNDpCĎKYj>V?_L@5߼ k[~M/R~A:3HSjիb0Jv+}>_Y ߞ m$]o?>9T9zVNU]FT9ܤnݻK_w# qG- h6UYق?~1:޴i??z`EV"(1L^{nʾ~u7ڛ2=MF¡,I8ץ/+ >;]z}mi2t|?62Y)];q3ʓ͉h(!Xލf;cӫ,9m-IT:,RQW]uuˮk]]E JP )>齽s/3I\׹&s?wogKؼHܹMFvy_=D1n ڤri3qI8kA f:/<8aOS'䷻f-M]s>q:!_HWk1})80q~a40gY̫ ~K[7j]q8Ҷmbͻ*emug.:T@ f:eHڹAEgKi:C}l&pm @_Pm7{[@w7s.Y;utHSrocܜ|R& g{U%ut4**0D!sx)0MtRLEp?NZA I&ێL%7uF0X/z{{ !Ou]=NPk9°/{c/j5׭4gG$)6zzq5Pe8+x%˖gWÃCXXHvծhN@0Huu5tB-_I+SYmR?>/S="vy&1:g:pCpdЁ r8"խ!<])`OP@O\Qek2Xܞ?b[E_{cdS)R+7"-i2νuՍW>J~[^0;ڳz?7 }J{ҥ Ş //>G_{(x|~K|1r]٦W~:egU]QVk|]}=2<˞1{}9gu7tBع۶0Mj|TQ v`Feyk-w:[]]UL66:5Be΁x6O[~l.)*F#(*.בztN_ RX:f8dRQTΈ(J֫V7 '(ӛ֖ۗiƒ̪?ƿ>ShiM2D"4Νʫn[_?'2M+0Ɔr΃ !d||UUq\8NarK8]ǥҳ{6ﴂɔT\.fsmld~N&HbH#0켋x)gU˞Ug+ohyZxL,US:2]WU2I <$Hfs xvv:0C&DګoP,"H`:CѲCz K @E]k.ラT A_2TW]{^7Ce i54Ιm9ˀn(/Z?]ͷ_6p(g`4`x|m߾#{vz"UPx+2pK oϴ`WcCx~BL5UEGupXH4K(m) n,ı)n-((n>jDZVCbs.+o**VϚ=],|ݣ ~nxIt>(Ƈ$b㢈}~B{Eg+{vlݙ:omڜmT??.VTst`^;??޵,E擋ÑJGGqՆFx ^8笔tZl<#/5wqSrkKiih 9K?<@Ȥ"E dKY+Y^)^x1g׮=:("ד\Ζ;lϿǏKV-XTvMW{¢m-l~x"'I7 TV?ztg">:|F?˃( l^+n ?PgЄ2BQaM9:#9gBu{LF " F 0PtEs ͹B>!gRCqkm]O|X=6}򐍕#z<c?7¥\~mnG%X2uyhan3bhBl0M`e5]Si,%U)mGŁm[D vuLEr( #]B墳5A7T27H /D,[վs /='Zox֦( D-?́wRnwwe60%'ƾyKHrl93o7M4]4yt"TyLbv]~~7+2F(9 w#Ȁi:./!*V%fqmc1 ڳm#c'˝M"U,&"a/RRZm]P$́3 Ga۶qPHf QTt`(2ӛpϹgOo>q''ڝڪsɧ?-?S{;x+z28M1(d {鬺z;﨨Vgy=} +םnjP5ςt1N8Ξ6ѲCN>HG;mMPt9.26O>?޸0b*Pg;>_-'r^siZ/?փSs'9:m[x;?b~4mNħ}{!yZӼCewvlmٳtOLf,3Xp?xu҉xIn fܷ-\}vgfا/\YWhnUc$΂v)ԈD4L},+P6%%ټ-z>G9ifJmIU6'wnxc | 86~# IDAT.Z6ܛCQ7c ?2>xǶ5PŊ޽Hwe ˋL&8Z8*wŸ(GGm'o{?qs]ě烗MowML,}Sfw_-[S\vx";&fm5zfS^ w:y[?j>\5L]gK/pt=g}D|:Il=;K:TW BVR|F-+ʤH- BUbxH;c[Q@Dk8S:N.Wh 1<`[+O*_M>7cUxcby᫨}GsW/ǹ1@*Exnoο;Y.~dpTʃ ElH[vkC?]homڲ;[zfVD׿%oY#& dRS4MsBny\zEWY"_u9݉eY/4K{\ *¶HtsW /WC7w*K& =\ #hVr &s?.Z6#" 8֣`#s"7*grLDa6QQo9o]wIK\dqqUx K3iӲC8O(2lc6 ?L*i6ʦױo<4<Owhپ˲0t_PUU:诘tjY G> |LS,v} <׿ z~ UAnGõ^,\9'䙠B5q)sFCS)䳁«{]D͉!["~v>miNj-mq.NyO~PL,Eu_:_k җs੯|C;0pY4eeep.CCAN:ȌDw,!sY ƶoMf4TsuEʨrF' l:%3IQ.5jr͜dkdJc#VE]y6̭ *ǻسqC;y ж`Wni4ˋ@S x}PRBn<[vavo$1d1I4)r(= (ZF{zN{##4`DCa U],+el D|H!i꭯ʜsW*#%!0GiRtyP' m,.#Ds=zQZE`|Z}gx*K!yiϞLKryagQ=طeBi /bU0c&cݝo9u󔨥codᅗjZ\J0$7?>5PTP1c<޻!qPjz)JR˅&64$3--}#kGVD|8~vUfp3)Q7s6>_h0m#Mbx4zS}kcc »ξܤ=T>t  ft$GX7/pK^1Π4N9shwPK?Yq32'9Xmjd?}V,VebBG{'OUj+r-aP+ֈm߮Wvnތ36鄂ހ 3!Mؼi Za/iTѼB.XƭG-|nVy]j'##:Kh4M`9Z_(hO7Mrl>0 .䩻xT`h!I4vdƷHcdq2C^Ysٷs/!;{M$Τԡpw {/W5X Wr>o2ٔze*Bd* z-)ak/Kh4:Bv> /nV3cKH&$>H>EsKz.@Y).V͙KgO/[ ;i{Bp_w%LhDw~:u Y+FVHḍ(pߏiH)d2!=Җ-|p|:o|1q|ݵ]ۢr=\ϳkU֐gMo)W|mwQCX9йp;]*N9{Ok3 byqW里0#_.(ah/ >7?y76Zv6ܶj:Q|yˎ}|7^MAZ&H7V:OEm - ]P}p}= r ٱ1r$x ^N Qy}j2[sY( S|nf1v`ptޞ)>n>n9{ھa;yelތL 0slaסc|;+g/T}ӌlYe_/iZfrC!_F-;۰}af(Ct>8%JLܯ:yhiݰ1[} u|hȪ=0igDB'Fxxv+6)Ńlqt]Ry ?z Vrg;O4 CG3WV.YISљj5ю}Nͱ]^~{ *Ӗ,֬o;-{ 'v2a$Fo(L?aIeC]Sdރ^@ ><._eD>Ff nPuMx%rBj.MbxpK; R'uSg@܁άxG dd # /&`KI^ ڮ#Sto=LSh]dr`Dkjp:,,+?)fa,*3n{|5TUt`OL\D:Ϳs|>tU%͖gEAe]Йp qrd 2d {ˏ ӹ{+H)1<^G%˞KQ͔5o$΂K 6޽s- ׏>(妎#%9Gt{L!20]_@{kP5sz=_bqb}AiZ$_ٶ#j7lT^:?EH,v1\&NjGU_1_YԻGxy鍔qg8dicժLrt|6Qbg@'Mh۱.khK&d|*E6X TQ'gT T*.Y\=!:ɻHgdžG8 gnE7PLn+y[x#R{0vH 62rGp]4͂39ݰNx>6 %c^4ix.\J&fƣ 6Q]:uL^Q:!7.TMUr9L!xS7`s2E[Sd%ꞛE.!ւ%s%?"Iz)[nI&eek %hؼosdS.ayX>zS Ar('4H$rL'@( 7nȦ托:9F)zO944A]![κd'92"}Ҳ[㪬y"TWEզ]ox녗i_ƫ%09;D"D5` OΛ&nĎA&s8)p$"Ep$|寜gQjH ot.>9.lF<[[n :syIL: nƿsW3݄ %M\ɻH.aѸ8eY}E͚CD3 p_P.x8m180 #=]S&2iyyJy9/z|.{ZnQ΋G(/.Dq 6I:vNTE)f)_UURIKţ@sYo `[6LW~F9E^Ƀ3 myJ| >&-JƩ}gzP֩>q7~ 6ȁ6޿1/NWÍ_ƠZ!LeaλvD`Q?O[Qp|Q ܺ :q& c~<+-'P+ UPH䳂t,71x'9a2) r$x&\SyJ)%"d/Ʊk%Q!> $B mnX۟ @!ǚP eaiAw{0tq|6,ゅs@{iI8+cLhӛh;84G#lw'MFzDI8>_~./#ؼ38ƂhT:P4( <Ψe\J㜦i46,A2"q!dO]IZo 2>8P(sWK]GLjtd6]kin>E͜A4ޥx SJɡ8Y2u$L<5qA 4`S0j%|N}iDs!d-Ӡ-أheQZZ[L̘|o~1αhD_:-nGʢx˫ 3=)qIҲM904F6眺jtv&vF7 'haڴjc)F7 93"׹s*0bA(yHL v&:QQFQ0ED"4̝OQLzJMsS@] gd@"!YP{vGW26bl"!\>U3q*@d`Bc&I͂ yW4,S9 䡧8"+AHBՌ|I=pBX0怏PY[eOʱxsG/^zNk1aVh?@_MfLbʜF.^믬;PʫqM>oE..b.+WQE( Xܩt~ o\:WbtxL&mۥR\cut>qgwTs(( Ph}#t;MVdRJ,bx yƄ([6$MqCPdeT-_KfZ!/:úN+ 524 )F%hYV@ QHʉIBSTEG=^&_B`wmipllȔ0RC_r55!?:&E9 d8.K.tI)GQH9d)*Lq`;:|A@Z TRMv_|o!~ffTÜl_ҡEthLvaH7_n;@~twZjD4U]lr8.4 #H sT$LrX'˨K( ^LИ@uű۴bnxm+.[@t0&ӥ*(}|ra#^HZm^RSr+.YPM5˒M&Te\g+ B@m+Ϙo>|+_-< E"_;忸kezC=Tc^\.v IDATctR估|#J9ua#JF  zֹ562ͤ ,^  ѬRTi=ϦޥRSD(%BEe5`4-ZX@#N5+ QGtK  XSeR=LV֠ym^LIy<)ZikɁS _u4*0eǞ;d._}狟Vn/> |ܩiZ)b>o!Z;:TWM~z畴,ƳIz6S"1M{[n|soiSoX9Qa[yңS_0]&^DPhA\dȫw;Rz'R)hՌ+3!}Cu"4=ǹ4_+py:yB]yMm-"h]3c4zq): OմzxTتxHQ 8\|>)GFj0t^z/|?|rp9jEc<럕*@'}!e]JPjr܁,s䵿-@t]UYCG,+s}9wgVYPh )9}\۫,'e\3+'KfѲEi\Y5e\Ϸ2 ,h#72X:\3 pY9W7/X O֍ŔvM0].3RGmIH01MoZ*Q :8ʓ;8y+?zhI'@.h@XcbÊS=jK+_D`ݝ%q6z-]3B'w׿7^/_UӃ3ȍ РIE@G6w k[9,]gI&%H0yBqQ4'4Ԯ2q5S/BГ {VEe%B.)'sLᙨ8U|V26N*6g"49("(~Cse#SxQrcS~q]Dr:&wko-';oãO\=3EݢE!>3%)Di3TEXWwv.gT* 0;{N;ŠWSYϠ:ۆV`r PFi}JH}9<]:52G6}Z1dݸn9Ţ(N$r|ӽ r)D.ud[.fGu6D>rJ(PSQNp%Tj&x)l83e>9 RfL!Tȧ3Sc%Af<0<~ۏMPLPm-AdI##R)Y҉aې2IlhTUd͖gɍ'wxDwbAȯͧ)HMϞf}~|BuP*C|GNʝOվ7k<,CCxjRUm=#$' leRpQq5#;cSXyԧwsl<%G+'<iXC"ODJpR)vZxTUVPi(frNCTrJvӼd9`,w(048?T`opߴx+(j%,@aL):=BUKln*i_ lڶ'}BP "cCHoPHH˦c^W|Yy*}k9Qq"A I6 l0pl_8sC0`2 (gi4AH3:PjuU{[穧[k~~EBW4ET9<10yˣsvt=/v_o3ShqICcr|HsYKCv'Gk\7]l"<}LѪf+Wѹ( d9.jEGu|aTj0 5Lp2yl]O ÄrGXG*_Rk]scuw+Ax(MeK|Ou=hXaVK]H[Ud6BX֚+s`uݺ}!*5U/^CWPϘ_cTO-9m%W+ k72/1?|Ca ES3;o~/ ]r=JdQ 8 vI"hPw- Vţ|~Qv_?p%QC*Ū;B0@Ε1{5lp?&!0)7i3e<<f---]t9!mI]J<P(ePZymhAQOf]Ys1KDM(*P"]镑pJ@Taj28=dIH5krSfvJ\{EQ -}(p>FJ}^.Y )";C! R)5J'˓=|ciiF8\\6hk#?y.5[E4&mx_ ,[Le8qJScgJ`T{R Hoh$rBwcoX\Ċd lkNrQkzЧiZ PU,SK7%๺ֱTW%y _%T7~[r,ap689Nyj 3uUe[(!a.[ç8=6)Wb|ʭXd(euY chdy?3Cr)t޾ i9-}?*T:TJ;RZ-߰(?B6Sņe|r]*,sg"u9?Ŏ\QlkIt:#''5-)s]9>i쪩hjh NNR&45-$͢W TMӈFZ#Xh.M Y[퀉 G0:NKaK3\Ꟗei1W:Wb#CcCA [u U[J FC S9>{j*PPaQ:JTJXղ]-BȚ@IBX$_!V`W3B ܘy8RPr%_|섺 =NlR1J3Sx"곐RJ%.=^tUUx`}Ԯ'AHMhBٲZc;7dtyvn"DH$t,Gu9Y3&(V/aē4_r m)"A˓1LHO A0evY' hmY/Iu5oz0q,٬/LV}6LuqC hk 8YYasq-leBj58@Q#ڊ],Y\Fqۇlh,6عAhzz")#\Uu]qg>Feן}B)˜-~38Q/k+k,M^دDNK?/~ CK"$fw;ԏm\FW4DJ׸Qʉ:uHcc#gɪV!.aV.,^)TUķ\ʑC?svhw\;n onLέ}̸ ] A8p``ētP`ڿvx$fm:Qr.g&˥`qW*Ѐ(d}!Š%*B *)wji'1tl/ -$ b0{! Bj%t]Jvdp~Ei^_X٦1wm(PI@VD![3+侎~BWS{xg9|$i5 kq= Mk_+|QБB9.`8e2E u*tR%3H`bU%a&fb%z;U-ۤ/RF'̌۸a:U5W3n$Q)I-ەh淎#bqf>Bl{/?__I,Vz>q-Ez.zNƢI<n-nhaZ7lc?W2=DC_ފ67)e[P.iRc S./q.±LЙOk[>$(l&7n/ѿD cua5T*EXDbAfW5$Ի[i[Xᇞ9M{ ]* ӓE_-xwWZrJXଖ'c|7u-$&2= %c@$T Rw!%\Kg,hÅ*ՅZaRGq#\67(VwquW ) ]SfJe4!ssKDtbf'ƙGQD*m566뱭'c+sd٠^D0M3:q zwdh A8f]J E )K ϒdX4q\%ڣZK?w|WsmM3&\@H\ '33hJݽh76pmQ@DZwpުRkΆa&NW\SI(͐ RudP-S% _j8MkӲn nE>1s'138F'˦ErEnKdr9'ƃiZ<Oo]p&`/L^;ҧE~djdA{6X"peavmN5ܷM^nC*#_%dG/֖-R.RaY&Ɔr8nW}6"0hGKd䵁 #Cd#:}w[zqGχd.P.X7>\Bߥچh^,ibrgfТQPP2ICg ]³QV~]聸9O/e9a[o_kiGy9,l6Ez-FuD<V_z)پjt¬عp$PTXRs3ϾLV,gܹE*aUkuV* ZXPOqIhnGWt6,_I)8u<49F+[W^ْ5:!Kғ؈1R D--؞GCDHr|!p]4C gtr )*-=r[ؤXx("=4b1n x円ɤuM:ӚHԵd2ɄizXJ;'w)-0[S- MJYɁsA9U%Il7- g1!~E7ɳĚh_se慛ÛG3Gxwla׵W[:W2Uk>#<)?tvVvz1J{nl ~DdjY|qYkЅT#e?9suдВB7w`)iyg dfԷp](} AO~\qܙ<3P.j"2vLЫ@յn6 -l iJ0;1Rp4ATKQ N9QE8lfѴ1T!ސ\Uklht&D" RV {*[U$i*K8R(WkT}]U[n L 76Zb$|r+c9[Y_~R =$|PG,,m(MaU *zzcIסy_ sT# gΈ*94 CWDՒh^8aj4q"Vt=LsDg+SqNOzB![/;i(J V>K!Kxe}kl"*$g|kX-(P F٢O'Ny Ϡv B$5:",kr 弇mZ *dS/m}%[wJ%bٓ-L(bz Ua4덗^Aab +W,]͏/}-o A~tt74E*y k*zN]CLs%⬉E亵T*Ї'LJhogb\sa[N2uEz' riF OjoDO\}{.9+2q!ȯ}.B|=maC\6)(]۶%ヌfK ՗IjD47t74ezѱacOeqb\B" Y*@~̢fo^{~Y;):{WjԶL[*`K[#c"?d9/X58x"769+Fi4BF"eG%+0r-)kI<'T hJ Epkw c@#۲ {-xBAyQ!Ă ]8z8VZ4$j8JTpcO Lك Jp#*mbK^>p8\.(IBWQuT]*a&I~@&u"MN( D Js&mP!(讇&%j%p[x9MvtL0rV6\~m-lUە%X8+\?(!EA#x$tK 宷7]uG Wx9Y..thTE,iNV* ux&Mv|4C!>+EWH-ylLd\>G!T*aYVפzx"A(sG^ϟ\* *84oy/<'kzJxyY^nNhLOYx8aRQC<1m{ TDQJZn7 /bfe:bc%*m:=_Q,q*>G-M]Nùj&ñD,-.rLy}2B" IDAT1BGCLhB,) q놕9a6*[w 67'y)cV F}cRc2iK΍r3blX9~Z}*NΤ9)e?b\B@PzmrkktFeVGU|VF"!Pus43r3s\.uLLT!JDIDgfl$8o~ 4M#eS"Bog"xBdG"C>"W4h"P-guWʾt IQ/~E< /!Фy< Q|c-d. v #`Hɫn^=ygNP6\v%(k~l( >Hk+ZdHI+=bnz*p~ Ϫaq0ÖP(~PUӃu d:.4ZUNT*av`PEU]Q9s)}C[05<̯.Y8/"LfSBlrt A]_UEy$MC12"2p(,otXUr/N׵w|6-{rT2pg\e#O0P(:y2ɽsyw^XR Y}լjS?ݸS_eML󳪪CT P-!LZeHFQ5Sޯe Ztjo[*v b} wo^3Ӕ+K]kp zk/W_ E:R <<KJz(Q @NEe&yug>*Rx-~Z{0`IsNJ^aYiL[26i%%"W*m휞8_rX'U^ IJGLUNttpz lj/p4P!2f9Z3>fF(sX%E$ԥa#dzdN=oR5 8otX;z>JR+!4!N$f3xi J)4OѨ]z߱XֵrbZ4j;X.8@J ԙAZ":{`rP#O<͞\dmFwj捈厷)仌|S3g/ !C'E\Exw]Q|{1";]b&a׬PFuUIm:Υ=b;bG#ܶk-(7"dجh>9xJ6mїJ0hm[d+Y>E.Al114$0EQ M9IdJ7v䨛5O"pg{GA!7t(ky $ @k{]zXnF4i ;jBY̓i1>5V4x?c#P]㖰KF1TMd'Tdm Q`E VmʱK~bV!*`cG 'wrAs' 76qt-|f"aۚ(~B׊UӮUfKqC T Vl Y=B!OyZ*BSx5`į}K% 鹺ڲi~_8. W*Ѳ.S4p'U\(. ;;Cff..EQP1Bd[y% ^:x|Qp$ذчg{B Hc"\@/23S#ꮣ/XCח vG_PZ\;n<#Ӑ2" C--DdL^_繡ߡ\*XW32BtFe:~R~?_-]DSG}ǵ㲣&S$3) ҁ݃G0"hMkYLtTpMj-?{\YW$ ,UXюp̿|Wo1?pUr i_!]+d$zBY*3Gx8yf?=|>LY,`^X^|Uj_k3Z۰0"SC빽W4*dÒ-kHF:R7( AvB3!E(,ȧ}%V0<E\P zR +)E0~s(r;}t{ӆU6nB]u!AY.lTu)?蕓GNϷ_#ڒ CٿS!Fm[,5Gࢠ(+{e9>4 刕:~4/?#/ukTg7RJFmvLL⌫b)*-zE`Dbrbsr+ w∻军?QާvZ$+kc{'r X εJ2iGRD](hzfB&Ӆ^cbP$;9 Gfb~|B6#S"H1p2顨.B5ȥnU>3"^Yuv&N#]yhDZ ;Ka"]&i+7ǽݗnQKtdh\z>/y~p4#͕L^z9/|via?Ab7o)ybhGz&P+`jT.vs_6+wK)F)nhlRw5ʚ8~) y.Y?-)4 ,t*Ffp~rD)v^ų橧Ybbh=~=^*_x*3ƞ^{1X`U#TkVb)ψ|=㳈y>_yV {7Sw墧 MW #+ e;S'zXѪ(j8ZGZ7bxmhǷxWHirj@Ezx)@a%S) \'ؠLOMs]gZ][DlݾW]/"$2u_3L;꺥l[/VZZdiZLVMbÿ_޳z fý+7Swuӷ׉,$ٶEҦrʤ2UUQ#1tߘ9Rby$uja)L4x Y6cgNյ-t~~dgdE']8#. ;\Tɹ044m]TjM;xzjHӿ驉Eqt4ĢAv,bY4ggĤ4 = Zwehj ڐ\ *]QfG+*ܴcPBڍu򸧧5]bӇDٹe;Eq?cIOsڀGM.D!yslj8 BDc*)ǎf??%#(#OvQosK+D\G,j>*Mr1̑AQ֫Sqm p-;qa4+B.%n{CB T/ ڈtbnM7h^?NsG;ӧH%V55w:CLO# Hr`ӧy7~yJ|WUx!E \m1ƣQ`flqVym&6 xc)>'֬xc]קm.ӏ/N\(-9cH!pFγwwpl&͖fEB@֒b no?<쳞=p\QECw/~⎭ Vn-A !P4f8sŸ_o{H8*65dBNpbg²Lm,ODw@RVIHsH<"|-B9DK%ظr9_}?dIa>jܜk\4vDD)'n_SsD NFg? l<КUƘmikJqО]c6͚ D|jovM!3_FQVf`1 n]Ik$Lc<ʦ]W3;pm%^ gCwh}4470tT.[L=="ܵT<`u|}EDs$>69:muE(BU79e- xjH޽~ޒ聕/232wiT_,T*kϩ4*bɡA\Y2 h2E2 *zL9}'\Omt5)h߈jP&29ӃPe)u+neAsA:Z[gvl4 EQ%N3512Ēm08tlҥxbE{g3q1zu p!UV2%ξl,YU<J ]*$Bxjs&{ĝ8ꜜ+BEOFYZ3Wӎyh;^{hukD.Qs)*f4Y4QB q#D<}ZN՞/( If&Jԗ-S?,ٵP;³}PK <58J)vLlZ;z Y׶-p0IYxtm3t)g'8HH[.l Jaܖ. 2cT~CQІŷo|Dr1Q>P-TJRaK)9.Fo'1fzN_dzr '˜(xz%պ,,1HZ0wn 69LF  ϥl M- [u&UYX0V9 K$Q:*q o''qXen#ı ׯ㖏|=1iR.A4{)%VӘu z;ZX8M/D-ɣRǒ$G8*3D4ٷ~9؛'=+sc3L`a,WlW ۯs\w<"V15@%3;>|ѡAR1Pcu";ts+cmID=ef1JMm \ۥP*#e # ?W4@x RycR\PB!]]SfL ؕs3Ofa#V!n-=U8CE)ID=f1*8"æ`l.MP4Mšʮ^\Ѩ(J0vmC_v+Q!)8.|u\G^kٸYD";7Gif)155٭Yˑ'G&MbhR,Y9\1x`BzAfffjjYfu=Z8"7n=x_;z3^wO+u!TVW[qc 8rHM3|Pzף MN+n{(Ilfz/ J9Q8;;φ[nsN<RRW Tt=;Zi|f OdThBDB! 4FuLcOC*\Hk _"1U=[L 2O{oZ !O>lFcE~ݿq3W{fkﷺ렦%U .~?SRsnvlږ-g:%(TeUU 9ߙS45ABr6CfӐOM yHn$(MbbA|_Wl#J֋۹^brnUmDw'ƕ;vXy$9cy=kJlfH$ɐ݀Ga w^+a8[dV(D(т߿z*#d8W命'gZ@Ͳ!7m8c#8 FZ/|:0׀55!ZI qGnAV#ݵJ9S:jh[>?a5 {ۯb8zK\.#-F7PO01{j\ѨhoV;}jkO+n{w?{ru]rvEADKK]'o};#c8.R[wMs' G0Ca ͮOMpd"#^xY6ɤz-;g|71]ρB'XVnA:-^￙W-r[si \ zR]Ҹ| mZ(./ q8[U8W4&\ Ww4䷷mPO?#_-;n±C 8U^(Ch3MbՕ,mh3,E⚭[H49}onu!sіiMtuuյy~?[Rg'ǨS*XZl 7|wu߿Woa@$&VS+ M&RfDR>ɓ&ミ`^q2ZM-gKcV-D"njeŲՄ[dF~:?GhʙwP9_oX]O.[ ~+E-aYU2w2t`E2$H0Zb(ᶥ4G,iL^eNaxhs+4XW̫`~&&R߻RC2*Tˆ\پRRz~XČDHwtOvREoųoOF:{)qDTd&Ukz*aF8%ؐD͍X Y֚i 0 [1MX4,=E0Ƣ[(ci/3::f~ƭ׭֝o%VǟHMTm_0MHpC3v" rU!SNܯ^ArN(fG~5kWp5kUM0׾nPXBFhlmUe$WOǎ[Y`P=UTc ԄUKxÏZ~~qq-ز{-x+7oeY @S9 2|J,f0hv]+Wp%HFȟ}^{ӱ|k:FJ]'G Ec&*2Nxfٙ)8COc4s[ZݿRAƨ#hmxƒeeڗ+:ꓟ`gp'"q֣m]7/.J'aueFLUKص2nDZ4J0 [pdk; H/Y*|+,̬)nѓ}~~1 R-%jzrRkWʖQqFόS wOű"QX3Gǒ8VdBtM!Ę 1nyynwvy:\`bci; Ed9} ]V*j3FcQvts d|ƫ?#-rŚϪw_p'8!PeP($(%̻B)Kޮ];ߺ vRt=5Չ84kA(b.ZmC201BHbFFX z|?SL!ʝpDDW `(zG?E_xZ #CXbkX~,t$Lxl33 Z6S$т:E8y;|j%)i:.mViV 3#hj$}FΟ3?L^>Υs3xǹw?;!/([عe?FL)jRF/H51"7i P{q@&N1)tZ OB8ʼЗgy%,WPL]H9aOcZ*+x^ԪT 82*,HySmc%|١2W`{̖"1|-^K4Igw2;A uU -hO'd<+Z1R]! jYa'Qm`>sz.7U૱y&4h5hldyJ8*e)Ue 7gbu,Ay5$DvRT,nIsw W*vD@anHD(vYc7ohr Йs<_$,Y*YS,Rq"1:;pEZL-AsUФvh4RR3;ڈ092"gG NAs}~&{_'rѦAQXc2G_ad&^[nވx*Q*Z"hP,R,r/1z1Z 1wqDS{{n1>/W||n/?? ;㦷A렫%RT2&36!F"zX<Ʈw/<@je&8u\u;UCo/AZ0 j ǰI7pnzV !A3en0ڗu̎j1ڰB?QNk<OϞ<>5[h߱Cu#\v$ ,R0M+:r\ǐQyNtNA=$WMuG22}+;!ce[i奾A"0R*[PK ܌Hs:TJ2]E1 n `X.N5  T5۶|>;A/cU=4R󴢹Yz )hQJ5?׎dMW][ԕ&5k2?kH^olXP^KDO p+>n\"7k=y 1Ռ]?{ia[C\V(˭qCW+~W;- +$*C"heʹ,C)P]w - gcKcTr5_A$@$JxgK`4w yrR%KI_߼JM3>a(#R2=8bR($xCP-W`Ⅷ$j#75I2xJ^^>u^~ U. w|%BP.aKcs#}jCAHN(~b,"G$E5A("LCv.eJ IDATKr3YݽRW5:Sn^;W??~g_׿NMgYT EmNblB1eL˃|xn5 u:VF4J ]aЋYO$KE9'^ #Vf[ʝ93ڍm׫/};2bHWjb|dqjuWqSgFhgzu}1+bFYxޮzZ?'Xwg_k[{ЦU궵8.?w}Z s,y1ㅿɃT*ں{ݶeRMé9 g:[85@S*TrLenzYg0iO Ń{ф*MP}oR gfVFwnW0.{o`<-p{n4O(_2<0$òcM6a+$wl^iJy{Șd)O,xFh`T +">Z{h]íLS+M`3(5B$eZD:Qfny  a `J6ԑ%QZE(m&&dʹ3*&ҩjO-_mͼv\)d⓿Ɂ3C2N9?O{vSM*J IB7вzz_T 4Y=.0w 9"yكxӓXKg0:]u0 )8QTr "qv1mnFώK_Dok$>%LOϨvcve7W^|Q-]Xk)wzW=.AՉ*(#zbQlԅ S|olXux#בoܨ6]_TdV @  0CiK"N(Q=,ߏZq\#eŝwtE/5Os՜xnPk+w_(f]x©"/VA榢 F(1Z- yh9"TjmK~~9Av*\@$[YSmvcy9ƻ 7o#j,MG;`XPˣֲA2嬱|=zIyѳ H#ZI`J/oS1oO>Ea,%V: 2yxLKd83m3z;g {ë+[@_ ,X~T0= ]Fn|gO^͆-Wpn.+~(?L Oܼ\ӿu7j]G䫷^vE|7R`$W^_cFc0"ul,|IUʬUR:* |yyjs,_aXORhiŝc _$Wɇ|c-d'9V~ m$0C´`w)㣷_D#(#@zJX{8K- OTgb ǎ*PDMEİо$"$[2: yݠWPj=6$ B61]vrx'/]‰auG׬'W_ w` ]&yyWslrZfnZoH޵ijj~.V5.hoމ*|D<|AU]@ŸR+Q+(U#HE #%T.ٍpJ-YMpX^V'ڐfUlz䌇StճpeU>(()jjSi3w﫶e“?EE"[Z||ULL] Tk*ոƫ"٨6uAQc*(UP-)z5N)q |ŵ=aď$W7ZIMݴkϞz| lV>NdsSo<' VD9*J,]H>,Hࡌ]PQM1M]P#&GŒM\T^ ǿ*vV E9`Z]иam ҭJ%k6e8C@eN174lJxkᓿҳCCx4{`|S%'h VdzK.`XEq_jTHЏR9̈.Ѵ Ca&C0 '1M<7S {W(s>Ti9сhhAkC2$LV}LSgzLH@5WAY**d"G"(cꮷE=yc{ZFgqN_[u`HΦ^Ճa)mt3K?) _bqjqf_3UYDfU]aykMTΟxr`S-hG VHLٳ3xcPkQy־ FR|Af_y==R|@S22ߏ?kl"JR99M"RNn)TUC$D8fPO67im,3RW  +W|6Q+̓,Q]L72mW^ܙS?fRs4lN ?$bEJvI >~]u]Ə7\KS*;k =4<D|$W)+TF2"Ŝ1(T0;;YNRc%ĠREijA^Mpv0QQ:phv j&p\T|I,MȚjf5Ph:JOJ]I REt Vyt4t&RB("CQ㻊ZZE( BjJ1WS5f޵i:7>_;[h|,sd~!x\'9/]?87CNT_n!En:]j}jAD\P.k(G. 'f /z8 ⚫p&sᵪ{uX&0 -_L?݇?yQ+ۣ4W_a:}jQ 86N(VR.>JTv,2? $T (N +P!ݤtQ>v٥Z \e|*1ݭ&Gs8=sAO6C4]Q*l6{@hJ9/P- vYZ«Ti!HRRMh v 0#~nWA{00ID!%H,%Hh<VB{yiJDBQfMRB1śR.=rQ(HX,q1GjBd_4+ RQ3-Eb~lY|?G&_nTw^SGNs/ fwP ^b7TZE<U#!H?Q)UiH'yq+<$7ՍTH.1xTs]BEyV؏d`<(˧Z6FC{VDcZ[- P6 4EUᴦ4V]?@4ĒF87ݬ_s-Mʴ,Zq_GkOdIk{d|G83 A倾o$ݱVע{3y=5][tYGKs{=nb$UEsr`4rx#.[s2R>uΑ+*Ľp㤯F!e;c$|j/d  <*٤$AgF5ᨏ[ z%j] <RzfދQ /X]p,[#@RÊT1nCíV&=?[ +Tr8"O8fR[ڊM+o~+6kP?{Xn4;IK{EFI.VmAhKj5IQLLB5_|kë8G4顔h G$]뷨F P,e 國ggQ,eU=ZtolnZ\ v^8vU06V#{ H2aōӟ?1c*$Ysj)tJkl-bqN vA :p@ xds۰!niV2n1l" |bIJ&\D8U+|5ܻsqd~bcXگsC"E$LIf$DRh#xBA*Lx%сoR-Tu|3ՀJn`{eaE wf3*%y _URQI(f f:B7VO[x#?lPZ Jct`nAu# :i+?@>W_*Z*` @;PԬrJzu/ct]ό W-##:@zAG.Cj\ j]3q̎%Ւܤ) {]c+;ޢ#L7e{Og{Cc3l^c\H4dđÜ}uߥq=J[tc3-:?RpPcW3fQ[4"-QG,hpSJu j1*QCݳ20_G0ajB8^0N3?,"Ez6og_gkL5mn8قtyo5H /&frla;xϛSK8@Ȝo1:」 {H5>iϥwZr$:/pڳBVQac8.g!_KDdQ5B:{5xO}/;K':iX8ዿx_]]zW Qmn*cO(? 3`DN~KLpٷB==#; yE1;.v cu^hO1ǽH^oB]VX1ZE]/{.7~ٽ;~{?/_Ks9dA^5hipn-`/{duZs~ecڶD%!}"A^!l)*+i 4J ̩'~wSC[:8g'y֝ˑB9(S+]#XU"+YMV "UI]dn מNYM3՚}?-s'+O9zUH2hyLiКSzS?|W?+NWw^un9wƙ()K@ Ø߻0OtE\Їߦwp >rgwhgT}{t _A1[8ׁ/GXuw%7_2D5{UYF/wL*r,3%@_~A%Ͻ$7Vv:j7RZc7_MbvyC<ù S:*A]p{E_qɣ38m?E%WM!k* ŬO?)kVj+qfv4!w묧  az礴XcO6u|=.sЃ{9(0eI ~'|2S TǙk^dW/|]|SoB].{DWq ,4Q:d<%-jL7 ҵ5㭓-De{Eǧ1Bx@c&gEG W&D{*$g ժDHMp-I6׌5ٗL@XFES%DhI*ϩN fjՌ@%:!G`(;%Jtv3sֱ(/_X"#>&,JggVX7E3֠向VL]ir9Ǚ7pM"[ش]܋ع3?]RgFAȺ~bZ陘ܿozOkqz;JEY8 Pi$v t]&H VQ##u3#JRT[C<kٯ5SYxYWP3 ڵWt JX"Ŕamj<;D1ZxkЬpN"WX b`C`.ԌΜt.AJB(A>?d*Dg[ףbvz[794&NP4&_$ u& B3:A6ZjdI}?1;o`M IL3_<^5*rtC'~k/4-D5V[{v@(5 "lahc+FJ 5֨hXR DtQ*Ԁ=t U^7rqqKZEK9)?Pgʰk?l/D+7jx!)Aff'8(σ0-ul4R(s5%.|]"ux~_f~jQ"h2oO8\6FWq_lj*wɒ#N72*#4.  "^R|)u/x{ţw}cG tE+( /1zUWN0D /-TDIAԤCHlS+dҘ%ΝSu?e9.QABq69"%t>NڴXS}&G'T)!|BFޮPQvȵ?5rę!7 vX=x?Rn JLO8-_l-@VgO rEXkCO2u3mVH[bNrvk7@R_n*% ftb]#-$vώыs%[Dqi؞SֺEXkuE!fpZA]8B;OKkʳU;!5QZcSVpWB.uy*O"!J{v:`%F[H\-gxfBH>0o^#KR{ȃC)n1 a WLڀҀ b[m:fi~{Tyq15v3sufw|ȚȨe\E|D1/u6ZIfY* FDIĕ8OڝƯ7SZ c+TLmV6&&0F$׾y)f^oIpLH zA1t)y)tY(|`gX&Xbl7:BH$dF0e3ty3žέcwz]-t7wu<$!7Uf#=YBb{={go!3բm`iΤx 8N^"rf1 ó2buJR1eä eMvt ~/IwqVB:Q.j[Xk ,P& eY4[)S.FD Sq$X8k%2ԫI#7LX"97vl) Ė709e!NHd4xУ.΁[cxV;ՒËIToN/ R(Ø8zww$n' VJ^]ojI>Ki[Jo(zNa;ؤoؗRI31m˲['E>ު\[A5p=bו-b*1$&NIhR nZ~Ώ _X*3;~V_O`]!تB{X#>~ZZn),XwɗO>9'G̿9P$7ڧʦT5Cж ֮b+;Z&3kGXa`7B4Nbﵧ⯆hC/=hf8sʀlVgYW;A/rعݵ@\K\%ݷmggW#ИՎ` Th%T2oDf4E]_ krC%#'svo V\X:2 | 8źP dJ rdY#V ^yi/2u?/uc4p>W⥏̽UA=H;dz E/ܕ۷ūE/?|aQԥTƫø> 2qbg7"ci# S>tC uU|FI/ /Blz<&Qr`O^n'TF Μ7u~nn[^x@z G2^J6f e뽁HŊk7){Mhl&8"<}({3{tgȀxn'0F{^͢s`zrڏ^*<3')_AW m0!T;qP _Gxc ˳3Պ,}Vgg9 Gmj}2|2t z>Bߡׄ5=zgcF'x [ C۲l@]&vl>VzErX{ &j_oUP=n+ml!5@FD=>j_]%,]t `Ŧ8M,7H8sB]5_~'{9K~ry /Pˀq5] 5]-{ӇpB<(U߲QM9Vt{`b2$) nӾV}ߑO܂5:,CF};̏_of,dt7n7iWBAaX2NC/zb9"cl 0bSJ]&q.DSmCּ5ɟ; N+l=. su$>@9Gѭ,/P[aWKk~Ӯ?X8_/:ܟ_M1~M-go*)o4JI!Z0"M⚨@Vrzv" DF™$:RaPQfm8<ӣ(5gj&l.,$"ǬA7n=/8El˒t;,A;d ͱՒuxoS!<bx̎Șx Xz¦L@]D8e>%-1}vGęR<rN}E; b~pGkœz\` ֆM`Mk1olyv2@JzWj6/*HeIdTyCwey%qsyK\Pq%;EJb&GsWdc=LyUӵB<Om7LknzZ/n~p\PɃ{8#AIm5kwF ]b\+{胋R6e2\6%;c-=g>!P*˜8t!:zع(ohYzEkW 8~'1K i/ LmWÂ:{м;'JGh0H9AiNlukB}ѐ|kqk&οnŤo?#4 fkױgz4d9vαmalL6|NWkDKN{ WDU""%4D&;=>)31>_=+^m\QB'_?eMm~D˜}Υ}*rNHnޠ| Av9e8k8-XLخT5Y(p::$T+Nh@Y 0xtB=DLC'5F.h]xgΑ#J=1Hy-9-jzk3Qdkp0ػF(iۼvb\0ԋ,OOgd붇(a:Tу9^;7PH]%ͽ79%3ڌ@X78f-7FȄJ!Ycv̻͜{{l8fѿv ]92yVgg Ҕb<ϹjSVט5Q elߧ;oW8>kĽrMOI85~2!tY0$MY n߭8{sMD$lPMhg&MbU6i g}.'@ a0rͤEWctL#CE1q0S->bU}EW5t{M9Pcg8}H]ɰVmQ2.lѶP7At#+6mO]A&*DMgppMuBioi[ ]#}.[̒vyO(biA],"fϚЇnbQ; QqN]\ugw=sM~_Y]2 nCH+e=mhtY1>E9?att"m"DCgWH|_g\E!+D,&?YCY֌Fnr=?¼5 sv?xw}R/y @FP~!UE 2-i fEaNPme)hMNU{`kDl1.'.Mn+;Tiܖ8;=,{H8YN'_vnV+ u^26 uٸv2Xf}[OQRL |ytɅ(mWԓ;QȜ=mU"I*{b :9z9إ[NG7]aVesgeoarWJf8ft6lFq~N$ETw lf[{ApHFzZ>rEYæ ʹ ,mˁ3za5Ȥd͂LEqګdqր.Q}cfr 8E+}dز/5s5k:MV!Νa/=y<8WnK-{1h~ER! |. ږH'0U b.FBX"po'q KPG(^"g6fچ1|@%VIDAT{mEN=5Fq5֦0O*@,) ~үjD{]qDH/jL}cx߬fLLwU+េbI1bG8 A8HdUl|k̔xc3alȱidѵE;s}š.o czM ͈Fԥ!5v8wҼ7ŃPvCnrX%ַ[L(+WnM }̴Q!4\RLYS$m aq|r* @F딫ft0þ61$x %)3z JK1O]hԂ= ٦#s{OsZS\} e "mB&^شڀM@U=]b)@n59g_%x`|.TS^BH݊aS<@} gu?#Ƭ`ĴP;~\i}8@u3.(FS`!.m/Ut~WKa!4Wc kJQ]my;8vD1V-ɖ !仈(nMʴoNld:CtqF]cKW]|V2Ɍx!e6޷8b,|P=+x~-ITQ9c*zθ/ ^6l'k9%Nh+.0uѣmzroSaQ/%匵c mz;&u$\ܔ϶:E Pds6ɶ ݺM88?ng^]{m֟I Z>$fXNaf'8w+$pF3o]) k+z;W7QQ֯K0D{.:0ub2^,<%R)td稩mǾmPxVd#U]D&`Nۃ|2eM 7G.\bl(ҦNt6~O} Ԙ!=\d v C?=g K1+O#Թժ@b_͢vGډkWʄ x=s홈(t- >x Bz-#ny@f(I-a4wͶG8&gAW2ж0M5Iwv)'\ݯՖ, 2Q-O^8B#ծ! Zw;Nm=(BA 6ܔW1X=ZRɻ9uKE e,ӓw0;I эG rO!ܞ{.΀/osHp(V0ܿ|w|7&$wQW]%y֌Yu-Oҵ)ծZ;}MXXl$P*ҝ눪0ҥ+l]qЗ^htD`uirUa.8c)$C2ЗZ2N(޺M9?5j۸ ƂD!#;}i0M^x^pG8w0@vӆ4^ȗguoDlò`Ku01}b2UP/آ`A`NRu8DG=@L'>/'r=!fh)@]\mO$ȸG1?"n!e%WV|b&h.ij|~X<|aڊ ]cbkMKHg3d79R!@1~${W G>WZ ݻ97}ݷ[5Z_]clJ+Td'eux"c]ʧn}w0[-qdq3{yvU;87Y[6=WD%qj@T8!",IH*h6+ WqX ^MVaӶ^[Ѳ.gFGe*tƥMe;wǼm{ B0 0EOJD#1FhV =j\^LJh3|^7]} mBMK_g1QvGC@hk:9zd ]taАmPTv$Xqeen2z ~흈H!6/%α~J$nj|h{1tm`Vp] '(qGHkuh i }IUbC]u[CC\v]Fy7 lFw͛ѵk,Op h{PAq9sal7"l3' USn6?w< % ݥmm=s(^d-yY5u ؁l(mmerB)\#[.;5/c:s\y)g$dů 2Iϻ^f{DTF PI)W.5~ηdp.:s_]yP  j'+9Y8ƀRFG,Zw?ec>Ka]gm%@AŞBQV#\BDFW1[v;YIB⿷13lBغ@>#TZ6o2%mk"G&):k%mMFFd F%x.{wػ@\΂sȴJDw0 zR[>.m\ft m4$ rxJ>s@~7T p4<?F@UR@9;{E6C &].hg]\s;WSc]!ʃ\ԑnQكw3q|\5^s.zy~3||aSa%s޸h_mxyB{rհ]]5~5Xv zl? >a.,4Dg ̹8sje8C2ֶp]tQJORސ#ѐr6d ww (fdLR^0 cTRYI|"ֶX^d J]5=ĺt(@TAݾ;FcQٶƺ{l&XQz8cڝ3gܝ>&6ndY`99qS]I`rߘlien z̚t`Qs94]7q3џd̎4y-~nMU"c\f1ҵFPRnlaBzi`E8a:\F0s|IBJ#A~JђgrN% k͈&yn҉R}$SF.SpC Ņ Y ہ>+ҲKKJA> 0+x/{Z\^z ?ÿ!c@zF3scAԑ>n]?0M nϘz0Gd_ c3.:P|6 6փ `;^f G-F*%gM6 zO7` L#kLro~K%G%{kь5V:!c ;Qʩk<!Xщ(qYJJ5<Ӻlľ>ϧSl qK` Z<T4C#䶮ɟjm{g~Y~(Zf~3rrr@8+=| w_Hۼj$\ͱ)ovIҋE4+Z9hҩeԨYsT>'Ѭ*T(>q.;~;{59 D5=mF!L qbwIY&]27v"!>sU6Z@P$|Pu x_z4RK疼T҈Ҁ B@ߥ/[Ke7) $\*ӭAe<۶_KFo9#ϗe#.xWt)Q,j <̊_N+чp:Oz+)u%T+[m[P'Ju]ǖ|o%k:o"r qQ Ż{D&}G j@)ɦ;aΫ^n֒װ4sU;A+,q?ͰEWCyC4ƹ PJݫ)yS>SMRX0=M%E-%<`P{z?]#HE?lȳ $ϭu{j .JIs,JqNs,II|DU[F,qyjz.e03vN48簻O(P/;ēYljP`hFKehFV-(F`|? jh$ۯatt & gD!y|LZ4(G ň~_H|5%'n!4_$|2z57:.Yrw9W9RnK[IikZk\yٞ71|ŵw?[hu.-<I>cZHsF7gzv/"ZwIENDB`bumprace-1.5.4/data/gfx/selectp2.jpg0000644000175000017500000002642611217461066014176 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222X"G !1AQ"aq#2BR$CSb%4T3ert2!1AQqa"2RSBC ?" """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ ""+9Ob\o:d+ܺ[{5b=?san~Wt+6+$/\I(5XX͚uGuԱrqֈLb +g9qR}YDZELWٚpDZL}K&nNX^܀ACI[jeXe&V\'e=6x;ȶ2c/%Wn+Iq e[e#{WjrI NT]>bǤ MK<<2&b3UeV;3'\Dz͏eKBknTr1u4= HTT'|t qlEJ){Ѕ bg>i""*TR3fR>a]RB]^߇xmwU-E"GrO p4k%ϩF.u[3 Ǥ9KuU*$JJѤ^9wuc*}yDD8DDD@DDD@DDD@-L eө:ZN{Q~e-}jGTa \Io>FDn \ٞ%IF1ecX6,Z믞,2u'\gw) xCFA7Iź,8 ɫCf]ޡ⢇yCtslqy䒏r<Ј { $\VXMEC" sO<8m}ò4uqU[rQ[=-KS Xg'b^ӘޤHu\} œɮ4~0$qhw+ Gz0DЅu?UeAi.QS5i4EN[)͓Յ=3nb.ג;[AAPӒdhR]Y6KSϱqG#Z a7*kEYUjvVok#9ǢXyF2|ߑ6GӈYUu3d|֛䢥&%_ڡ\G0gopzs*$6vb<¶N袧cKTDnwP`Tiܲ=fJeYD^i(@׹ؑ$,Fmp^}~E#EUmK*j+8/eq6Y3j/)w0sy7{죫l#ӥRj;Lc+?#D04MUa$U9@cY}S*mo1%FKr<"/A+ } Iq͑ό84҉ K1p@fT5Y,@ NQ88U *̟UxJIy\}-e? mW9l\sQXoHlj5+\Wm{BM&RMuB>f87yL ,a8SԪ)kڈUT!³s}W5di .z).*0置5hzcub@#{:^1W~.8_ZϬ/YHW8DD@I&2IVᲐ$nk~*qi~Ӷo|T+5#r. aR䍕S{,u $F299r|קf2HKM*lz#JYLݥYyzL/#zꚖ6Vs9CEDDD@DDD@DDD@ۢ@kso mV𦧄:N~^sh~lb 4l0rP}i/XFB~fs!\uK\wrnQOd9ّ9ّs"п6k/.ёd̀8j,n~Y>ŤÝk.*w~uxr{"t/ p 4lꗘeڰ r^Z EGK1;7I\=\9/ܲuAAWeu2".,.V3>RXX: 9pFӰL̷ImGd\+UfTxq:z?ܩq覩iiSVi~h]eBn먠&Ϝkw\MJU-<լQw[u\hj?ؼMtFlȂ\_ E;/e8kuK "+X_uc >`yxhGSQiaJUIe3խu+6E\:#.wl.!&` cVU.*[o8p.f\Jk'GUaQkړ[.sujwQjg|o[<"Tﺶ_5ZݕMn˱.Fa}rW_]5o\<:Urn &?='eQ{ +j'tH88ltQRyD@DDD@0PQInV,Q<<ͧfRX冖״4ε|XfVd[oijAG$ fԏAn˔ڭw?LR-5 -fm'̭(4C\@ߪe\ԲhXR2&H!ɔZ3ߢ@Y,3Vk HFP[!V'{{.nDdTF07^KXKA:]ȎKY?@KkHȦ2(HF7au ưtᕅ1# GYxFaETm ېM$r#S]lеāU\47". sdD[#Һ I;1Qw K$HÈBєJ<Иdu:;OX9r^G~yE['(] Յ19X/Oj)eFS㥎Cfy^\MápY.[JdVPBѠwE} Apv_~jhW=4Ij\E$HDGG1=r2j wO}+ ?%Q9@7$7Ċ]9k&gZwZk[+>Ve320@#E$LH>a$HlŞ_e$Xd:} >UҤh٧(h<O/vgܯ(GI4^ũcsBrėĺ/5:8%وK%;dntwnb/5[+Ym{\^VYA2EN< M#^^s}ւDrH\˳<([S6GHr5`>NRrK̬55Gfn+\mDsXf.{|]dFftMmT'Mf+iɯ&r3s k `x6&@"9c=r//f([HOcQLkNM^=GO$d9f%uqq#]m.4UGnQ9I&$ijs2dx+F=8e8x<ӤRȆV1Iv2N]ؕNB7ЅDc/mٱ7ؕtGBVS9r>5!]TԠ1)6eSqϹ-Urb@rO`UEt8_9ņV4bC\@n]W=k6<׃{N%s^cpqٶָ vq֞5ͭ}QTۅѯcwՉ Qiz)487H*֢#FgFcc2Ṱ̳ 8r#&8Iv]QM<-P_墒RD.o˦&TTTTM `h]l^fñ%' UKKˇԺ`]&ݭUY. 1bՔ A=vSNo SR3Ucu`AdJ222?]oueEɳJ0x)"T qK!_ U f#4qز3[m7Ԏhhc.k|T ȓU~G2<t{藺t̖;PI.kpM:JOik/k%Q!!Hm-D,77UͅImqi~#RX< S;<t9/.AUOy{7]CVG\\jm5MMɮ(y $t_[cnH=|Jˇ0:sZ<{oUثXFhFHAmwE4q]J9`5oԼTjpaq&cmaQV+hi!@$UMNr^D4(ŭ};iD/cCA/o*)4E&׸l 5X<'g<^PŇ"ѓ!/vKt)BjsJj/+pa4OwPj ??8k42=ͳQ(X1lZ㙮Wc5pB6.+yk)mU\5Z"lA֍͍I㩷Y)(x.m."./ipL^K燇ԍ7쨗caPpj/c$ 9SLk̅sSYF\L"" qx@kř04LfJnE h?))ĒmK+$%9,\,dlՆF'͟ \wJV" DrY.]-xe3xfR! C#0\V0к7DAkl{oZ{ I$J`uF! mivUe4p_K vAxQ}f!,1f!kFu з,@oZwF{кRTJy%$ s/LH]}J|S%s+_97#i +Xu< 3kWlSC7U+H#s{zkw űel^{h'idU@\SD_C.yItP7:*>S<>..Pq(1O*mgOɳ}7:Զ2MtP]]Y\]LI!l.RFQ]_AMmQ̌7$`A4,s]HݵrFʞWuc/kExa >/&Cż+d| >f#ܼ^5pMgsӣ[dRk+ie|:I\z瑑 J<H^\B }U#1y*KGF߳;; rB]2s[Rpb~Rek,S GT08Q "Um$ w)6kjx0ͺ (]~KX`̌H ZRJp `4'caT3ZuHp6jhSxڬ݇6QFYI,jd͡E_K/c\/ _ 32>L#Q__4:-%Ѳm2Ku\Vx> _W|ҼAGrz3xVqՏd,Em7{bwk8VnjpSYRt~bָ4:Xq,PV s9Ϝ玲6V&,X@o&*w[ouvM33 k։tz:z 5f+lOmz<YRx;. {?5H*Oj?vC?w:JV\O sM>'> , ks@r1csxMDr}ifP\|Mw#uU^k96^=Uw2-}FWaK?2GP[\ƴj@YeGԬI6ףEU xj8|2ZO$QpzkckbYυ` 3Me:/oGw+$1K3ѷ=ѓK/]cX)a4CK)yw ]V6Z#lvE#<_ë_-RH?KR`\1Cq`b_[[4ik%{Zwj4\Io_4\퓆|iVpRAKO рV#u= u&yͦbE4Q(Ϣa|%Q L`skXM fM1^ ~SsQ:J_.Kg.jnOݚ(>mED44 .>줴u*{wz4)6< ÈFH5$R"""]@v؛sQcϝӠƸfRT0vmkGK6X:(& jeOOkbtSKsmUbƣֺ2ɹvp:P~O5Àm}|-\kϮbOJ5lt/\C Mo{6}_E^\,/4GRrIe_<-WǁR:*1tt*.5u!r *<'~;o.3b<tkW752RKJ(6f [DJ4ʖm̑FnYoնu3<Ì+|S[}2?T~tًiAUD摍;h]07hW=#혎/<5n(SV>f7{Wq!!ODZ9Y˲2:8n Zoym]lJ=헃2'M(&a;꫸.I k_6…~<ݙ5skѵ>G[??vCM3Ϙ73aaoWv(}aN:FnhiܨU~m|-B7vIE?ǾO*)#Azm-,BVq6~: ,,c$S"dexqh6}N6l$d_iI6< XYM%gWMACF ~nO,"!" """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ """ ""bumprace-1.5.4/data/gfx/laser3.png0000644000175000017500000000243311217461066013642 00000000000000PNG  IHDR (VkgAMA aIDATx=SrU=~%dI-;eG3PرaO`ɖ?#XTQ*Y b,KdMs?V|֧gFP(m?z__ ϾXiͅBqMFv986yn4r8HBZi#[1$u4lb$0νw>27ȭ RضRzM/]jIY>X^ezP(Tt`K0!7XLR!NF<*Ud\q!Q4ۗᅕ, ;$`E$vwccsS tۯ7G} W@׆esHI!FA ɫm4 x49;nubo9E t68eiR"2,K꺕`uiO*A0tA MЅfڅRR1R)@`>av.zah<Q&tAZe#ee(۵ڭOYoԊb2F כ^wNF^ɣ ]ƻ͛NiĸaYL,'W(& t]')N _'aN(EC( ")Z㏾j!i]bgOǣ0l; +l1*D _̠~ҶS J(N5=Ѥ> <"P, +zy/8AN#-!;bumprace-1.5.4/data/gfx/racere6.gif0000644000175000017500000000114611217461066013761 00000000000000GIF89a8w---2^V,ZZZQQQ;;;ͩ:::pppnnneeeccc___PPP,lllkkk```BBB6///{{{jjjsssvvvqqqhhh[[[8885444xxxuuudddNNN*d VVV\\\bbbiiiwwwaaaYYY@@@***EEEHHHOOOUUU]]]^^^TTTMMM000222333777???DDDIIILLLJJJAAA==="""!Made with GIMP,   !"#$%&&'()*+,-%.$/0!123456)(789:';&%(<=>? @ABCD929EEA(% 4q2(ADő)TXrK)ZX$ɓ(S\ɲ˗;bumprace-1.5.4/data/gfx/2playerteam.jpg0000644000175000017500000001156411217461066014677 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222d"B  !1AQ"aq#2TS$BRbrCDc0!1AQaq"2BR ?EťpYE\ƪXE诨M-]@w6b> ])-CYzS)#r"+EWF,Щ).d"w;(BTW\BrԢL⊫oV22{>j!vfE' N\}ɔWk -)㚥oV22{ꚢ/@j?Ȥ *fOuK3 7q %م(GzN"ʤu0%E'e1s3jͽ[>bR)>J㰝6ͽ[jK ƴ*!TtiS[u;[iT뮾mf_O}-/=e\TUF;"ke O}agmuS"?yE xvz*nzWޭedZMܪ!@MX6YE%EVUHh 9YIέ=Z5wMז5ۈ)#ǚWH uk`:FyjmUIľsYa-^=%]aٝnk vV{o F̬"uAՎN̤)cVQûOghr[r''2{o,*)UYrh}Jyb0dLmQVT.=NTvKć*w+" e1yOGdpHa"OYJØy_6FZHHNJ_H_Ks3$b)ψWW2цԙ@=uv&;$qFk<HRYc|ΞTIq3#,y﮵[8e=-ԚJ+Ԭ/[_Ou|nBlvዮvA*礱 ?P?iG<OFg7衎 2s$Q߲BT(xֹ"<jXqUC5;۳$ygc#dfi]J n;Ʊm1 ْ9fXEbɣ^ +9#;ucEvsb $NkFv Y@1IGkP$UbHPoIqѤgRSk7\g%+lqw09DŽTErY7OUvmԣ̷q6W! @@sT73El9^Mk[h%7I 5+u>j޵r$GwGS4%7n ao><֫T"[YPT &;q*D%C#ק}-uF橺h-$f4/RIXcYՊXA0'jޮ⓶N^P*nND(r\=tMwe ٩;OB7w"s=dTmS6"`p_*iI5oyZme%02qqޱ,{8KyFrwm$-590sOvMo>NziᲸyUkFpgC -LxɷiL:H'H1H>׺Nn 1䓎t 522E9^kVkW>ךjAj' +:x[WI`'9隖0TR{ɧG[MxVI S]A^Y_)F=N[{Kx*Dhm? )qE\Jf?i;Y$U &-\dTϛC[ĩ^@NpI+m:H젷l; 3҇{ӲhS=5 ,xXgYjv:?g&=Ɛfw@yV%YmBK#aLJx˾?Ew$2BHdx]w Nm:;]́3֩JI&$Uf!o. HTyDaz笔ΓfV};¿cP+?kWMMd;-omܞ; KL+l#O~shQ~^MKR:d;2p7g+mNk[~U=@TNgv6v#>5MӮgӳ1.fl }fMJ2+u"ODcUϾ@,NYN5 ۺNOZؕeYeD($ֿ,M}MF3Z̉KEWXG隊]f i(& 3{ߖf=> < %0dmq|h):MZAC,#ubI"fGΨ[;1pa:5KdQDIO*FM7S۝F[DLv=q箢fGε=ag'8>zaO]1.+]HS0#(-] YSc;ski#,,Bpݘ8j]ir0[(d=ӜfT9*RnW|7a7& >7Fdr0--M:KVI32Oy\4pn"j>+u(rKM4̗c #yHdufxAI2ުݞC8.qΤ̳[jB쌝O B!R6WS(99?9 aBn-[hH%WwL=ZO/҂@->{}FIV W,*ڽ 0fZi[sUgΧ>rcqW\_3,'&0aC:k3 .y3 Uʼv]ܨFؿԇc@c'󡘳hi\a}J'c5sث'}i#{9@ޢ+&]3z59 msߜPV:m00>U͵~a:G.a\`6*8}xnO:辙ϰTԼdg 3=* {[\ldL1?_El<ca.`X:n9q%gSXVc/w='9)i^kDՒ`8/!Fq֑җvG ۽C5犤|QuHZfvp?JCS_&!P]_Dx{j-??w:}O'RygC^vV @m4qFO5!j eYߦfPnR1F?~t2bKy !BVAlI#p'>4564KYEsP,[u0-ZI~}e}J2@}f7H?*0;^QRa t7ӜRoe1?LC1`RSw-2JlҺTh*?hݰeO T*42(a?Wr'ی@pK.>WA_9sLdof-J2+kp5/$|%xcSs%AwYYY(WLkw7kwtB$JFP)NsSVQ'ȸ +ykΫ*[[,FyBmbvH8UdR=} M\#!RX< A{X 7&E8EQQEBQEQD!EQQEBQEQD!EQQEBQEQD!EQ bumprace-1.5.4/data/gfx/laser4.png0000644000175000017500000000240611217461066013643 00000000000000PNG  IHDR (VkgAMA aIDATxETɎE|uUWuWo B .8!}8!qqG$KF=3=MUoWfvHO/r{oogx}߽1כ;Ռe{>gF{ TEQY`q_zgn^2- "KcQ&|ok9sgjL""h; SfUJ²m =9I`zx3#74 dfXP TlU)2E'QF{%VHv=$YmųǿBC @aMC75&aںi4QM+=t122]qƫlDMN\]˹Fąeq%<'uqPյNZ7V{k< D-gr*hMiŗMw= Ƿbv,kͭl< **܆rB)s5'vׅ0tABXM>f/VTQEqFo轓~g ]׭D2˒jqۀOT,ʬ U︭-C  Ӵ4-1]_֗@|~Q$vY* >r1~JH7,kHHE݄:9#%<7:92$8,8!YJ)tΚ~ϵݷb :LFyT1Y%/9x1P5GPWdey^OG vj=߄S)+),^o$Ϣ8j{:7l$"`JJ1[p|\kC\7i]1jPZ  A$HQ,fglooF?; kdsO>=xo?FOIt̃+`םY.h^WLAT,\,K&^wF96rCR\@#V+hl:'!bL(hFyJ1^EpnK -7 5+,Kou[ZUJcY]UY !4Q"2i8f@L 18gI*mAq(eZe=-IENDB`bumprace-1.5.4/data/gfx/fore12.gif0000644000175000017500000000226211217461066013530 00000000000000GIF89a((___^^^]]]\\\[[[ZZZYYYXXXWWWVVVUUUTTTSSSRRRQQQPPPOOONNNMMMLLLKKKJJJ¿ľʘ!Made with GIMP,((  áʩӳҝܑQP[}ф#f @ :-qћB 0dаC@1D 'PPE /`Đ1F 7pȡc>~ "d"F I$d%LJ6q (QXJ!1)X%-\x&%bƐI'f><"ز&ʬ SP&Acu I[= V,ٗgӪH$rūbmY4T"-k=AqS.Eب뿁k{9 z= {i%Sul?'^s ӱvUVqm^MIW]VAMl"$xs5a^ՕJ!M6oTVrVr*gS&pZw-aG5ُ$y)ڑ. a|c\U"l'#{SB.$aZUf6f#znqNxh]xz:ʙ" :}} Y՝ f\'N: bx؛,gN1ףv&+@;ZfbJ&;p'6)Z >s66w22z..}))[ZOOOyyy^WWm__qZZ{^^kFFh>>l::p66Q##Q***NNNPPPSSSUUUWWW\\\]]]^\\OGGRCCU@@W<?@ABCDEEFFGHIJKLMNOPQRSTUVWdѲK/1ɔ1 4 q$6m. 2%L)ܼ&M80P3N6uعC O=t3?*]ʴӧI;bumprace-1.5.4/data/gfx/racere5.gif0000644000175000017500000000114511217461066013757 00000000000000GIF89a111aaa\\\CCC6tttrrriiibbbjjj___NNN)J[^^^wwwyyy{{{}}}pppccc]]]LLL4xxxvvvnnnggg[[[HHH???6666888ooosssllldddRRR===1(((eee```ZZZTTTAAA%%%,UUUQQQJJJ... C,,,>>>777+T3+++!!!!Made with GIMP,    !"#$%&'()*+,-./012'3(456781229&:;<=>?@AB 6lB*ɏ$,aG #9y"J)/M @Ȓ(S\ɲE;bumprace-1.5.4/data/gfx/racerc2.gif0000644000175000017500000000227211217461066013754 00000000000000GIF89a>*,F.,J.,J*$62"*V64Z2,V*$Z.,N&$>F&$>"22.*b>&$B*,:"$.&nBD 2.zVTJDRLVTrNTbR\26D"2<,$*VTfdvt~v|:BL&FT>T:<&4&.&.bdfdvtҊ*JT2j|.r:T &" "  ^djl~|ʪ*VdJFBT6D"&$^dnl~tRl NdBL*,& zNTVTf\jV\.*<6T"V\FDB"$z.,* j$>$b64v*$& fJ"$R:4  ^F"$B"6&$vvV"6"!Made with GIMP,H*\ȰÇ#. @QAh,`$PA D0!" .`Aà :x",P@A%L@,B 18*cFC5lC=bl  M "D"EADɎ%Px7!&M<E*U(Iq,Zn0aČ!SL3g\If6my'9tL+cJGϞ0|cǎY-~0 Ak*dC=H31#Hv $W>.a#$IPR%İ!`&p҉'$Đ W'8(lBJ)K@dlJ*JSD J*`X@" dqPF) ;bumprace-1.5.4/data/gfx/racerd5.gif0000644000175000017500000000031211217461066013751 00000000000000GIF89aGGGQQQRRR]]]kkk!Made with GIMP,mI8ͻ`(A Xi(dzZ׷L *5uBp!;2f BPG -aVR;j_[| z ;bumprace-1.5.4/data/gfx/cannon2.jpg0000644000175000017500000000237011217461066014003 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}*欚`fݾյ5*M;;%Vmec[d!T 8loTPr:+%Eՙ ПRH^va' Qv9|X;eywjo i~>.gM;sKg5J0> j>{<2,5˰Xdێ>lJJqTT`IIv^^sccvDD_::[<<[@@zZZx__u55Ր⢢OOUU~UU- r++hh}}DDJJOOmAAn 99GGXX::@@QQLLl;;((22==1177<}8(A r,D1-G$iУKN@@;bumprace-1.5.4/data/gfx/racerd18.gif0000644000175000017500000000042611217461066014043 00000000000000GIF89a;;; ;SSSQQQsss~~~RRR}}}耀ώ!Made with GIMP, dihlpBm!RECwЂxB 鮊5xZYKO]r9y& # |,U $-%)hMM1!;bumprace-1.5.4/data/gfx/cannon20.jpg0000644000175000017500000000235511217461066014066 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9qִ,䴲ӡ3egwTREUc5H;4u e𿌼?HcoF2 W%ԊoS[Xx.ee#9QSk]A+ F3gr¶ښb ,PtID Jp3 8 # x{s T"Zt_GaB<")\zs?Ila&Vc&ܤEvy5pA$q`Ldr@{w^0<π bkmw[/tt *##~^| +3y#aJggiRӒ'EvV7+ q)or8e@77bWEtj|Q{+;y«q?*([$2SnXqT%Hb@ U=GΊ)erj[uVgʮ @3(7bumprace-1.5.4/data/gfx/racerc13.gif0000644000175000017500000000230311217461066014031 00000000000000GIF89aB.,.N64F&$F"$R.,:>"$2"$*$&V64V*$Z.,V&$J"$BB&$:"$.2& ^64^2>>N bZ*nNDn>\.D*.* " ntnt*JLR\R\ *& ~RT^d^dftvbd*64>D 2<,&JLJLvRTRBD>>D",$*6$"rB<:",.jJDz:2.N2,b>4Z&$V"J6J2,N.,6"B.$:&$!Made with GIMP,H*\ȰÇ#. @ 8 0h&P@B 2d`r>!%L@ Vh 1d̠Q8r|Xc>~0DȌ!D9bI%K4qd!(RDB+Xh¥]zK1cȔ1sM5k`f7pșC;xdB=|<P :*dD(Z0 Fq=IY&QBTi0ef'2<}*%m@*"j(QJ:*( V-PJVBJ 0C,$G0D `K.A"TCRB/& 00Ì14` L0$3LE)lp S1L38S+!UiXf%;bumprace-1.5.4/data/gfx/racerf5.gif0000644000175000017500000000112411217461066013755 00000000000000GIF89a777555333000---***<<<@@@CCC===;;;:::888222///,,,'',,11rRRnXX2,,422???GGGKKK\\\UUUMMMFFF~~kk]]WWWW pWWm]]311666>>>JJJRRRNNNIII!!&&++0066==DDLL   UGGd]]AAADDD$$**//55<>fDDt''z//99DDf++f00f55A%%q##v**c c$$c((@_`?=!Made with GIMP,     !"#$%&'()*+, -./01 23456789:;<=>?@.ABCDEFGHIJKLMNOPQRSTX%-\,uL1Ɛ)I3jȱǏ;bumprace-1.5.4/data/gfx/racerc14.gif0000644000175000017500000000227111217461066014036 00000000000000GIF89a:&$2"J24F*,J&$N*,>B&:.V64Z*,R&,R*$B"F"J$22"Z64b2,^.,j*4V"$>F>6$*"fB4n>4v64^&,J*$:"$2** . nNDv6,~24n6Db6DN6D 6&$F> 6 J J~Z\RLZLNLvNT^J\*.D*:L"4$R V Zj z nVT^TZdjdrlzfl:BT*J\:L",Vv~j^dnl~|ҎΦ.N\*b|*n>T.D"Z b jfflޖ*R\NJ: B:fdjlz|Ҋ"VdN\:T&< . . ~RLZ\ZdnZ\*24"BD:T2D&&zVTJTFTrJTZFL>:D",$.2zBD:&4.v24V&,Z.4F$:&j>"$:*$6"6"$!Made with GIMP,H*\ȰÇ#. @ 8 A,`"H80B .`Ȑ &t!"0`%L@BE!XpFSȘ jظ#*$>*,6&$F*,J.,J&$F&$22".&V64V.,V&$Z*,J"$F>":"*"^:4b2,j24j.,Z"$N*$B::**fBFT*J\BT2L "&vtΆš&JT.f|&j>\.D" fdrt~|ږҪ.V\NFB\*4. . blnt~2NTV\R\BJ > &zRL^dVdzfl*24>D>D, Vfnf V2JLJLJTN:DBBD&4$Fz ^zBD~>&4*.JRzrfF: R6,^64J>6F2,N2,J*$F&.B.,!Made with GIMP,H*\ȰÇ#* `D 0pA .`$LPB.`Ƞ:x@"2 QPPb-\C jp: ~aF A yH#F Id &N|X1( LR,YlaI9r@ȗ/`ˆC3hkشqN9sԱǝ;x>U=|Hw@ShCIh-=I$Jt %$4m O> %(R0bJ Ѐ * +|J$  ,%BK-"- TK, /`*C'c0*S1pL 2"0@$0@!5iXfH;bumprace-1.5.4/data/gfx/laser1.png0000644000175000017500000000243511217461066013642 00000000000000PNG  IHDR (VkgAMA aIDATxMMo#iO*lDZI& b X? bĂ5 X! izz:Itx^=Gzgw4?ٯORʦOoۿ|voBLe&v \)i+pSI45J8-&e Ynݯ艏%WgrM&1F9J7=юzY`X- a8MLh^O/^'8@LS"}3=?=!n8:T&W,\P ,yZf)Ef\]^C n{w-ݰ,O{gGoʼ(8S iR@܃ϑgm7eGT*K(%=H Ȫ:ͼeA1]7  orZ"0fiZnG7}T9#4$^GX;'X(La:NMd\3, :N5[utl&ye97-?~pw 0LBrbDTY2zgstl)[ÓH!Rš{:;rqͿ44ZWy^_Ũ(sVt 3\U]aPqg>60j 7/i֊R"IENDB`bumprace-1.5.4/data/gfx/racere17.gif0000644000175000017500000000115111217461066014037 00000000000000GIF89azzz...YYY\\\hhh444bbbvvvPPP;;;ٌrrrRRReeekkkIIIFFFwwwɤyyyfffBBB&&&___|||nnn```AAA000cccнqqq???mmm쿿~~~(((jjj⮮OOO^^^LLL--- M)tttZZZQQQ<<<4TTTpppCCC1116>I\51*!Made with GIMP,  !"#$%&'()*+,- ./01!2345!678 9:;<=>%?@ABC=DE;FGHI,a2H'OD2a*XBKZp4DP/ 1dʔdʗ0cʜ;bumprace-1.5.4/data/gfx/racerf18.gif0000644000175000017500000000122311217461066014041 00000000000000GIF89a~~~rrr{{{vvvlllxxxuuunnnbbbzzzsssqqqXXXwwwtttooommmkkkPPPpppjjjhhhHHHBBB<<>;;99 b((e((99887744o##,d##h##332200..p+dg......**) cf**++( a!Made with GIMP,         ł !"#$%&'()*+,-./0bȘA<7pб?=|DȐ1rIJ0i QLRʕXh¥/3L3gIf 6nGԁJիW;bumprace-1.5.4/data/gfx/fore1.png0000644000175000017500000001265611217461066013475 00000000000000PNG  IHDR00WgAMA aeIDATx=Ɏ,Yv]׹un̪D"H4D?OM4ҌU%3*_&"vGFfgξ&m8S\N2{V5+Uf<%İLQe{cdxDVj)~` wV@?2| 5&ƧGۄ?ceY?f mk㻩Xf o_r9?8~M_Ւ 9ъw\nWjZ1)4=rq#iue^(o9nR `1)M@H?\U4z=ϟOOooK?Ē~[Sy?v>um6rzNWuͨח'&M_RC/w 7궡TdJZWU*dZ~|є?4}/7Fmyjvo׏߻.Imh}]+VJ'o<M rnRH) JI+Ej-*B#Z(9\ 1%RLtrf6j.^~00lϧ;OF?xZ\/rx:ǟ\>Z7l:aec)֒b`lv9/T8R({жv]c,~0v/quey{n5LJڵߋ]ne^; Jp'\ &p |sA+Es݀o{B?~"}Dӷ'Ōˆ IJ~1]/FJmn}oB߽7˿9ޅmvݷr/1D;Fwߒj8QkKZWzaY6olP2tT5SaΓ&<иyZ+2.} ђube;(Y @1o"xR#㸗~G,v&ՂRqiviUrlۮ+Mv.g5VnK "LM;jXWF]3Zi+T$ZD`L_kp]SZc i0HJ\МYn7[4'kޑrArƭӊߏXkp}$gT )FCဨVdž@GVr-y 8H1!JU1Îa<H,tQu5P*x8K YZ1;l+ƴ-q޳. ŢەZ+1OW"!֐mg,9%tМ)EQ9r)ZR k 1;XfjJQil⚆y1pGLEig\"LIt䂄@)E녢 Σrע Qk8iH1c,iBOZ7T]%cvCkGh$|3otOo0ЪX-h^bD㼨֪T|4W1r?e-YlNh]K\[D AUєBjL\q"(g,FAٖ )QclJjU"ef>Pb-b,V %&̮m:`#D]\}Ki12hvo8rCajEtȗ~#%|L7hX_Ϩ! U SrZѦ!tm۳.w֘H˂vF.~#!֙zkM`Fvi!1@؜F("1#.^† G XwI됇5-a V郣5 ʖ"xuA@F]6aÑ˟~DFc-Xjθ)&wXK$K ׷h1]ve=Z0}1wΓrF"U1aRWb׵8`=_1}plUVnZДU)c6 @Pp}KJrTyC 8k0FĂX+Xk8*i 'Hg\$=G|>)'E1=͸hŔB6Rw<jE=&ΈVJ6nXJ-,L]fA1R{TʺRc .$VvQc=,y+HZWn?ȗ+-ibB<] 1Qs⚖rR ÀiSsE*J6ҺWd0"!MӺ1#Ҵy]i3;ۍ#ZxO|yۍ~ Ӿ}x 1J* %b*h8҆Zj)-C('$Pcȿ; gʶS)Ssm0. T+[Lױ1.W',wi#34ar k)Zє!5BKW&RQJ`߶h@UD+6,0#6MG}TȚi]ٮ?>>| Bʴº!#~<1COQK""%%1ۢu)`\+]SƐFk,b iYw#teYVjBX axʺů?Ju{ J-Kض|]CKʈH(T{e9#!0M3 -땜{b0TeAg %%®W)M`y}0 //\:L"Z cQEE(quFHL"✦;b-+MӴcb<p|, ޮmED; Hؔh}`YV&44!{*9㻖Z+Nڡ;K|=QA{CS'Nʲ=RLx5/?rAv5R2PQES"|]T0@e|| o ufkHBNJ-U]߃w0z}҈0ǧj8d˅*MKULkiAEc 2Tb,%R) &K)Yo$4A"zĕuQx/5e|-Lۆ+2f(1cx珔Z1mnR+5;l y]xPH,q ["Pvw_X"$G jyd=Oj<}߳mH׉Z*1%®͕3" [F]OR!y( % #,d~ZGL a7#/P+0/ :/lͮk6}Su2^ە I3!K l}YRrJ`؎PKCW,k,ѮCs16-4kwoj2iIZRݲNSi2lۊ<LJG3p`L+mα=cC~G\NJY.e޲8~\ܘ2߯0Cm̛'7}~SEH !.3?_ߔh/_r;ݓ ;А*|:!,º,e ض+Vi 0}pogmk%-mJR(Za o`*B:H[{8Rvw T1دJڧ'%됒0R_^vuz\SgT|wLzo˟Ƨ7}쎇KҺv)oP 1Xǖ7fݎ6 oOJ~g\(㟘~==jmb6_~ןRCci/e/7{%}|~"N~xXoa.ldˋip+gc6olˊl䏟 g{5%%RWʶje=]QUiR9r9uoiOؿ\S'v]^CpSH{߄/dwpUT(5fR,*0RPg1Rئ+yQUm}?0MW-վyS-`)TEV:IENDB`bumprace-1.5.4/data/gfx/racere3.gif0000644000175000017500000000115011217461066013751 00000000000000GIF89a]]]bbbfffaaawwwoooLLLxxxXXXuuucccIII~~~mmmUUUzzz___AAA{{{΃KKKjjjQQQ111ppp666999ttt>>>)hhh444+ \\\iiiWWW@@@(((2 VVV^^^TTTMMM888+w555000 5o1ghC+!Made with GIMP,    !"#$%&'()*+,-./0)12(345678%9:;<-=>?9@&AّBCD9 9EAR%K4q (L@%H+`E˖0aF˗0c ;bumprace-1.5.4/data/gfx/2playercomp.jpg0000644000175000017500000001065511217461066014707 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222d"< !1AQ"2aq#TRSb3Br0!1AQq"2BaR ?ES1.YMʊOY5e/9` m酲?ul[[d ,JH&O6lN|}`snF0q2Ew8Q3ﮐ஡jl(Vo/'ƹk^ȤChxZ>FLX=mO/zݗT~"Q'ITS7:{\dZX02YYMXŠ){kOMXpw<,@'x*3T^+byXw88}[վ쿌MQ JJ5* $+{9.; lqO}[վ쿌F(5U %QT!`v]}[վ쿌\_yZ>FJ7Q[(d|k =&6{hy|d_PGRbTU_zݗKi7K{rTM66 <=ed xQZLaV4 bIgW#aXz**&+4SIg^"8|Zѭ fI*:ֹNÖs-0F4n?VV}XRA8%؃5=p+J V 0=bW}3;Eۖq9>qΧ闳\yf-IV Nꭲo W5;EtSϋ+4+*'zb;[Cb;jcg䘞VTbemlcR#~uF,$\lĜCew]@< ,]OJΊ+ mE#jFw0ZaOL81^)mu)v湃(bn{NT%!eF{f <2DdRmki[K.T/UzISv3o-GQ܉ h"v !Ӿգxv 橺h-$f4/RiRVu:Uk3]$M[|vzM#")HKǾI[xa5'iҨG1{_tA[ȩQK7,mDU *&k& *+)i`DIq6288 oX,|8K}Ǯ󻻭=xb\]I vMfL2믝h`xlUdFѱ1P ֗^@^rmvw/ַ R w5.FLy$k].6oLlmW>՚ӝPS T8Y]HںH$`vy9LԴFcM:?o̴eNI o2 7IL1p[ĉR&;G]ǐ=|ooqfM,[:*U@#L.ofsEPbi*ȖEL;D:Jd"Ӥ xIڳ>(w;/B=5`$`vjGpqMe*[`GBu+# Ze.TH824+nbo[ϟ!`$FBFFF2(hyԒeiM94PB8 -En rQ**݅\ckY"l䶖(c 'NhNC,3}fʡ0/5FsS6}N[#jƗҽdVphfdjT [y [UnϦ&L>ɇ 2Xf'x#"QI#NW {ebPOZ}17a7ƧQWN.}K{.Y.qֶP$rPdE6đQj1/eY$TR=E/E0YQQOWFK`'Kw :᰷aYzF6[o!OUֺԇ-٪ݟ޵Ks4Y EQ fN-.3I\%#ˈ_O f2jA$p=qwiJC[i}"ƅ~ُ|q\ejbm7!9V𭵟29`Ey#tQ̵f)jȁl0'+afPچ1Kv!Gc*׌2FqX- =*RvGh| G>5>B4+5?ko3S5YPǴj4&BSal$65 T QG]ȧ?Ñ֏,fs&&O%T-7ڼo*@/~)(|q5 N('U$HubEڡ GO猫}d-" (zl?=.N3IXrrVURT~U΀vv>6̷?9?]U9g% +8$2R{kI7W=.8@*i* h5r*Q﹖Ԕ^bV7зãRJXXL)%:Mh mQe˪ݰFcqL]K}3=[ V]H}E餵 xLY;OU>{o#$,gWۓxڃ kj4؁EWL=]-AGHRJ0atypg2C;9 a&7PcՅJ2SaqY 'N8ؼZm[xɬg/5XbV |M J뵤v_kH9SNdam*1{ʚ7i1i_XE>HώCfg9f$^s1LBh}X_3.!t}"ج @^sRDT;=V,Ә; sVnASbyki)pv㞵UJ=^N#J^~ rLk2,Hܸ`x85uG[v,24#.֑8A*ARA␤t*9[tER]sB!Y| 3D9ɒ8cPX,CyW\=aQS`H#PrXYר>>UUUbbbttt+++777CCChhhlllgggBBB^^^:::PPP111///EEE'''"""<<?@AB4;C43/DEFG/#HIIȀ%L84D'%hGA8 *UJAPdrǖ0cʜIH;bumprace-1.5.4/data/gfx/star1.gif0000644000175000017500000000047511217461066013470 00000000000000GIF89aeeegggfffhhhkkkjjjmmmnnnqqqrrruuuyyy}}}|||wwwxxx~~~!Made with GIMP,P@pH,Ȥrl:D$ !L$6$Ҕ'Jh# &8DHC sC!"#!$KA;bumprace-1.5.4/data/gfx/cannon9.jpg0000644000175000017500000000243211217461066014011 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>TkhIfQNN}3z?\䢕 YeuJ8<`TwyJDC6&Yԭ--gFKʺB3 8 # x{s5N3'NI1g"#;d烞ý=0Xc19;il2RI(|1G>[> Z't˫o"lnv0s9X#w̅*X眐MM>B<")\zs?CWѝʍHՆwGEJxI4xiZ?~YyZLm* 8w0U\&2[9 =+Tvoryq`dI|1'RF1yw70ȷ!K  2}0k*iggic#KKjߋ +Mrϙ?L4P!CJ$Nj5rH&%e%JZt ӤL).c%iXl( f@;bumprace-1.5.4/data/gfx/racerc9.gif0000644000175000017500000000226711217461066013767 00000000000000GIF89a&J.46,nNF"$6".&j.,$ z Z:22.^:4r"$$ F&2**fB"$622.nF&$>">6.*F4~>4z*,4B" .zVTNLRLFDjFT62<".<"$ .2& ~VTV\VTfljlz>BTNd J\ :D","R\flrt~|Ɩ&FL"j>T&4 "*" bdjlv|֒Ҫ*VlJJ>\.<&" bdb\zRd~NLZ\Zdblrbd*64>D,NLJTvNTVBDBBD",,zFDBD6DO $h-D&:(E0Өo),(ŋ(P0E$'1\ɠg̜YD9Sd S &PPQ9udi Q-\MYni4<i/ʵ[q;Lkׁ)k\ q5t܁]`̘m[_!G˜E Q )TȞMv&XpF 3NάF 7pбy㆏@BH 6r6(s$q=%D4AM|OyȩC=$x IXW-RLf`4(H Xz7`=T!aRXqŅ.d!5P aQh[ \KHŇ@Ė[fDJw.م ڈ00AĔK訄T\DuIg߆kzE0QśCPţfDTAaS\ (0\xV4ŪQQ)~b (P“zWh"(aMX1q %РfaA[tqESjE~-]llpV[ )Ćmnk]Kk (n/Zf Ŧ 7̰lpqFoR;Fhњk# 14˛1kA ,P&U>>2E&5" %H^\+'$ \@<&!M,*, D\|JD<+( c*+L{0-=t*(]62 L""VT./  ~$ Qtn>6d15DC<Dd2>T*,4DNo1__GP~& J[_&42,b:29p*228>OVT>4*~NԮ2,4j3KB8P!x ->|*$2D`PP7, *M7C- m64OMNhF`.D-%+ q Vu\22Z&&<&#,,8L}C@~&$ $:.8 |>\2D &0&m*.  h Zy2*,Z",.$!7L*z*$:=T:UD,8Ed-D  l14 Qu\7> (w~*<-;=bj"$BZ\ o^!Made with GIMP,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJիXjʵׯ`ÊKٳhӪ]˶۷pʝKݻx˷߿ LÈ+^̸ǐ#KLY6E2kܡs1tSe6̺f2{M9E|߼]n3ؙV^۶"dP վYufa 1)3m$C/ޝ;g|9bϱG'{gv kx)ox`gn(F]}-Ӛha[\aʱK.&J7(թHߋb3jF#gbߐމ֩GfꇙA$n('z:|A%08{_jM_1VGy9'=0]&|x" ڌkxEj ر.# &68c9ֹs5@ -F7h0BEDBF~R;)zPZ W% $ ӕjnT4l@. x._4⻜lAϏpHow+R lB:gr'S3-'G!p\ubA-^x!B"|\1YmWKNo=PSr.F83l"Ģ$c,qW- M8mr=MB=l7 {a'67s5'볚Y̬ª9X:zG諟 -pN ]ؾͻA1ih4hgXMpDQ 0ٝC Z88q3Ѵ8b5# 3H G¨#z8CvL`"p]aEXxIr/^/z]rLHe-13 &D[># dYI 4(qb (]+'8!aϨ@bQmц><^Ld=&RU$)xqatH1JrPF Y.-xFVZCWZlb$hh#@NG>RgD#yby%? &m5J"U#Ё'hIWr -| . 11i$fe6UYDN>:FUa0E:3'LeOl F2 (D%sy>TdlǪd)@Vҙ_?e*`hpP!u8 @n <VpbX  ԉkVjE1)?{Fr)ނծCۼ 5qtfvQD# +|ꝭ$op<>:kM`(F [)W{Nz+@!0F0 lý "*A+ڦk!Φ"Jr$~^> m@6"^ {A (7yQgaWAkRyRg}}އ}a` wz?}?e^Vp7 @ <Lb V\vuc!6h $j"1l vːo6Ge7r}:  Ɛه ` @i ~Lp@`f-肗\qan.d?J77wms'wxܧ؄m}Є6Pa +7tPt Ѕbj_fV`"dq|j7G @ox wٗ}yڠ q g m`8p0p 0 VpBY  pYWbxId, "&r""Wq&d(gڀ` Bۧ 60 ̀* 01P_y{&P'9P\1KEIIULg~‰q!!&a4؊P8LB@Mxȏ{b B/_f>;2(`\B" 2"$ޘ&d Izh(wBЄ)~٧ Bp0 "v89bU KC\>"($%֘ 򉠸|s@o_9XB% [I `a8yuY@UN,_dW 0# IJrGrI8V 镏Ppeٜ;+0pPgN@ _Su su3`5" 'Qh4Bo}Yi [)6 @\{ `YeQEKiCyW/%2$B(I&H"&(8 OxHBȉȜ\У ڜ0 `J_VgNR7L]q2Z5F"(" b5ȥ&'`;%y(*Y?zͩ{ JzYN9$n9/p0S *i"la;bi*Ц3 ?>z0` ;``` VCU8KQ4:y+B"z|ҔML[~ pzI*>zy*)  r0Ы >B96"r|B|c20:$}٬Ǘ"cDy)3* *\ \oP ` P֐Nf` lSGI?XD5) "!x2Bhzxvj<*`)Pq)늫ӰK L&p C k |J$ Q35&7V*ҁZڞIR'O8Kq(1ٵZg(` oPm m` ``p s 0 k`K]:3)a"@ yv-}r$}% Gv!vXf,Ӏ$lӻr0'?Z h ޱn pAp~أ>.(wHfk&hM2|S S#:N3w4cQ)r%bԈP ,9=@ pW ^p~|!HVoÉJ?d7C8B(9~`  A@qN$L˼,slk$^`EPHuN˺Ұ|esDϓ77 JVT 09=[P_o ˎ'%^Eƽl< 'goBpaO[рoo^bW; `0!PD:*Z1cu  8Hb^($ΐzgtSN=}TPj x KEhFúVAF reW-k7m07k;?!p(G <9U#UɹH'PQa2K,f4J6G k.XkQ$.r1bE7ep LghM۲55!:W< "Dj^/ yc@IWf?u6 wﷸkq+b 4 :ndIIL_}e/, y+;ͱ"E##瞋.p:p0P0뮉9}ը L>8[Bk?U'*A6CZ _k#ǝ1#Uf7>n၄ N~!zO:帎n#l%x=}&ڌ(pyC7F8=p&G^Ѕ.@!Y ΀۩ς?aa'"A粗S м]j4d۹Е$`?<.8@m ^BXx>Ŵ܃0}}v=?@x$3HAgD',nz8ǡaJ(#p Es@ in~Ȣ'.HψĊ/DZ`Hp2tePӁ#mPb(8<ZjMٟvE!(R7 v1HJ q\x2ǬNоp@MM5B6)@ d-YBUL AAdS(r]B~`i&oN<*^r PAwVTX4~6 C G)F Di@1Kpxt ECZԧ: Bk!njh*3 *av?'瀎# 'xDK},x2@0OG$p/,#j_ {j;RO(1>X6ۡ,:L8c&" 3qf :0etLllu7Vd$>P5p6]Ā1i07qQ( 3,pFvnֺXe1t0j` 9,pϬG0 Rwc upd#@q[G4 a02P_qf(H { c䫖4P/dӭ0elP7EM0N"%3aCU,dC쌕Ό9 =| /]P&y_dOcyKas/cwost=hBЇFthF7яt%=iJWҗt5iNwӟuE=jRԧFuUjV[) ;bumprace-1.5.4/data/gfx/racerf1.gif0000644000175000017500000000122511217461066013753 00000000000000GIF89a {{{zzzuuu}}}yyyrrrwwwtttqqqooo|||xxxssspppmmmvvvnnnkkkllllffnggpiiqjjsllummwnnl``o__q``sbbvccxeeUJJhSSjQQS??tYYv[[y\\z]]WCCfGGzzV;;xSSyTT~WW[[jjttW66zLL|MMO,,PPSSQQ}EEL&&DDGGJJ@@I ;;==DD;;T$$@G3344??@@55DD},,..<<>>11SBy&&|''((;;>>,,]9@x!!{""##==AA((&&!Made with GIMP,         Ƃ   !"#$%&'()T` 1ɘA8rG?D"E6 2rI%",a(HB+dѲK/_ #f 2fCF6mܼիXV ;bumprace-1.5.4/data/gfx/fore8.png0000644000175000017500000001265611217461066013504 00000000000000PNG  IHDR00WgAMA aeIDATx=Ɏ,Yv]׹un̪D"H4D?OM4ҌU%3*_&"vGFfgξ&m8S\N2{V5+Uf<%İLQe{cdxDVj)~` wV@?2| 5&ƧGۄ?ceY?f mk㻩Xf o_r9?8~M_Ւ 9ъw\nWjZ1)4=rq#iue^(o9nR `1)M@H?\U4z=ϟOOooK?Ē~[Sy?v>um6rzNWuͨח'&M_RC/w 7궡TdJZWU*dZ~|є?4}/7Fmyjvo׏߻.Imh}]+VJ'o<M rnRH) JI+Ej-*B#Z(9\ 1%RLtrf6j.^~00lϧ;OF?xZ\/rx:ǟ\>Z7l:aec)֒b`lv9/T8R({жv]c,~0v/quey{n5LJڵߋ]ne^; Jp'\ &p |sA+Es݀o{B?~"}Dӷ'Ōˆ IJ~1]/FJmn}oB߽7˿9ޅmvݷr/1D;Fwߒj8QkKZWzaY6olP2tT5SaΓ&<иyZ+2.} ђube;(Y @1o"xR#㸗~G,v&ՂRqiviUrlۮ+Mv.g5VnK "LM;jXWF]3Zi+T$ZD`L_kp]SZc i0HJ\МYn7[4'kޑrArƭӊߏXkp}$gT )FCဨVdž@GVr-y 8H1!JU1Îa<H,tQu5P*x8K YZ1;l+ƴ-q޳. ŢەZ+1OW"!֐mg,9%tМ)EQ9r)ZR k 1;XfjJQil⚆y1pGLEig\"LIt䂄@)E녢 Σrע Qk8iH1c,iBOZ7T]%cvCkGh$|3otOo0ЪX-h^bD㼨֪T|4W1r?e-YlNh]K\[D AUєBjL\q"(g,FAٖ )QclJjU"ef>Pb-b,V %&̮m:`#D]\}Ki12hvo8rCajEtȗ~#%|L7hX_Ϩ! U SrZѦ!tm۳.w֘H˂vF.~#!֙zkM`Fvi!1@؜F("1#.^† G XwI됇5-a V郣5 ʖ"xuA@F]6aÑ˟~DFc-Xjθ)&wXK$K ׷h1]ve=Z0}1wΓrF"U1aRWb׵8`=_1}plUVnZДU)c6 @Pp}KJrTyC 8k0FĂX+Xk8*i 'Hg\$=G|>)'E1=͸hŔB6Rw<jE=&ΈVJ6nXJ-,L]fA1R{TʺRc .$VvQc=,y+HZWn?ȗ+-ibB<] 1Qs⚖rR ÀiSsE*J6ҺWd0"!MӺ1#Ҵy]i3;ۍ#ZxO|yۍ~ Ӿ}x 1J* %b*h8҆Zj)-C('$Pcȿ; gʶS)Ssm0. T+[Lױ1.W',wi#34ar k)Zє!5BKW&RQJ`߶h@UD+6,0#6MG}TȚi]ٮ?>>| Bʴº!#~<1COQK""%%1ۢu)`\+]SƐFk,b iYw#teYVjBX axʺů?Ju{ J-Kض|]CKʈH(T{e9#!0M3 -땜{b0TeAg %%®W)M`y}0 //\:L"Z cQEE(quFHL"✦;b-+MӴcb<p|, ޮmED; Hؔh}`YV&44!{*9㻖Z+Nڡ;K|=QA{CS'Nʲ=RLx5/?rAv5R2PQES"|]T0@e|| o ufkHBNJ-U]߃w0z}҈0ǧj8d˅*MKULkiAEc 2Tb,%R) &K)Yo$4A"zĕuQx/5e|-Lۆ+2f(1cx珔Z1mnR+5;l y]xPH,q ["Pvw_X"$G jyd=Oj<}߳mH׉Z*1%®͕3" [F]OR!y( % #,d~ZGL a7#/P+0/ :/lͮk6}Su2^ە I3!K l}YRrJ`؎PKCW,k,ѮCs16-4kwoj2iIZRݲNSi2lۊ<LJG3p`L+mα=cC~G\NJY.e޲8~\ܘ2߯0Cm̛'7}~SEH !.3?_ߔh/_r;ݓ ;А*|:!,º,e ض+Vi 0}pogmk%-mJR(Za o`*B:H[{8Rvw T1دJڧ'%됒0R_^vuz\SgT|wLzo˟Ƨ7}쎇KҺv)oP 1Xǖ7fݎ6 oOJ~g\(㟘~==jmb6_~ןRCci/e/7{%}|~"N~xXoa.ldˋip+gc6olˊl䏟 g{5%%RWʶje=]QUiR9r9uoiOؿ\S'v]^CpSH{߄/dwpUT(5fR,*0RPg1Rئ+yQUm}?0MW-վyS-`)TEV:IENDB`bumprace-1.5.4/data/gfx/quit.jpg0000644000175000017500000001037011217461066013426 00000000000000JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222d"6!"1A#2Qaq3B'c ?R R RiGq@gA+a}~lKt}lvip Z)J)J)J)[M9hMة>T:B%^ >1 ])J)[=?jMع2#(5t0%i 1l(S8\q_-+%rP}ME'+*ݐy<ו4hAi1:IYXcPwĕre-F;8^)m?i<|5U9حcۡ,0Xkv qܡ|g <(T= ` \VWnqcÏjqv,rY}ayͪ)dvc8CxKE ܜ_'<Ro:yζƔmT;QB8VAEjX;a͍-kyBdy5fvͧ0`7lLվ҇VЅ% ,|6A A[T>ѵHS= ĕo'q8_U&ű6̇ajq8A|(d>h$5k/1b\6ʖeOOPI <˝>WCZU .nZTrxJŷtߴ|;RJn2LfpXU#)Pn%[JhjNce~[ZUzx +9S.n']4ϩ !5ՔvڿNYd{p_j ?S=z?5LBILQs–##σ\g: ř-c<*M[Gi5Q>:ebFfJNIylFIOn@jp7-(9* )y?K[]F"^SMEܵdm''89^ 3f3mR.{nǎkf\Cnr;/^n_# ^~Mش}GjYN2RJڅۅ 0+OMZG 8ܸKJH87gr'|**;gъ`Y '<3MLWFbyVzi >3%*,M#ݙ3#te<Ý)P<)e\zlTF\_D+¡Xpl騫sⵔ R R R RJvce&ԲRNNdyTHh==~yHJZIA/g8*q$aE d鄂c G'xIy?J*h^^a}@ZB}YsUfzm-(6qG9HAz0-F ~kWg][[*ٍfw7SaRrA$ʇ4J_5 Cr)n+s)p'ш65ѮjR!VR)_WMJAnc})!S=6:r(o'ǑVu][ ]N`BOqsAt\U05HoHmG'%ϧ 6kVlzVhv M-#`jyS 1ҷ:Zvۜ2nCpF@$#YzFF%IIͶ}h#uiz?׶~Njv:{35kI..PZW QV98!ϴzb]d6b6a0W`/ Ϝ88T R R R RaQLBugv`p 񕒜 wY!W0\scKFRyS==DtB5ʈpfOqao>JTẦ[ 0P81mNIx(7>֡68T|8 8x%BT$>TIs"+Bk#/t:R,avÌǏ"D*"1Բ"C0qmVx>ȴ/=:)KZeSRrRF1 #Ry! $4Ke (cpuݥ_ޢ wEŽFn7vfj(Ymv~s?u•m.+JIy*pN], *j%oU*c?D$Fb6jbZNhppy=LN9휥o9@? V57@M!*2_+ _j89>?Pw$:֕7YFPϳ-~F,LdFH5nzcG8YId"C(}%mN݃qˆyRҚ^Zy /0Rl&FSOk՟4RY^RB2p >|^8"/qJ ')۴ (dI=wPڴ68V򖖐6#jvG>x)U&9.)\ '$xݷ_kFsOsu6'rNA;UH٨(/OLU꩒ud0]=)ϐ-[f}@3.gd8 ߁縐G1Zn)Wu@Ě=KKgwgv9\ } ܭ5nfgs/S?QX!03(~W5\d~KO6hip>rAϞ(*FzeAyOg~Ґ[ anY~S;H]ot/)ޜm 8?j|n2mNuedVx"KQl푔GD[ʔp1yΊa_i_A + W;8;GoMOvcW=pߑOp$t𐤤mVW Jӊ$)%%FǟV=:@}pϵFmR5VK >]:X_#n)4keմJT kksy~GrOw~뵣R\Eѕ{3ᑑwG3lc!|u5[Iý[s9?kʵ6jږOwnВzjOc*̳FmAJOQ[v8<`p< TRAmzZݲ^O\tԠ/!A)p dJiyt}1,Ɯ>-D`88mcvؚ/J=k7 C=*ېI$'L(DOI5:vB@T@T ͧa.- B?+ Pzunp˒V̇JVBR$ƔK穗w_\$:څo9HP $NI)AO:ʊqme TZ.,” R R R R R R R R R R R R R R R Rbumprace-1.5.4/data/gfx/cannon1.jpg0000644000175000017500000000172311217461066014003 00000000000000JFIFC   '!%"."%()+,+ /3/*2'*+*C  ***************************************************((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?挕Tv=HZ-i$Ӄ ?k[S-MTr)hT An1[}G>Iǝ|@8Im*|Իw'0v ;8縍ryHe`;}j 7r'j͈+deXVU['#K-$ަ&Iԅ&N׭oGZȯ @[fu'"gvtL:>m??p<>>III;;;!Made with GIMP,H*\ȰÇ#: @b 8`  0hБ"H@$ .`Ƞa<|BK8",ZF 3h԰q":vA !R$I,Ȥ'PHB+dѲK/_3&/2fΠ9s&kشqe8o:Ƒe:vBx >MMLLv77Yf""g$$4477QQNNx33Ucd++..00WWSSz..ab&&((cc__XX|))$$llgg%%~%%!!~ !Made with GIMP,H @CxHPt`hxB (TpA 4l!\ b&NDB'+Lh PĐ 5lԸq9b`3Q=|XLJ(DD@X$I I'OD*U\E-\x&Le1cȔ1S4iԬaS7pșN;wѳg0>~ $hŅ BH"F4rR% MO;bumprace-1.5.4/data/gfx/cannon18.jpg0000644000175000017500000000244311217461066014073 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':Eqb«")8g$;UkY <ۋwa% F۸'p>v? )WQ]jȫ+bWq=9ֻV"") gϯU<.evos~~a/hֽ X K+˃c񃛦ũiwm:jXKdr x ׮|?aatVbcٯG}c-5h"n|<.Epڀx>n2OP b4_+ `1TV*=xdYZkacr1x Tq~%y>V2^2J; ^A$n$p:%'0$@îpʊ('q̨$Tۖ1w?2;hIR4X?.UOQǷC\5ږU(B (Mrbumprace-1.5.4/data/gfx/racere4.gif0000644000175000017500000000114311217461066013754 00000000000000GIF89aLLLPPPTTTRRRccclllmmmpppiiiaaaFFF666+++^^^|||wwwnnnVVVuuuzzz~~~{{{fffCCCeeeSSS>>>vvv___MMM...6TrrrdddAAA\ ssshhh[[[GGGUBBBooo///4 EEE===--- oU&&&.c 2!Made with GIMP,  !"#$%&'()*+,ď-.//0123Ҍ456$7 68+9ߌ:;*<=>?@3AB CDQE~AJ0D&O#)STdc(S\ɲ%@;bumprace-1.5.4/data/gfx/cannon13.jpg0000644000175000017500000000237011217461066014065 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}*ϻCyK\I,sO@ |GuI72qПRHA-p$8y'qP{tF9|X;eyנ|.?fŞ! &\sK2HcR= &5T_·}Vz'>?exz& 矻՛8KMTg(y˺9*W#1^/⾷K L,PA8q=ż(#WiIGx~U 糙4ӎN6=wb +Mr*,>&,:&$F*,J*$F&$66$.V64V2,V*,Z*,N&$BJ&$6.&^:4b24b*,^*,R"$J"6:2"fB2rNDnFLv64Z.,F&,:"$:$" " FD^N\26D.<"4 $ * . 6 2 &VTb\nl~nt6>L*J\>T :L"4&: >2 fdnl~|֒Φ*NT2j|&j|B\*DBFbdچޚΦ.V\FFd*D:D :N V fbNLJTBLrB: 6 r><><>Dz2B$& "f> LP Ach!D|)JpF<I$ړ@T%L dҴIN> DQH}ŰSR*R+4BQ+ ,!4,b+M-AA0.̢C/+ -"Hd/$@@Lod1L2ʄ$TVi;bumprace-1.5.4/data/gfx/racerc18.gif0000644000175000017500000000230111217461066014034 00000000000000GIF89a>*,6&$J.,B&$R2,F"F&$62".&V64V.,^.,V&$N&$:2.Z64j24f.,Z"$B":2&*fB626 nNDrB&$2."JDB\.D" " fdڒ2ZdJJB\&"^\r|n|&FLV\N\*<*"rJLZdVdZdnV\*64:D 2D,NLFLFTVBDBBD",, .B :2" z2b:4n24f*,b&,R ~ > F2,N.,Nj ":*$>"V!Made with GIMP,H*\ȰÇ#* @D0pA .`DP aBHTp Dа>B$20qb)T`0b -!C  U԰ 9t# =|X$!D9$Kx`¤\N<E*U\G&eeeyyyqqqtttuuurrrmmmjjj$$$?=)(((111UUUTTTPPPKKKEEECCCHHHNNNZZZ>>>FFF )))!Made with GIMP,€    ! "#$%&'()*+,-./0123456789:;<=>?@5A!B CDEFGHICJKLLKMN'o޿q w _b_nۗ hY3s%|ؖQ[j5jVSqijg>-10)[ 5sѠ(;ϡn3-:hP {ٿpQD1qAZdꝴ3*mWJ)X1O4!!dwW .x<`'XP]/; ࣏DMn9a`)-38rh %*Ø+](yٙ[{Cpg >T!:бM,?_L3*qK,T3U@Ff皊uy^[P'vbI;Ȁ0Fb+(V?"L)xkjVE1h 8Xh^KE:XB4N76JT*?!UPJL+%kXN[ojHdbkMt3 hc)T0mR27%3tro N+t4@Fجs1mvـ3 KE,t)9^ :E+Ġ*0` +e4ٟ 0'<_",=y7 I]x@L4>J,qDe>#'1\+J5AqPViA*E9%u@1Dٽ?aOC)4#yyeb {.^X/Baĥmw)RX4_ }v2pA,LE4`8^PA3QCGwp1U bs `$ G҂Fn2|#HG)28,/=q_X~ Xd1'q =@!,x1Ȥ  (#Lp!s1D+I Pd7|{V.K3 ;Ҧ>}SNIL"\f |Ђ#4JJr"E'H|4_2Lh 0> > NQIеkNO >Zd*@0T 8@B>#á\#G8ҭԲ\DxB8R Ƞ3"PdN@׺v(%PO# QhbhqyPT/JigC8개*WK]c[qp W SHN}ЧNe+[l/pL:5[`ʂ hEPäonlt/B 32hy w(WP'aK§m<R<6IY*).H*d&FO}8 '1)C0H"{@gOdb U'[\d%EC`[Y$πffKǬA_|jyJ@6=&1U F*J t:Jq8G)\5gA/d- kuЀ htr'0@8M$`Ő0qm$J|q $jjc}U]DrU]Z C5'9)i % j1)6?}yq (ȠkzC73% ,1p+ v uƜD|,^G3ňu0:*h*< MgC_,PP4Sw^Xwd?*Aub<.vKRyzt|΀fّTIx^Gfqgm[lf9]n6FQ|" @I p,VtHff|!; M⶙sgČ/QJzP 9t`8@Y8 2zI`z ɛUfNX\ifHSXPh0iQp",F ڐ P ]'yd$d 6@VɛY镯&b?%I#t_r9?_8=JBJ"%[!'@a w@'fWt.wcfi9\.Y?F3/֭Ƶ>@ -/ O(P%~S>cpkT 'rK'7%oN(8 Y + -í. 1>Lp$F)YIE6ڠ18xv6nGY&ROjgź T:`\ e@ Ç/ cұDYJ+W"ͤ$H@!l D&T`J) ;` (B8?Cp UZb2ph`&/n4УB+1.;.5z2UU# LDg [ilܯAS@> ͖dMyPAi rʡ ن(+ CuV#UISZA"-lT4LmM5hH!+(FR%KղR]u1qaUW,d̓zn͘fr5:ji @@BQ>fFu=Ytpԑ^Lݴ$=œ<>3O*c襗{$^h\w?|#>kFH{ic Ǧd!d %CPIPrWB Öv 5>PS7ŷz D<;oZ 8{aq›DgDqu?#!nz\ͺ)8u{V-qb[<!_Xŋ*&`&Ex;M7=I3(j\]3WaqC5TagRe6LrGǦGc@oZ -70B+ #pӈ>TJqgJS2KtA^Nw.`;`*)aT6q Ǝ1 W1L΃[􌙨Nq:8 bP Pa3TP*,jTcB'.`8'-R 8տ3Y$B/qZODj gtB"( 0Y> 681`F!Rw&I&8M(] X`= Pp CbdRTG,/+tʣk0FLP?Ȍ}'e9`fC a͛ Gy44Rj^dx|*HéBڐ 8-%3)~Sh[zSYg^NGс9jFG"X3Oc)eK{xp _4=3~)7S6&NlE+*P2@;|  F+ĘMj+mK8\ݑKZc%> k$'ƞ=:Nk7gLBi!pOVJ1SO05)_WF@`aim)u`Oz I8ސ$g:VNéѫΛlʟAڲ6R!x/ٮ(`*%PwY1ɝ42sY0GSfTމhmp?5b[~KKe657Q+7'H m{q%A.aDw =33`3.}9a=h6 b۞ZL 7S2yqg<oz3*-)F[XJW|?aaRXGu kl]iϮb4cG9u_sMgI3hm]ʧ4p;Ɋ떇PF{0SF!KT̴M޴; BzcYZIFIE$C2WɘTOKGNM^hEPy0šFOTN\O34qiN$L^()o8tD45|$]DQ|`P źa4E|E4O=ϩL}W$uDHѰ$ EIDXqNLMѲ9,EȋA4 L聻`QD|I|(϶ |X.} / Ӷ'`X9^ʤMEXEK>T b̄ExTLoPS>I#A@XM-ҙYU|Fd[` ղVaEVSRduVeZ9gMiluBonopq%r5sEtUuevuwxyz{|}C~؀؁%؂5؃E؄U؅e؆u؇؈؉؊؋،؍؎؏ِّ%ْ؀;bumprace-1.5.4/data/gfx/back2.jpg0000644000175000017500000014754011217461066013440 00000000000000JFIF,,'ExifMM*bj(1r2i-ż'-ż'Adobe Photoshop CS2 Windows2006:11:09 19:14:44 X&(.HHJFIFHH Adobe_CMAdobed            x" ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?=!DJSԩNBdt UIyiC!K[;oBr)JC).J0[A @0 pdBdG  ’I$$$I)I$J\F ;L"Cc4$JKibTJyLRKrd%ע5ӢҊ KHd=! I@RsaEB+ZZ4'ИHKjJDj$P*R BʊI)D$В4Ea ;LR9s! H(Sڄ[ !DPP/0!'rZrM((t${%EբY meՂkI6!23D$R image/jpeg Adobe Photoshop CS2 Windows 2006-11-09T19:14:44-07:00 2006-11-09T19:14:44-07:00 2006-11-09T19:14:44-07:00 uuid:84B880A25570DB11B460B8F2084B91CB uuid:85B880A25570DB11B460B8F2084B91CB uuid:83B880A25570DB11B460B8F2084B91CB uuid:83B880A25570DB11B460B8F2084B91CB 1 2999740/10000 2999740/10000 2 256,257,258,259,262,274,277,284,530,531,282,283,296,301,318,319,529,532,306,270,271,272,305,315,33432;AD52201523CAB9F041C00B1516FE0281 800 600 1 36864,40960,40961,37121,37122,40962,40963,37510,40964,36867,36868,33434,33437,34850,34852,34855,34856,37377,37378,37379,37380,37381,37382,37383,37384,37385,37386,37396,41483,41484,41486,41487,41488,41492,41493,41495,41728,41729,41730,41985,41986,41987,41988,41989,41990,41991,41992,41993,41994,41995,41996,42016,0,2,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,20,22,23,24,25,26,27,28,30;877E84F91927E2B9BA87698B42667459 3 sRGB IEC61966-2.1 XICC_PROFILE HLinomntrRGB XYZ  1acspMSFTIEC sRGB-HP cprtP3desclwtptbkptrXYZgXYZ,bXYZ@dmndTpdmddvuedLview$lumimeas $tech0 rTRC< gTRC< bTRC< textCopyright (c) 1998 Hewlett-Packard CompanydescsRGB IEC61966-2.1sRGB IEC61966-2.1XYZ QXYZ XYZ o8XYZ bXYZ $descIEC http://www.iec.chIEC http://www.iec.chdesc.IEC 61966-2.1 Default RGB colour space - sRGB.IEC 61966-2.1 Default RGB colour space - sRGBdesc,Reference Viewing Condition in IEC61966-2.1,Reference Viewing Condition in IEC61966-2.1view_. \XYZ L VPWmeassig CRT curv #(-27;@EJOTY^chmrw| %+28>ELRY`gnu| &/8AKT]gqz !-8COZfr~ -;HUcq~ +:IXgw'7HYj{+=Oat 2FZn  % : O d y  ' = T j " 9 Q i  * C \ u & @ Z t .Id %A^z &Ca~1Om&Ed#Cc'Ij4Vx&IlAe@e Ek*Qw;c*R{Gp@j>i  A l !!H!u!!!"'"U"""# #8#f###$$M$|$$% %8%h%%%&'&W&&&''I'z''( (?(q(())8)k))**5*h**++6+i++,,9,n,,- -A-v--..L.../$/Z///050l0011J1112*2c223 3F3334+4e4455M555676r667$7`7788P8899B999:6:t::;-;k;;<' >`>>?!?a??@#@d@@A)AjAAB0BrBBC:C}CDDGDDEEUEEF"FgFFG5G{GHHKHHIIcIIJ7J}JK KSKKL*LrLMMJMMN%NnNOOIOOP'PqPQQPQQR1R|RSS_SSTBTTU(UuUVV\VVWDWWX/X}XYYiYZZVZZ[E[[\5\\]']x]^^l^__a_``W``aOaabIbbcCccd@dde=eef=ffg=ggh?hhiCiijHjjkOkklWlmm`mnnknooxop+ppq:qqrKrss]sttptu(uuv>vvwVwxxnxy*yyzFz{{c{|!||}A}~~b~#G k͂0WGrׇ;iΉ3dʋ0cʍ1fΏ6n֑?zM _ɖ4 uL$h՛BdҞ@iءG&vVǥ8nRĩ7u\ЭD-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)KmAdobed         X d  s!1AQa"q2B#R3b$r%C4Scs5D'6Tdt& EFVU(eufv7GWgw8HXhx)9IYiy*:JZjzm!1AQa"q2#BRbr3$4CS%cs5DT &6E'dtU7()󄔤euFVfvGWgw8HXhx9IYiy*:JZjz ?X/B䚓Rw xXQDrHEz|x44KArAw–*[v'' xUYQ Ñ]V]qoqo"q I1ʂHއdѿmYpZWlU lUإP)uqVx(^\n-]\*qCu[ aWbVLUjhqUe8VGU TVXþ(Xv Gq7*, Ui=;KDBӊV+X@UثWWv*7݅Q[*W^F*qBaC~1Kت[•UIָPu)0!Iԩ 8c dRJRUثWb]v*0vW'#*9U[[-!#<,ƓFYH#RE4Ddu]Yp*ojt߱튵v*i#JR0ňH"-O*UWEr+D9O#5&Bjd?i"{.[9$f(@ц,znh'+4Qp 4a@zNNMF*(e-C )SZ=VCDm Z*⮮*⮮ث[*8plU*UThl*88*U Uݩo\LTbYUV-Ww\P-­a*$b*dR\(oh⮮*8PBjbUj⪊ءup%ثDaCCKW RUXGQu ;xaUVV+N)pҸÍ I jk]M_kv* Uثu4nX"]2!#(ufc0-̓H-Êq%xVaWb]CJa=k=rw" :Um5up+H5ڕ*aVWW5]Jӊv*][*8Up8uqWWjU­W..o8aV]L*W+v*bYT ]bO\*P+bGS#|R]+qWUW*إءqU‚S*W*+S]-8DxaCX={bJR]\U}T<0E|T)0Œ{`J1J`J1UάHBE|wV]vv*UثWbE q:bb`ŒqZ#\w])˕_\|UGonP~x--bt­b'N*UإثWb*qV Tezr+D,UH5$ޕU®Z*(l6⫱CT]lb#p]WʼnUV تFp%GjڵָPUM)Sa8RaV*8qVCXu[^*+S*ձUU†V\*|-`VUf(:Re4*,+1J Zp%iRUثVh@'5˦*v*UثV$IԜUUvv*Uث%N\cRURAbP [?&>"*jqWW]qVVWUء][(jvlU⫁J7 IAƻWuWu5ڛ֢.U†Bpp8Pcv*­U {[k S ءQ[lU}F4WlUՊ8Uc^xUi4Z;RF*F)[Zp%ZZ *U[\*[ qUPqBlUv劭8P|0+Ku]qBªn.1J RVZj;`UMbA#qVv* UثWb]jē@*w %u*+̓: #Uœ'TWrWqon=W:m@1VV늸*ZZ8WbZZ]v**U[W}|Ukv*B ]\0x[b}*N,WL \U]\UZ*u8)SaZqdkZ-bUnqV+qUUر!Q[|P bP RCXL*NE*A GQ!iKGsqKXWb]]v* 2[pd榮\Ⱦ4N@XUQJ\UUثWr亸V\Uث}1VWbZ]]\UaWb]v*URPuqWWn†p8x8PUث`⫰AlS8u« հ*8⮮ثU]=1U3J튵\U6*g8iVR(k\*qC\Up8pz(!QZUZqV늷]劷Z]i 1JIlR0#l XF)Zp+G]v*Uث*s @1m)qzr#+bXl4m?HZ]v*UZTaWbZ*UثW`WbU*UثWb]\U^ثXKV늻o:UUث`CxP[.]\Ppc*L*l1C`Ux8gka▹ UkqU*ثU[hRlUi8Z'hb-WqV8GhJӁ]-UUثcl(]*Up8Ux8xo$/. nplUƘXӊauTV\T)2MXFKHbKWb\;ZWb]v*U\ɬUثWWuqWTb8RqVWb]v*UثWb]v*UثWb]\Ub[…qBqB`⫁¥xCRklXRثXf4vsOثG`*F1N PTw~Xڵp%caKXN)k| qLUiV)hW`KXXWWol(]W  \XP`U⫁+WWv*2ZqU)2> XF)[L hUڵ|RqWb\GO|UثWb]\ءثXثWb]v*UثWb]v*UثWb]v*UثWb*(lP*aBqBUރj7Zw'[^o;劸ONj=>cfe!IgPP\PUo_}R_orژZ8[GlUUO+qVWbj@44u«N]aWW*(]\PqU⫁…bą†늶qVUk UHUbqJ RF##Z#u ؞=?V)kv*UJ+שo**UثWb\b8XثWb]v*UثWb]v*UثWb]Wv*UثWb[ثC`BҸUp8x8U}Emlo U 0-lđxn@?U3KGRm辚~EZLJO`d+HדUM A }a[[kڽ+ppGp%mqWb8Unڵ1V%ثXUUت…ء⫁W Wb*8UQ[[Z8DblUhl1dXp%a jUثWv]v*U\bRUثWb]v*UثWb]v*UثWb]v*UثWb]v*{w p8PM(T.RC ;01C` [(n W)qH[]bk^WӁ-Uiv U&G_ث]qWbU zUZ8*V%qW`KXU].]p8P(lUp8x8Up8qbWchv\^qKxVPk)ZqU6B Y)V+H+p%ǥ1KXWb]v*\bRv*UثWb]v*UثWb]v*UثWb]v*UثWb] …* ;̴eYMC^S;bTjE$Si@w#nm-1 2#e@ܿSZZ*CxG8+CjUA:bp%zaVk ]p WxqUqBpB\iu[ )*v*LlRbbˊTVКt+Hbb]v*U\b8XثWb]v*UثWbkv*UثWb]v*UثWS*UثWb]b\P(\ F*%mQdYV[*j_/Ê+Nkup`C\N**m׷pX]qVK+*ѥv ]lb(+7px[‡W\ Cc.銪)WbV dbHإiT+##Z-Sv*Uث\bZ.]v*UثWb]1Wb]v*bx ;k*UثWb]v*UثWbP8p\^Up8*u~UZ8\*8UثXT*i8ثUثk ]o. b\1B8UUU_.4 .VUT⫫]Rh<6DxoaZ#lRF)XTPf* ]Z]LR*Uث˒***)v*UثWb]v*]v*UثVWbbثXbޤoZ]v*UثWb]] IBw|P[R}(\*PaHuF*qWWUUثU]\PU~V߷kWCZVbb`KWb*vp *,W Ux ]UP*(l0+u վUPURد_D P†Ue=V{|R KbdSZ##Z]W\**UثXثWb]v*U|U8K+()׾*/jyPSjo]V]ATt\hT) \UUثWb]v*(\(l*(\*PUJvZ8*L)k4qKC*?N;lUz`KXUpP16F,ܿxJ v*ZaW`Vn:Sk v*\ pbaWbWbUA{S*c- ت=Uo*d`dv銬#Z#]\bSkv*URUثWb]ov*(u0%PRPUإثT8–.]v*UثWb]o6(\o6*WWuqVVKX**v†XP.:bZb** vv*U]LUثxp\*0\1U (u0*1K`Ub⪀]#X Uiv*Ő++V-VKT]LU_^h▱Wbb]LUb.]v*[\0!Uث.u1CWb mOjaI E(m^{biZ-BMM{ j\E?^Z]v*UثWbV WWo8b]-aVVWb[7]\UثXUZp+Gv*v*UثWb[Bj*/JcQ P*0.®8iɪ8z***SmbXb)>*Ui wb+iVZjث_lZ]CLU iZ*R*UثT->SRA  з^߳aV{b[Z_nO*mM~}UU`Wv8UثTZ.]v*UثWbPUqVxb­nث\p+XUثV;v**Z"]-b†銻]k\/R+W~P+UqB(v*MP>b[®V H#0aUiSVk|Rz*1V-Sv*)؃W**ZWkv**R ':M[)u(np*zlzq*1W衪(IME:u늭*ڡcAJН{qVV][UUF@25x'?\Um1VKWb]v*P*Uv(v*8u]q-b*qKW۶7\Pvv8▎*v*Uv*ZUb KVǾ6(^*rS.x8PUaɬ] P lPY:CXتqBv…@A8M늬\Z@p%m|\R^튬++qW=+hUm0+[bmU%YXRj*p*bSUlUثW Qсl@ 1WaV[* U†\FثT61Cl&aQBr7CFVhU1VZ*UUثWb]v*7vxثDb]v(vv* XثKGkZZ[qVWbbSv*|qV Pbp  j ڜv? lӉJb֧lbE>}N/U$(;xHVV1V0RZ+mi_ZF)ZAUG-;od1[L RTqCG}ClU0*1Kk(zoMUʮj93 *M:n@VWb܆ ({ ;8 U*CC^v#uCs T߮U v*60(Z5Z~._kpwUݱUKѣv2'@.Ÿ'/\Um+Z+nwLPWSqT]LU1WPaV*1KT\qWb0Ubbb]1CxUPR0%ثWbZ*UUءث* Ӂ baVZv*qVWb]1BqUE8P6.*$PToQJ*M4wb\ŁS\Xp %kMUklb@Ap48Up`~XAG*C^qU­UݱVZF)VA~Ra;H-IܞZkӷ*Vq=1UZ|Wb]G|U®^ZW`Kxኪ,^q#eG)()n#[CwU]LU S**1CDbS LUbSv*UثT]b\*(v*Rb]\Up ®b­Sk]v*UUUu 1Kxc.  C`8iڝ w߱tZ-=v;z zPSjo]3 3*'j|\UǍSMiZmL*jxUol UrF̮#^MVU4,)ɸ bRqjkUtN)$-̃z|ଊf.Ȯ?*${o *1cS@h1WE6!Xhh }銬d Ei^ت)↙SެkQMͪ+I,$^G%ؒrI=IB|RhH4F*5tb x e܎*SjV]w>R;S\\0v* [(nT[u*cJ7Z"Smm1UqUqJ1Vv*Z*aWb]ZZZ)kv*Uثxxث\0xcRWFb>(khUݱK[xWZFbz{m늻 [*bb[W(o 4؏| —`WV N)[\Uyw`jj 8⫇j ^D|ءps@;aUąQI*]J*Į.OWVF*e;e!nYeLFUXrI  ʪqUO |zuZ_q4O+&F.jjcYNbC֥Iߊ!xO#PM7ڪZbj Cor;صJ<⅌ (kA-Anq-ZԝzRU—Wcbl(k^+qW `KWbbW (^lPlijXII®+L*銺k*0Z*0*ҧE@|Ua\Ui]b]LU]L aV(o -bbbv*Uv]laBJă@E|Aj𡡁 **<1U-Skb][[~ t[LRopv6p!R*N*-vb\OǨ6O!j*M7}VI7/ld1=9*/M҅ }UhnefXt%^j0fyU>qrU?ARǶw#Į$Wjs4l]B*KJG QHd/`/FR QѱUI*L(Z cN*-㨨~UIUZ S-+E7® E@5`JڐĎ»mZ'j}=^*)jqVV%[] )T.t :*ׯ*b.Íy5YTҡ~H,je~.?VZ*=U1VU4Tb╼|0-+VZ#T* mޛinPbi-b+XثTZ]lb] I߀[ڕ](laCx`;⮥M {\~T-bz⭉!1 SBTɩko\0㊴F*`WbC\ ꐤmCCWo~JځW422QJuaPU=*1^jg!xbF+A+ j6W+P;kO UƸjm&%EHj sUB)ܨ1'-J UAPgl k \iOzPqU⫁ -1CWƼ!"JBP'8qrTt˘*4A[<㏪?v?&'Re gj|ޘXh) H @4t`߶e@5ؒ*v5bG[\Uo"ƝE}XإkuqKDqWb)uqWbb bǾ*L*N(U^{|S {*N'zث\F*`V7? #qQ[ASOU0! :UiVG_UaC1VNVWSF*ZUN*1KDbHV+qVKD`Kߊ444 qWb[\1U0@,kAh .w…]ث)J SZmbh1K*U |*bĮ_ (k++kVxRjCŇ%;e<…i-إaZ+)kl:Zv*&`C`Uӱ6)^a5SNZC*1,5$ n<BӵM(]L,E "!0`jNJq?/x+~yR@wֵUqU3inθjS[ ~Jӊv*Uثu8\P[\*UP7Mw…bUm/bH{트u[VRvثEzU4sWq0Uim0bLUUiLUm1UqJ)Vإc)ݪ+AZp%46Z#kv***aCc(n^) (l UaWSZ(j. 1CxTVZbHZ aV ko qVVV*ث{xVCQ|Uax [ۭ6m76DyP̜9!H8k`*T^!TPxQUą6Tׯ**SVKG 0 E؃JURqVVWbnnU[ pU{{˛vVgDZ6e"H鸡rn (v…UlP}Vu*%p'l*mW8{⮦*þتߞ*1B6­Sju? VLUk-qU2)j¸ֲb:J1KG+)ku1URCJ(}=qWbB*7…o\(OZu ;|XKT bUpX[®Z#j1KTբ0 hUc- PإoJ kvqZ[[*"{oMU\#$Ҥf4 !8/ pGON7UHBw5 piVfp *TM]U⭂<*wӦ)XqUJڇ*qd늬aߦqKXkv*qVWbb;  WT\*1<6w H@´>8uqVbwUukJ߁W :m+>&U?vKDbb\@V i]ZIRA0H4TUm1WPwblM-GӁVbUw:}V! 0 kS6‚ኮ0;b*߾o ۮ(u0Z-⫔At# b[ UU=WbSkVVaU`KMRMS#Vw bb⭃ڪf!E=vr-QK2.JR8q~D/?5O1UQ#@ӕF2EǐRCFYD"Mڅ++bIR#vT>a$: 98_R4El*zb'oK^ P`@,kAh hm؃~ثLjzڧl? UiVBÊVa)k]Z8Uثu[]UPp`⫁WW7WS6(UG#PhX@ӑ)lX~ [ p= "]U 0*ܸ\O_EqUY ѪJх1VB={Z8T؟ B UzR#S"Zp%nkv*UثWb[ovlaCuW ⮩*6/VWąE 8\^CP~Up8xaO}*UJji@ [튵LUR?8ӊBR*㊬#X8 kv*UثVK*UUUUU…6;S]\*8[(*ؠQ.*5:bWS]nqUVv)u1V z{{b1V80a_|CMn$(Ƞ2&5_qv^/ej$`J1KhM6o 4#pF*bb[[B4bfd(vUUK fO[\UCu[o;lbP Cc]Jǯ[Z**P*Vy$rY݉ff&w$ F)bbbb_mhv뗡Ŗl;-ķ.ۗQ4 Q0I/O] P]Iݶ7R(i@FU7T]ZqUY5\ UXF*╧Z8*UثV)v*UثCu]]\U~8⫃aBlPSu iW+U@qUWJp*'[Z\ƪZoъz *1WbWb)֛XwT†$VަmM㊩Db6\YZһ╬6]};oU-SjUv*8q$|@PlUثu[(p8Up8` Up«! W RqV銭*bH HVL*Ui\ YƦJJ¸ii^8if-TP ytjrUߵW/BՖD4 F[eZ^V.*KBPhfy( Z_mW܍a_SlUiZ8ÉKGV*U802ZqV%k vv*UثWb;v*qWb­X+bV(\Upjb@^[*~PRW M PvUAW銴FV(ZE*z*Ėcȱ55S dblL*ԅJZ3UsȞMREhx|b,nR($Af;v *qU {{blUء(l*UP+ʼn][rmW \*hU*EEGp6 iJH« ╄`J?#l14G +S#h NQݕW)x 銵\U 0qb8u5[&ӊp*Å- [Z­`V1U8]p%ثWb]v*UثV[/ )z(^(nUz(!x8TSU+JR(q銵Z# RinjI5M N޴XV,aO*n,#z}ت.(S# #maaF)ZI=L qCZ[[**[ W! C{]\*N^*Rq^1VF(ZWXF*RF)ZF)=}6zbNx0x`qbN(o-=1J*)[UiaUZURUثWb]v*UثWb uqWb…BlPPUr(T*+bqJ+Wv*z▱U 4= { WrzH­@ b…Tӑ x(ReVV!iaiVN銵1V늻lbV \*l C*W+W`Vq1VNثTZSA1B-1U RF)-r^x@ ӾmlO([Z_ Z⭃8(h)XE%+I+N*ZZZaJ1U8V%ثWb]v*UثWb]v7\ 8PP \PUz(TS qJ8 ^ +-olUثXo ?f(]aBw'u?N# $ bInEylnDVPWlPץ! ޒ2*~#S SlP‡[Ƶ xf%1JÁV ڧڸqKXUp]*(o\*lcTSWqJqUJ0;WNثT­P}1JbYkZUB$%R( Wr並34eS~-S._WW;jbW.I`Awj1Cآ4N)ZإiZ8ӊp%UUV+qKXW`KWb]v*UثWb]v*U «Ŋ…@qB88^U TR)+x$)#x↉\|F**Sh+kbWo P⅄aU70Zt=E{bdb-4)ZEz fX|qK]qUZ{k]LU(olbW Up8P8qV*rHlo ªp*W RU=}1VۿlUc PF*SĶ TVzv*b-.p⫁[ڇ獡RbN*VUZ.]Z80%Z].]v*UثWb]v*UثWb «U[ Jqb⨠WUUJqJKM®]!RHE)ڔ5US>8 GʝU0c zaBR0 UDTBÅ-UmYHe4aB؃V▪FGߊBic-b]nUW \*W)uE:ŋcu⪀+ҽ=nm ^qCZP↽V^'cʢSzLUg*?+ޤ{mժ튻:WITvU⭃ Up8UZ8U`KVW#kVRUUثWb]v*UثWb]v*(\(^*+aB տ 4PqJ'WJ`U=K`By6PP޻ӯ^a®j68W;[~_]]NW f  )Ȋ7A*A>{BbM4$I$ VbB!fr^n~۳~ $t\)Xp+G[\Qʖxjl zU+NbWb]\U6*8PUp8qV«F*^*I mQ)lbX)VP6#[]†$7oV^q^w]\U]Z$bou†[**V] ]HUث%ثWb]v*UثWb]v*Upp8V…E8T^(TFUW8nv*WTSmV`VX@<`(*Ÿo)0}U'jw߾*p*@v RBHrz Ui-b#jب[Z]uF*Uثu]\UWlP*PqU C`TVX z ؐ |1V-LR*ѧaUM,I#:B*HD,UA+迶ߵd++qWv)1WW )5;iثx[nPvZ=p%Uث}pUإUi0%R*UUثWb]v*UثWb]1Bpz,UTB*WǮ)^*Up8x8Q\q#$yQJu|qV® l}*㊸ ڛSMkF)s%xE W*t{B[ =сT)ZXzbژEHqn*Z)v*Uث[‡bv(lP*{u[. (7W ҝ6 1UEnx8x#jlUw('YJ?  RIŹ/?ݕXj?^*ӷU^URUث+튶](,HQE&5[T,Ҡl l*u®(vouqWbbaCxVKV8)kv* v*UثWb]v*UUثWb[. USPW USQW"W\)Twm:wqVxr8U⫡XݣYX3B8X#nѿ\UDqUY3~A*╥@gS ?iZV A *(AO7͊T®=JU )v*UWb]p8u†\.*qBتqB6' W`U@تإR%V$3^,y7*T)*m܎+<"r| ]'x[IP\=@7ͿvR?j k\zb{`KCWaWb]u]\Ub][])khRh▱Wbb]vv*UثWb®]v*P\ El(US ըAUTCM>UNTZVl v-lRE1V_ P_|*hh̡2ۚ"?z=R~ڨR^>=ϖ*w$VxV늶آ6dhU qKDbH +Z[4U[cqoQlUUثxUCW (ol UxZ;iZ#ZFZ]L 0W`KWb]v*UثVCxxVBqB6+&>x\)m;Wzz Ux;b õAAz*?,RО6) M>X)j $v$Pp# $ $"Fh1 ~ nG䜤fl FקnA@AU,7<~#GAňbxUP@SqJUUإkv*UثWbHtqW4|U5mk ֝>UpqCu­ f :C`8E:oQCڝ.(\*6d0vZF;tS qU@O%*@%~ <[~, YjUUثWbV*61Cu­W`\(]xbb8ӊZ#[-bVv*UثT]]v*UثWb \1UBP* P\+AR Mz $R*b AZJ8Ukw:`J-ZQM]LUcSp7BMr5VR )^PJ,@䥪U >/튴qCQZEYxT1%v-@_~./1U"6| ⭳|"N{qKb4Z]v*UثWb]  h@Ev؊(lUqUCu[=Vw7>W?l` Ub.®4+iGS`KXtZ] v*Pb ܝ]b \qU1VKDbN]]o ]LURUثWb]튷[UlaBqUqB6%UN኷;n†LUvVxbnZiZE|7bHTW!vzP (V`f UUj6ӊ>}zLU\„64 bd R hbb]v*UثWb] Wm:aCF 0>Ƅ B)^1WWl(nu_AWV~Ue1K_*bPS.]XUثcbCxc7MW}8qU *튴F*Z#8D`KXثxXWbSv)v*ṧO|UثxثV**኷PUQN(VS*MqUNUثNP׷l PpG`U7~8 )h" 7jN*VKDlT&wU"TIQgQT:W}QgR\Y,xHZ $z UL h/A]╸ثWb]Tg%E D"2XUƜ[$TWb] AP7zPn*[AEyQ ,h9I!TEweEx`Jo UzcE@e' [﷿^ Q ׆]ژ1Jj}tڔqWnZqK%ثWbZ]ov.(lb]\PUVW#h╤b k]0Ub* kklb]1ClR(\0qUD8*ph 6*;{ⅸL>تE~*{;T) g)Zk׿+N*~hA_RxWb튭joN|Ua5v*]Wb]p;1Wb]v7] PUثxiu7!i>8R k⮧㊵JZþ*R)hU\ ;kv*|UUثxXxxP(v****8p[vjӅZ8i*)o** 0%U]v*Uv*UUثxPUx8Y }B*ݱK4*>7|X**HP~8, a\ù8L kj* ('rbjkVWL YR* 0.]lN 潇** UثWO߮*7v]CNT~*_~>q**URsO#[Gf0# Rg vN_ȸO j{Vɫ;}X۷*(n+VӯъZ[_Ps!iR 1U޽M Ñ)Q_j ivP$EzWV+$o߽6qU21KX{kj.[qVP**onP[#ZF*UiR U.®]LU`KTZ]]b(oop«\ * 0zև߶*1UPu5nŋN>^ {xbnnv>8UM) l02jUi~x]W+5$7v WqkZ*d*UثuQR{늪\ZH#9U$Rc OH$Feup+Fyi4XW(v 31 A U*OqVWWnWb®] '׶8`V|@zA@z; \o_:mfC[DbYkqB%H ڕL*V P1JZ7NإL)kkhRv*UثT].*[wZ[®]W *Uت0*0T-bbW P *UZ#ZLUonت኷[[\*.^08W(s.ت' (h v+tޟ,Phk+CU"1Ub6n*VKGrH=w|RqWI={mክ#lR[N¤l+;Xbc܎1l wtk`@Hv%D|dʜ$gzTWb[ڝwZ] v7,( S`WaVWb[!vC˰[y.^ִ OBmv=*ٝܖv$I$IYƻVb6ZaUkr;@K1TnI;0Rahp%c R*b(v*UaK+Wbx5]W ]FXFhR1KV7kv*1J`KCKxثc  PaUTL b #*0* bYE?ϮR),TRu dWo8n* Rb]qU[[y.'8GrQ Kz8U,UثWb]]0UP\0zl{ހqCOBjV]*IZv4# +\UL lUqWڤ{p+TN*j21J¤b㊸Rv*0Z)v*኷o .UP`W ZApT-SpW U(j.ثDbb P­⫆(\7–Cc^1Jb{aUUnM('@+NLT NªL0%aLRqV%U+Z? UU"qiF-W)m@fPHh=8Uث]]l) SRzm^qVWb®†*UPUD5?;t]?ج#-aqW$|TDLx'Ğ Z*|B-0O\:$~<+]8\RW*eqK+G LUإثWSku0+XPUثxX***(\1VCD`U`J*1KXUUp u1V]Z*qUb`W Up­ LUUrx*\)VL 6P~ s ԞRt$(:d0 NRRF)kZ]kbV߈vĠ$)ađj|bTUqJ`K+d/SQM7Z]\)Q^W Pׯov*U|#J,f5*!ɹ3T`Efv**8PxV9r4&$:"$:2*jF46,BD^24V6< 6"$.*.&:<.,6464JDFLfR\&.,6D *4."  6<.,2,>\&,"&*64BDV\z6F\2j"f:L*<"BD64VTr|Ʀ:RdNJ&^\Z\bdҎ.FL"R\R\ & *vVTRTZd^dr^\&BD>D .DFBD",,rBD>D~24r:<:*$B*4.jJDz64R&$B$>"2n24j*,^&$Z&$>.f:4b.$Z*,B"$>"$.J2,N2,R2,>.$6"!Made with GIMP,H*\ȰÇ#. `D 8  .h& P0daC~(PH!C)b$J0i("e*U\E.]|`1 TC3hҨY 6a^ 8q̡S;OA=B>>AAA777999;;;}}}555666xxxqqqiii111{{{zzzwwwsssnnnggg---,,,uuujjjf``***)))BBBDDDFFFHHHooomlllddj\\gRRgLLZZZ???HEEJBBwwsVVhGGhAA\\\]]]___```f^^o__}ffK44yPPLLDD==Q##hTTrXX?**;$$YYOOFF5500**%%} 7&&N,,k>>p;;t88CC<<7722--!!,o88t44y22~//5500++/3y//~,,))''**26~))''%%59$$""8<!Made with GIMP,   !"#$%&'()*+,-.%/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRPb KYl0aNe3L3gМ%5ll8qF3G,.cʜIMH;bumprace-1.5.4/data/gfx/racerf9.gif0000644000175000017500000000207311217461066013765 00000000000000GIF89afYWYh[52 4X[]j""j##Y2 46\ _##m((l(([!!46]$$`''o//]&&69b--s66q66_,, 8c22h88t??`228:j??xHHb99 :""kCCjDDVVWWzTTvUU<''P66pQQwWWwwO;;R??kVV;,,=//M??PDDSJJwmmzvvvvv%'!!<66d^^fcciiilllZZZzzzwwwttt_^^bbbeeehhhkkknnnrrrWWWyyy]]]```cccgggjjjmmmqqqYYY\\\___ppp^^^aaadddooo999---fff***,,,///+++000111}}}uuu333444!Made with GIMP,H*\ȰÇ p XA 4p#A$LP1dаC`"$Jh*V Ȣ0b,(c6nȱT=| $!D,5rI%K4q (RPb ,:l0a59L3gФQ6n '9&XSN;xg7e]pAL*Pg!ҩ;ј]-P#|ܙ4T |4 !قa@;bumprace-1.5.4/data/gfx/cannon10.jpg0000644000175000017500000000236711217461066014070 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>TKxH8pHFoνMRiVEY]g;'R)Mdc8}*uduT.Hg]prHck0`:I5-Qj5pu",B6$g{8L swF[ x\18'4Um1m_*I;?('Ԓ)g7 ‡?s$gqM#w̅*X眐MM>B<")\zs?I|It=/𿇒&-#mϚ_sKʬdc @,Iw;*-zlj5[Hkheia$&,͹hJϦ+]'`uV4*iI׆&tkGW;<2,5˰Xdێ>>:::!Made with GIMP,  !"#$%&'()*'+,-./01234 5678*9:;<=>?@AB-C DEFGHIJ.@KLMNOPD2*.\E%Z9E/_& CbƐT MΠAɲ˗0c<;bumprace-1.5.4/data/gfx/cannon16.jpg0000644000175000017500000000236111217461066014070 00000000000000JFIF NeoGeoZC     C   ((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kVhY;_{B9q֬ւ+Xxɀ9':PZgfbc#>SC@I!n~uzVEY]g;'R)Mdc8}* tϔ;.˳}c0(6 qXmbxD#bFwb =z*{a5 DžcsEULѴ5=Cȸt>v K$8'~9>g, Jr3l d\H!b9$SVm s7 `*A+&gCEJo$;~oy4|U YA +]rZӅA[/eR6ۓ9M;OBH/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) $(am__remove_distdir) test -d $(distdir) || mkdir $(distdir) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ distdir=`$(am__cd) $(distdir) && pwd`; \ top_distdir=`$(am__cd) $(top_distdir) && pwd`; \ (cd $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$top_distdir" \ distdir="$$distdir/$$subdir" \ am__remove_distdir=: \ am__skip_length_check=: \ distdir) \ || exit 1; \ fi; \ done -find $(distdir) -type d ! -perm -777 -exec chmod a+rwx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r $(distdir) dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-lzma: distdir tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gunzip -c $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bunzip2 -c $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.lzma*) \ unlzma -c $(distdir).tar.lzma | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gunzip -c $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod a+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && cd $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x' distuninstallcheck: @cd $(distuninstallcheck_dir) \ && test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: check-recursive all-am: Makefile installdirs: installdirs-recursive installdirs-am: install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-recursive clean-am: clean-generic mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -f Makefile distclean-am: clean-am distclean-generic distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive info: info-recursive info-am: install-data-am: install-dvi: install-dvi-recursive install-exec-am: install-html: install-html-recursive install-info: install-info-recursive install-man: install-pdf: install-pdf-recursive install-ps: install-ps-recursive installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) install-am \ install-strip .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am am--refresh check check-am clean clean-generic \ ctags ctags-recursive dist dist-all dist-bzip2 dist-gzip \ dist-lzma dist-shar dist-tarZ dist-zip distcheck distclean \ distclean-generic distclean-tags distcleancheck distdir \ distuninstallcheck dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-dvi \ install-dvi-am install-exec install-exec-am install-html \ install-html-am install-info install-info-am install-man \ install-pdf install-pdf-am install-ps install-ps-am \ install-strip installcheck installcheck-am installdirs \ installdirs-am maintainer-clean maintainer-clean-generic \ mostlyclean mostlyclean-generic pdf pdf-am ps ps-am tags \ tags-recursive uninstall uninstall-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: bumprace-1.5.4/config.sub0000755000175000017500000007730011217461066012236 00000000000000#! /bin/sh # Configuration validation subroutine script. # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, # 2000, 2001, 2002, 2003, 2004, 2005, 2006 Free Software Foundation, # Inc. timestamp='2006-07-02' # This file is (in principle) common to ALL GNU software. # The presence of a machine in this file suggests that SOME GNU software # can handle that machine. It does not imply ALL GNU software can. # # This file is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA # 02110-1301, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Please send patches to . Submit a context # diff and a properly formatted ChangeLog entry. # # Configuration subroutine to validate and canonicalize a configuration type. # Supply the specified configuration type as an argument. # If it is invalid, we print an error message on stderr and exit with code 1. # Otherwise, we print the canonical config type on stdout and succeed. # This file is supposed to be the same for all GNU packages # and recognize all the CPU types, system types and aliases # that are meaningful with *any* GNU software. # Each package is responsible for reporting which valid configurations # it does not support. The user should be able to distinguish # a failure to support a valid configuration from a meaningless # configuration. # The goal of this file is to map all the various variations of a given # machine specification into a single specification in the form: # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM # or in some cases, the newer four-part form: # CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM # It is wrong to echo any other type of specification. me=`echo "$0" | sed -e 's,.*/,,'` usage="\ Usage: $0 [OPTION] CPU-MFR-OPSYS $0 [OPTION] ALIAS Canonicalize a configuration name. Operation modes: -h, --help print this help, then exit -t, --time-stamp print date of last modification, then exit -v, --version print version number, then exit Report bugs and patches to ." version="\ GNU config.sub ($timestamp) Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." help=" Try \`$me --help' for more information." # Parse command line while test $# -gt 0 ; do case $1 in --time-stamp | --time* | -t ) echo "$timestamp" ; exit ;; --version | -v ) echo "$version" ; exit ;; --help | --h* | -h ) echo "$usage"; exit ;; -- ) # Stop option processing shift; break ;; - ) # Use stdin as input. break ;; -* ) echo "$me: invalid option $1$help" exit 1 ;; *local*) # First pass through any local machine types. echo $1 exit ;; * ) break ;; esac done case $# in 0) echo "$me: missing argument$help" >&2 exit 1;; 1) ;; *) echo "$me: too many arguments$help" >&2 exit 1;; esac # Separate what the user gave into CPU-COMPANY and OS or KERNEL-OS (if any). # Here we must recognize all the valid KERNEL-OS combinations. maybe_os=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\2/'` case $maybe_os in nto-qnx* | linux-gnu* | linux-dietlibc | linux-newlib* | linux-uclibc* | \ uclinux-uclibc* | uclinux-gnu* | kfreebsd*-gnu* | knetbsd*-gnu* | netbsd*-gnu* | \ storm-chaos* | os2-emx* | rtmk-nova*) os=-$maybe_os basic_machine=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\1/'` ;; *) basic_machine=`echo $1 | sed 's/-[^-]*$//'` if [ $basic_machine != $1 ] then os=`echo $1 | sed 's/.*-/-/'` else os=; fi ;; esac ### Let's recognize common machines as not being operating systems so ### that things like config.sub decstation-3100 work. We also ### recognize some manufacturers as not being operating systems, so we ### can provide default operating systems below. case $os in -sun*os*) # Prevent following clause from handling this invalid input. ;; -dec* | -mips* | -sequent* | -encore* | -pc532* | -sgi* | -sony* | \ -att* | -7300* | -3300* | -delta* | -motorola* | -sun[234]* | \ -unicom* | -ibm* | -next | -hp | -isi* | -apollo | -altos* | \ -convergent* | -ncr* | -news | -32* | -3600* | -3100* | -hitachi* |\ -c[123]* | -convex* | -sun | -crds | -omron* | -dg | -ultra | -tti* | \ -harris | -dolphin | -highlevel | -gould | -cbm | -ns | -masscomp | \ -apple | -axis | -knuth | -cray) os= basic_machine=$1 ;; -sim | -cisco | -oki | -wec | -winbond) os= basic_machine=$1 ;; -scout) ;; -wrs) os=-vxworks basic_machine=$1 ;; -chorusos*) os=-chorusos basic_machine=$1 ;; -chorusrdb) os=-chorusrdb basic_machine=$1 ;; -hiux*) os=-hiuxwe2 ;; -sco6) os=-sco5v6 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco5) os=-sco3.2v5 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco4) os=-sco3.2v4 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco3.2.[4-9]*) os=`echo $os | sed -e 's/sco3.2./sco3.2v/'` basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco3.2v[4-9]*) # Don't forget version if it is 3.2v4 or newer. basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco5v6*) # Don't forget version if it is 3.2v4 or newer. basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco*) os=-sco3.2v2 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -udk*) basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -isc) os=-isc2.2 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -clix*) basic_machine=clipper-intergraph ;; -isc*) basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -lynx*) os=-lynxos ;; -ptx*) basic_machine=`echo $1 | sed -e 's/86-.*/86-sequent/'` ;; -windowsnt*) os=`echo $os | sed -e 's/windowsnt/winnt/'` ;; -psos*) os=-psos ;; -mint | -mint[0-9]*) basic_machine=m68k-atari os=-mint ;; esac # Decode aliases for certain CPU-COMPANY combinations. case $basic_machine in # Recognize the basic CPU types without company name. # Some are omitted here because they have special meanings below. 1750a | 580 \ | a29k \ | alpha | alphaev[4-8] | alphaev56 | alphaev6[78] | alphapca5[67] \ | alpha64 | alpha64ev[4-8] | alpha64ev56 | alpha64ev6[78] | alpha64pca5[67] \ | am33_2.0 \ | arc | arm | arm[bl]e | arme[lb] | armv[2345] | armv[345][lb] | avr | avr32 \ | bfin \ | c4x | clipper \ | d10v | d30v | dlx | dsp16xx \ | fr30 | frv \ | h8300 | h8500 | hppa | hppa1.[01] | hppa2.0 | hppa2.0[nw] | hppa64 \ | i370 | i860 | i960 | ia64 \ | ip2k | iq2000 \ | m32c | m32r | m32rle | m68000 | m68k | m88k \ | maxq | mb | microblaze | mcore \ | mips | mipsbe | mipseb | mipsel | mipsle \ | mips16 \ | mips64 | mips64el \ | mips64vr | mips64vrel \ | mips64orion | mips64orionel \ | mips64vr4100 | mips64vr4100el \ | mips64vr4300 | mips64vr4300el \ | mips64vr5000 | mips64vr5000el \ | mips64vr5900 | mips64vr5900el \ | mipsisa32 | mipsisa32el \ | mipsisa32r2 | mipsisa32r2el \ | mipsisa64 | mipsisa64el \ | mipsisa64r2 | mipsisa64r2el \ | mipsisa64sb1 | mipsisa64sb1el \ | mipsisa64sr71k | mipsisa64sr71kel \ | mipstx39 | mipstx39el \ | mn10200 | mn10300 \ | mt \ | msp430 \ | nios | nios2 \ | ns16k | ns32k \ | or32 \ | pdp10 | pdp11 | pj | pjl \ | powerpc | powerpc64 | powerpc64le | powerpcle | ppcbe \ | pyramid \ | sh | sh[1234] | sh[24]a | sh[23]e | sh[34]eb | sheb | shbe | shle | sh[1234]le | sh3ele \ | sh64 | sh64le \ | sparc | sparc64 | sparc64b | sparc64v | sparc86x | sparclet | sparclite \ | sparcv8 | sparcv9 | sparcv9b | sparcv9v \ | spu | strongarm \ | tahoe | thumb | tic4x | tic80 | tron \ | v850 | v850e \ | we32k \ | x86 | xscale | xscalee[bl] | xstormy16 | xtensa \ | z8k) basic_machine=$basic_machine-unknown ;; m6811 | m68hc11 | m6812 | m68hc12) # Motorola 68HC11/12. basic_machine=$basic_machine-unknown os=-none ;; m88110 | m680[12346]0 | m683?2 | m68360 | m5200 | v70 | w65 | z8k) ;; ms1) basic_machine=mt-unknown ;; # We use `pc' rather than `unknown' # because (1) that's what they normally are, and # (2) the word "unknown" tends to confuse beginning users. i*86 | x86_64) basic_machine=$basic_machine-pc ;; # Object if more than one company name word. *-*-*) echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2 exit 1 ;; # Recognize the basic CPU types with company name. 580-* \ | a29k-* \ | alpha-* | alphaev[4-8]-* | alphaev56-* | alphaev6[78]-* \ | alpha64-* | alpha64ev[4-8]-* | alpha64ev56-* | alpha64ev6[78]-* \ | alphapca5[67]-* | alpha64pca5[67]-* | arc-* \ | arm-* | armbe-* | armle-* | armeb-* | armv*-* \ | avr-* | avr32-* \ | bfin-* | bs2000-* \ | c[123]* | c30-* | [cjt]90-* | c4x-* | c54x-* | c55x-* | c6x-* \ | clipper-* | craynv-* | cydra-* \ | d10v-* | d30v-* | dlx-* \ | elxsi-* \ | f30[01]-* | f700-* | fr30-* | frv-* | fx80-* \ | h8300-* | h8500-* \ | hppa-* | hppa1.[01]-* | hppa2.0-* | hppa2.0[nw]-* | hppa64-* \ | i*86-* | i860-* | i960-* | ia64-* \ | ip2k-* | iq2000-* \ | m32c-* | m32r-* | m32rle-* \ | m68000-* | m680[012346]0-* | m68360-* | m683?2-* | m68k-* \ | m88110-* | m88k-* | maxq-* | mcore-* \ | mips-* | mipsbe-* | mipseb-* | mipsel-* | mipsle-* \ | mips16-* \ | mips64-* | mips64el-* \ | mips64vr-* | mips64vrel-* \ | mips64orion-* | mips64orionel-* \ | mips64vr4100-* | mips64vr4100el-* \ | mips64vr4300-* | mips64vr4300el-* \ | mips64vr5000-* | mips64vr5000el-* \ | mips64vr5900-* | mips64vr5900el-* \ | mipsisa32-* | mipsisa32el-* \ | mipsisa32r2-* | mipsisa32r2el-* \ | mipsisa64-* | mipsisa64el-* \ | mipsisa64r2-* | mipsisa64r2el-* \ | mipsisa64sb1-* | mipsisa64sb1el-* \ | mipsisa64sr71k-* | mipsisa64sr71kel-* \ | mipstx39-* | mipstx39el-* \ | mmix-* \ | mt-* \ | msp430-* \ | nios-* | nios2-* \ | none-* | np1-* | ns16k-* | ns32k-* \ | orion-* \ | pdp10-* | pdp11-* | pj-* | pjl-* | pn-* | power-* \ | powerpc-* | powerpc64-* | powerpc64le-* | powerpcle-* | ppcbe-* \ | pyramid-* \ | romp-* | rs6000-* \ | sh-* | sh[1234]-* | sh[24]a-* | sh[23]e-* | sh[34]eb-* | sheb-* | shbe-* \ | shle-* | sh[1234]le-* | sh3ele-* | sh64-* | sh64le-* \ | sparc-* | sparc64-* | sparc64b-* | sparc64v-* | sparc86x-* | sparclet-* \ | sparclite-* \ | sparcv8-* | sparcv9-* | sparcv9b-* | sparcv9v-* | strongarm-* | sv1-* | sx?-* \ | tahoe-* | thumb-* \ | tic30-* | tic4x-* | tic54x-* | tic55x-* | tic6x-* | tic80-* \ | tron-* \ | v850-* | v850e-* | vax-* \ | we32k-* \ | x86-* | x86_64-* | xps100-* | xscale-* | xscalee[bl]-* \ | xstormy16-* | xtensa-* \ | ymp-* \ | z8k-*) ;; # Recognize the various machine names and aliases which stand # for a CPU type and a company and sometimes even an OS. 386bsd) basic_machine=i386-unknown os=-bsd ;; 3b1 | 7300 | 7300-att | att-7300 | pc7300 | safari | unixpc) basic_machine=m68000-att ;; 3b*) basic_machine=we32k-att ;; a29khif) basic_machine=a29k-amd os=-udi ;; abacus) basic_machine=abacus-unknown ;; adobe68k) basic_machine=m68010-adobe os=-scout ;; alliant | fx80) basic_machine=fx80-alliant ;; altos | altos3068) basic_machine=m68k-altos ;; am29k) basic_machine=a29k-none os=-bsd ;; amd64) basic_machine=x86_64-pc ;; amd64-*) basic_machine=x86_64-`echo $basic_machine | sed 's/^[^-]*-//'` ;; amdahl) basic_machine=580-amdahl os=-sysv ;; amiga | amiga-*) basic_machine=m68k-unknown ;; amigaos | amigados) basic_machine=m68k-unknown os=-amigaos ;; amigaunix | amix) basic_machine=m68k-unknown os=-sysv4 ;; apollo68) basic_machine=m68k-apollo os=-sysv ;; apollo68bsd) basic_machine=m68k-apollo os=-bsd ;; aux) basic_machine=m68k-apple os=-aux ;; balance) basic_machine=ns32k-sequent os=-dynix ;; c90) basic_machine=c90-cray os=-unicos ;; convex-c1) basic_machine=c1-convex os=-bsd ;; convex-c2) basic_machine=c2-convex os=-bsd ;; convex-c32) basic_machine=c32-convex os=-bsd ;; convex-c34) basic_machine=c34-convex os=-bsd ;; convex-c38) basic_machine=c38-convex os=-bsd ;; cray | j90) basic_machine=j90-cray os=-unicos ;; craynv) basic_machine=craynv-cray os=-unicosmp ;; cr16c) basic_machine=cr16c-unknown os=-elf ;; crds | unos) basic_machine=m68k-crds ;; crisv32 | crisv32-* | etraxfs*) basic_machine=crisv32-axis ;; cris | cris-* | etrax*) basic_machine=cris-axis ;; crx) basic_machine=crx-unknown os=-elf ;; da30 | da30-*) basic_machine=m68k-da30 ;; decstation | decstation-3100 | pmax | pmax-* | pmin | dec3100 | decstatn) basic_machine=mips-dec ;; decsystem10* | dec10*) basic_machine=pdp10-dec os=-tops10 ;; decsystem20* | dec20*) basic_machine=pdp10-dec os=-tops20 ;; delta | 3300 | motorola-3300 | motorola-delta \ | 3300-motorola | delta-motorola) basic_machine=m68k-motorola ;; delta88) basic_machine=m88k-motorola os=-sysv3 ;; djgpp) basic_machine=i586-pc os=-msdosdjgpp ;; dpx20 | dpx20-*) basic_machine=rs6000-bull os=-bosx ;; dpx2* | dpx2*-bull) basic_machine=m68k-bull os=-sysv3 ;; ebmon29k) basic_machine=a29k-amd os=-ebmon ;; elxsi) basic_machine=elxsi-elxsi os=-bsd ;; encore | umax | mmax) basic_machine=ns32k-encore ;; es1800 | OSE68k | ose68k | ose | OSE) basic_machine=m68k-ericsson os=-ose ;; fx2800) basic_machine=i860-alliant ;; genix) basic_machine=ns32k-ns ;; gmicro) basic_machine=tron-gmicro os=-sysv ;; go32) basic_machine=i386-pc os=-go32 ;; h3050r* | hiux*) basic_machine=hppa1.1-hitachi os=-hiuxwe2 ;; h8300hms) basic_machine=h8300-hitachi os=-hms ;; h8300xray) basic_machine=h8300-hitachi os=-xray ;; h8500hms) basic_machine=h8500-hitachi os=-hms ;; harris) basic_machine=m88k-harris os=-sysv3 ;; hp300-*) basic_machine=m68k-hp ;; hp300bsd) basic_machine=m68k-hp os=-bsd ;; hp300hpux) basic_machine=m68k-hp os=-hpux ;; hp3k9[0-9][0-9] | hp9[0-9][0-9]) basic_machine=hppa1.0-hp ;; hp9k2[0-9][0-9] | hp9k31[0-9]) basic_machine=m68000-hp ;; hp9k3[2-9][0-9]) basic_machine=m68k-hp ;; hp9k6[0-9][0-9] | hp6[0-9][0-9]) basic_machine=hppa1.0-hp ;; hp9k7[0-79][0-9] | hp7[0-79][0-9]) basic_machine=hppa1.1-hp ;; hp9k78[0-9] | hp78[0-9]) # FIXME: really hppa2.0-hp basic_machine=hppa1.1-hp ;; hp9k8[67]1 | hp8[67]1 | hp9k80[24] | hp80[24] | hp9k8[78]9 | hp8[78]9 | hp9k893 | hp893) # FIXME: really hppa2.0-hp basic_machine=hppa1.1-hp ;; hp9k8[0-9][13679] | hp8[0-9][13679]) basic_machine=hppa1.1-hp ;; hp9k8[0-9][0-9] | hp8[0-9][0-9]) basic_machine=hppa1.0-hp ;; hppa-next) os=-nextstep3 ;; hppaosf) basic_machine=hppa1.1-hp os=-osf ;; hppro) basic_machine=hppa1.1-hp os=-proelf ;; i370-ibm* | ibm*) basic_machine=i370-ibm ;; # I'm not sure what "Sysv32" means. Should this be sysv3.2? i*86v32) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv32 ;; i*86v4*) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv4 ;; i*86v) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv ;; i*86sol2) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-solaris2 ;; i386mach) basic_machine=i386-mach os=-mach ;; i386-vsta | vsta) basic_machine=i386-unknown os=-vsta ;; iris | iris4d) basic_machine=mips-sgi case $os in -irix*) ;; *) os=-irix4 ;; esac ;; isi68 | isi) basic_machine=m68k-isi os=-sysv ;; m88k-omron*) basic_machine=m88k-omron ;; magnum | m3230) basic_machine=mips-mips os=-sysv ;; merlin) basic_machine=ns32k-utek os=-sysv ;; mingw32) basic_machine=i386-pc os=-mingw32 ;; miniframe) basic_machine=m68000-convergent ;; *mint | -mint[0-9]* | *MiNT | *MiNT[0-9]*) basic_machine=m68k-atari os=-mint ;; mips3*-*) basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'` ;; mips3*) basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'`-unknown ;; monitor) basic_machine=m68k-rom68k os=-coff ;; morphos) basic_machine=powerpc-unknown os=-morphos ;; msdos) basic_machine=i386-pc os=-msdos ;; ms1-*) basic_machine=`echo $basic_machine | sed -e 's/ms1-/mt-/'` ;; mvs) basic_machine=i370-ibm os=-mvs ;; ncr3000) basic_machine=i486-ncr os=-sysv4 ;; netbsd386) basic_machine=i386-unknown os=-netbsd ;; netwinder) basic_machine=armv4l-rebel os=-linux ;; news | news700 | news800 | news900) basic_machine=m68k-sony os=-newsos ;; news1000) basic_machine=m68030-sony os=-newsos ;; news-3600 | risc-news) basic_machine=mips-sony os=-newsos ;; necv70) basic_machine=v70-nec os=-sysv ;; next | m*-next ) basic_machine=m68k-next case $os in -nextstep* ) ;; -ns2*) os=-nextstep2 ;; *) os=-nextstep3 ;; esac ;; nh3000) basic_machine=m68k-harris os=-cxux ;; nh[45]000) basic_machine=m88k-harris os=-cxux ;; nindy960) basic_machine=i960-intel os=-nindy ;; mon960) basic_machine=i960-intel os=-mon960 ;; nonstopux) basic_machine=mips-compaq os=-nonstopux ;; np1) basic_machine=np1-gould ;; nsr-tandem) basic_machine=nsr-tandem ;; op50n-* | op60c-*) basic_machine=hppa1.1-oki os=-proelf ;; openrisc | openrisc-*) basic_machine=or32-unknown ;; os400) basic_machine=powerpc-ibm os=-os400 ;; OSE68000 | ose68000) basic_machine=m68000-ericsson os=-ose ;; os68k) basic_machine=m68k-none os=-os68k ;; pa-hitachi) basic_machine=hppa1.1-hitachi os=-hiuxwe2 ;; paragon) basic_machine=i860-intel os=-osf ;; pbd) basic_machine=sparc-tti ;; pbb) basic_machine=m68k-tti ;; pc532 | pc532-*) basic_machine=ns32k-pc532 ;; pc98) basic_machine=i386-pc ;; pc98-*) basic_machine=i386-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentium | p5 | k5 | k6 | nexgen | viac3) basic_machine=i586-pc ;; pentiumpro | p6 | 6x86 | athlon | athlon_*) basic_machine=i686-pc ;; pentiumii | pentium2 | pentiumiii | pentium3) basic_machine=i686-pc ;; pentium4) basic_machine=i786-pc ;; pentium-* | p5-* | k5-* | k6-* | nexgen-* | viac3-*) basic_machine=i586-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentiumpro-* | p6-* | 6x86-* | athlon-*) basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentiumii-* | pentium2-* | pentiumiii-* | pentium3-*) basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentium4-*) basic_machine=i786-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pn) basic_machine=pn-gould ;; power) basic_machine=power-ibm ;; ppc) basic_machine=powerpc-unknown ;; ppc-*) basic_machine=powerpc-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppcle | powerpclittle | ppc-le | powerpc-little) basic_machine=powerpcle-unknown ;; ppcle-* | powerpclittle-*) basic_machine=powerpcle-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppc64) basic_machine=powerpc64-unknown ;; ppc64-*) basic_machine=powerpc64-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppc64le | powerpc64little | ppc64-le | powerpc64-little) basic_machine=powerpc64le-unknown ;; ppc64le-* | powerpc64little-*) basic_machine=powerpc64le-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ps2) basic_machine=i386-ibm ;; pw32) basic_machine=i586-unknown os=-pw32 ;; rdos) basic_machine=i386-pc os=-rdos ;; rom68k) basic_machine=m68k-rom68k os=-coff ;; rm[46]00) basic_machine=mips-siemens ;; rtpc | rtpc-*) basic_machine=romp-ibm ;; s390 | s390-*) basic_machine=s390-ibm ;; s390x | s390x-*) basic_machine=s390x-ibm ;; sa29200) basic_machine=a29k-amd os=-udi ;; sb1) basic_machine=mipsisa64sb1-unknown ;; sb1el) basic_machine=mipsisa64sb1el-unknown ;; sei) basic_machine=mips-sei os=-seiux ;; sequent) basic_machine=i386-sequent ;; sh) basic_machine=sh-hitachi os=-hms ;; sh64) basic_machine=sh64-unknown ;; sparclite-wrs | simso-wrs) basic_machine=sparclite-wrs os=-vxworks ;; sps7) basic_machine=m68k-bull os=-sysv2 ;; spur) basic_machine=spur-unknown ;; st2000) basic_machine=m68k-tandem ;; stratus) basic_machine=i860-stratus os=-sysv4 ;; sun2) basic_machine=m68000-sun ;; sun2os3) basic_machine=m68000-sun os=-sunos3 ;; sun2os4) basic_machine=m68000-sun os=-sunos4 ;; sun3os3) basic_machine=m68k-sun os=-sunos3 ;; sun3os4) basic_machine=m68k-sun os=-sunos4 ;; sun4os3) basic_machine=sparc-sun os=-sunos3 ;; sun4os4) basic_machine=sparc-sun os=-sunos4 ;; sun4sol2) basic_machine=sparc-sun os=-solaris2 ;; sun3 | sun3-*) basic_machine=m68k-sun ;; sun4) basic_machine=sparc-sun ;; sun386 | sun386i | roadrunner) basic_machine=i386-sun ;; sv1) basic_machine=sv1-cray os=-unicos ;; symmetry) basic_machine=i386-sequent os=-dynix ;; t3e) basic_machine=alphaev5-cray os=-unicos ;; t90) basic_machine=t90-cray os=-unicos ;; tic54x | c54x*) basic_machine=tic54x-unknown os=-coff ;; tic55x | c55x*) basic_machine=tic55x-unknown os=-coff ;; tic6x | c6x*) basic_machine=tic6x-unknown os=-coff ;; tx39) basic_machine=mipstx39-unknown ;; tx39el) basic_machine=mipstx39el-unknown ;; toad1) basic_machine=pdp10-xkl os=-tops20 ;; tower | tower-32) basic_machine=m68k-ncr ;; tpf) basic_machine=s390x-ibm os=-tpf ;; udi29k) basic_machine=a29k-amd os=-udi ;; ultra3) basic_machine=a29k-nyu os=-sym1 ;; v810 | necv810) basic_machine=v810-nec os=-none ;; vaxv) basic_machine=vax-dec os=-sysv ;; vms) basic_machine=vax-dec os=-vms ;; vpp*|vx|vx-*) basic_machine=f301-fujitsu ;; vxworks960) basic_machine=i960-wrs os=-vxworks ;; vxworks68) basic_machine=m68k-wrs os=-vxworks ;; vxworks29k) basic_machine=a29k-wrs os=-vxworks ;; w65*) basic_machine=w65-wdc os=-none ;; w89k-*) basic_machine=hppa1.1-winbond os=-proelf ;; xbox) basic_machine=i686-pc os=-mingw32 ;; xps | xps100) basic_machine=xps100-honeywell ;; ymp) basic_machine=ymp-cray os=-unicos ;; z8k-*-coff) basic_machine=z8k-unknown os=-sim ;; none) basic_machine=none-none os=-none ;; # Here we handle the default manufacturer of certain CPU types. It is in # some cases the only manufacturer, in others, it is the most popular. w89k) basic_machine=hppa1.1-winbond ;; op50n) basic_machine=hppa1.1-oki ;; op60c) basic_machine=hppa1.1-oki ;; romp) basic_machine=romp-ibm ;; mmix) basic_machine=mmix-knuth ;; rs6000) basic_machine=rs6000-ibm ;; vax) basic_machine=vax-dec ;; pdp10) # there are many clones, so DEC is not a safe bet basic_machine=pdp10-unknown ;; pdp11) basic_machine=pdp11-dec ;; we32k) basic_machine=we32k-att ;; sh[1234] | sh[24]a | sh[34]eb | sh[1234]le | sh[23]ele) basic_machine=sh-unknown ;; sparc | sparcv8 | sparcv9 | sparcv9b | sparcv9v) basic_machine=sparc-sun ;; cydra) basic_machine=cydra-cydrome ;; orion) basic_machine=orion-highlevel ;; orion105) basic_machine=clipper-highlevel ;; mac | mpw | mac-mpw) basic_machine=m68k-apple ;; pmac | pmac-mpw) basic_machine=powerpc-apple ;; *-unknown) # Make sure to match an already-canonicalized machine name. ;; *) echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2 exit 1 ;; esac # Here we canonicalize certain aliases for manufacturers. case $basic_machine in *-digital*) basic_machine=`echo $basic_machine | sed 's/digital.*/dec/'` ;; *-commodore*) basic_machine=`echo $basic_machine | sed 's/commodore.*/cbm/'` ;; *) ;; esac # Decode manufacturer-specific aliases for certain operating systems. if [ x"$os" != x"" ] then case $os in # First match some system type aliases # that might get confused with valid system types. # -solaris* is a basic system type, with this one exception. -solaris1 | -solaris1.*) os=`echo $os | sed -e 's|solaris1|sunos4|'` ;; -solaris) os=-solaris2 ;; -svr4*) os=-sysv4 ;; -unixware*) os=-sysv4.2uw ;; -gnu/linux*) os=`echo $os | sed -e 's|gnu/linux|linux-gnu|'` ;; # First accept the basic system types. # The portable systems comes first. # Each alternative MUST END IN A *, to match a version number. # -sysv* is not here because it comes later, after sysvr4. -gnu* | -bsd* | -mach* | -minix* | -genix* | -ultrix* | -irix* \ | -*vms* | -sco* | -esix* | -isc* | -aix* | -sunos | -sunos[34]*\ | -hpux* | -unos* | -osf* | -luna* | -dgux* | -solaris* | -sym* \ | -amigaos* | -amigados* | -msdos* | -newsos* | -unicos* | -aof* \ | -aos* \ | -nindy* | -vxsim* | -vxworks* | -ebmon* | -hms* | -mvs* \ | -clix* | -riscos* | -uniplus* | -iris* | -rtu* | -xenix* \ | -hiux* | -386bsd* | -knetbsd* | -mirbsd* | -netbsd* \ | -openbsd* | -solidbsd* \ | -ekkobsd* | -kfreebsd* | -freebsd* | -riscix* | -lynxos* \ | -bosx* | -nextstep* | -cxux* | -aout* | -elf* | -oabi* \ | -ptx* | -coff* | -ecoff* | -winnt* | -domain* | -vsta* \ | -udi* | -eabi* | -lites* | -ieee* | -go32* | -aux* \ | -chorusos* | -chorusrdb* \ | -cygwin* | -pe* | -psos* | -moss* | -proelf* | -rtems* \ | -mingw32* | -linux-gnu* | -linux-newlib* | -linux-uclibc* \ | -uxpv* | -beos* | -mpeix* | -udk* \ | -interix* | -uwin* | -mks* | -rhapsody* | -darwin* | -opened* \ | -openstep* | -oskit* | -conix* | -pw32* | -nonstopux* \ | -storm-chaos* | -tops10* | -tenex* | -tops20* | -its* \ | -os2* | -vos* | -palmos* | -uclinux* | -nucleus* \ | -morphos* | -superux* | -rtmk* | -rtmk-nova* | -windiss* \ | -powermax* | -dnix* | -nx6 | -nx7 | -sei* | -dragonfly* \ | -skyos* | -haiku* | -rdos* | -toppers*) # Remember, each alternative MUST END IN *, to match a version number. ;; -qnx*) case $basic_machine in x86-* | i*86-*) ;; *) os=-nto$os ;; esac ;; -nto-qnx*) ;; -nto*) os=`echo $os | sed -e 's|nto|nto-qnx|'` ;; -sim | -es1800* | -hms* | -xray | -os68k* | -none* | -v88r* \ | -windows* | -osx | -abug | -netware* | -os9* | -beos* | -haiku* \ | -macos* | -mpw* | -magic* | -mmixware* | -mon960* | -lnews*) ;; -mac*) os=`echo $os | sed -e 's|mac|macos|'` ;; -linux-dietlibc) os=-linux-dietlibc ;; -linux*) os=`echo $os | sed -e 's|linux|linux-gnu|'` ;; -sunos5*) os=`echo $os | sed -e 's|sunos5|solaris2|'` ;; -sunos6*) os=`echo $os | sed -e 's|sunos6|solaris3|'` ;; -opened*) os=-openedition ;; -os400*) os=-os400 ;; -wince*) os=-wince ;; -osfrose*) os=-osfrose ;; -osf*) os=-osf ;; -utek*) os=-bsd ;; -dynix*) os=-bsd ;; -acis*) os=-aos ;; -atheos*) os=-atheos ;; -syllable*) os=-syllable ;; -386bsd) os=-bsd ;; -ctix* | -uts*) os=-sysv ;; -nova*) os=-rtmk-nova ;; -ns2 ) os=-nextstep2 ;; -nsk*) os=-nsk ;; # Preserve the version number of sinix5. -sinix5.*) os=`echo $os | sed -e 's|sinix|sysv|'` ;; -sinix*) os=-sysv4 ;; -tpf*) os=-tpf ;; -triton*) os=-sysv3 ;; -oss*) os=-sysv3 ;; -svr4) os=-sysv4 ;; -svr3) os=-sysv3 ;; -sysvr4) os=-sysv4 ;; # This must come after -sysvr4. -sysv*) ;; -ose*) os=-ose ;; -es1800*) os=-ose ;; -xenix) os=-xenix ;; -*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*) os=-mint ;; -aros*) os=-aros ;; -kaos*) os=-kaos ;; -zvmoe) os=-zvmoe ;; -none) ;; *) # Get rid of the `-' at the beginning of $os. os=`echo $os | sed 's/[^-]*-//'` echo Invalid configuration \`$1\': system \`$os\' not recognized 1>&2 exit 1 ;; esac else # Here we handle the default operating systems that come with various machines. # The value should be what the vendor currently ships out the door with their # machine or put another way, the most popular os provided with the machine. # Note that if you're going to try to match "-MANUFACTURER" here (say, # "-sun"), then you have to tell the case statement up towards the top # that MANUFACTURER isn't an operating system. Otherwise, code above # will signal an error saying that MANUFACTURER isn't an operating # system, and we'll never get to this point. case $basic_machine in spu-*) os=-elf ;; *-acorn) os=-riscix1.2 ;; arm*-rebel) os=-linux ;; arm*-semi) os=-aout ;; c4x-* | tic4x-*) os=-coff ;; # This must come before the *-dec entry. pdp10-*) os=-tops20 ;; pdp11-*) os=-none ;; *-dec | vax-*) os=-ultrix4.2 ;; m68*-apollo) os=-domain ;; i386-sun) os=-sunos4.0.2 ;; m68000-sun) os=-sunos3 # This also exists in the configure program, but was not the # default. # os=-sunos4 ;; m68*-cisco) os=-aout ;; mips*-cisco) os=-elf ;; mips*-*) os=-elf ;; or32-*) os=-coff ;; *-tti) # must be before sparc entry or we get the wrong os. os=-sysv3 ;; sparc-* | *-sun) os=-sunos4.1.1 ;; *-be) os=-beos ;; *-haiku) os=-haiku ;; *-ibm) os=-aix ;; *-knuth) os=-mmixware ;; *-wec) os=-proelf ;; *-winbond) os=-proelf ;; *-oki) os=-proelf ;; *-hp) os=-hpux ;; *-hitachi) os=-hiux ;; i860-* | *-att | *-ncr | *-altos | *-motorola | *-convergent) os=-sysv ;; *-cbm) os=-amigaos ;; *-dg) os=-dgux ;; *-dolphin) os=-sysv3 ;; m68k-ccur) os=-rtu ;; m88k-omron*) os=-luna ;; *-next ) os=-nextstep ;; *-sequent) os=-ptx ;; *-crds) os=-unos ;; *-ns) os=-genix ;; i370-*) os=-mvs ;; *-next) os=-nextstep3 ;; *-gould) os=-sysv ;; *-highlevel) os=-bsd ;; *-encore) os=-bsd ;; *-sgi) os=-irix ;; *-siemens) os=-sysv4 ;; *-masscomp) os=-rtu ;; f30[01]-fujitsu | f700-fujitsu) os=-uxpv ;; *-rom68k) os=-coff ;; *-*bug) os=-coff ;; *-apple) os=-macos ;; *-atari*) os=-mint ;; *) os=-none ;; esac fi # Here we handle the case where we know the os, and the CPU type, but not the # manufacturer. We pick the logical manufacturer. vendor=unknown case $basic_machine in *-unknown) case $os in -riscix*) vendor=acorn ;; -sunos*) vendor=sun ;; -aix*) vendor=ibm ;; -beos*) vendor=be ;; -hpux*) vendor=hp ;; -mpeix*) vendor=hp ;; -hiux*) vendor=hitachi ;; -unos*) vendor=crds ;; -dgux*) vendor=dg ;; -luna*) vendor=omron ;; -genix*) vendor=ns ;; -mvs* | -opened*) vendor=ibm ;; -os400*) vendor=ibm ;; -ptx*) vendor=sequent ;; -tpf*) vendor=ibm ;; -vxsim* | -vxworks* | -windiss*) vendor=wrs ;; -aux*) vendor=apple ;; -hms*) vendor=hitachi ;; -mpw* | -macos*) vendor=apple ;; -*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*) vendor=atari ;; -vos*) vendor=stratus ;; esac basic_machine=`echo $basic_machine | sed "s/unknown/$vendor/"` ;; esac echo $basic_machine$os exit # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "timestamp='" # time-stamp-format: "%:y-%02m-%02d" # time-stamp-end: "'" # End: bumprace-1.5.4/install-sh0000755000175000017500000003160011217461066012250 00000000000000#!/bin/sh # install - install a program, script, or datafile scriptversion=2006-10-14.15 # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit="${DOITPROG-}" if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. mvprog="${MVPROG-mv}" cpprog="${CPPROG-cp}" chmodprog="${CHMODPROG-chmod}" chownprog="${CHOWNPROG-chown}" chgrpprog="${CHGRPPROG-chgrp}" stripprog="${STRIPPROG-strip}" rmprog="${RMPROG-rm}" mkdirprog="${MKDIRPROG-mkdir}" posix_glob= posix_mkdir= # Desired mode of installed file. mode=0755 chmodcmd=$chmodprog chowncmd= chgrpcmd= stripcmd= rmcmd="$rmprog -f" mvcmd="$mvprog" src= dst= dir_arg= dstarg= no_target_directory= usage="Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: -c (ignored) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. --help display this help and exit. --version display version info and exit. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) shift continue;; -d) dir_arg=true shift continue;; -g) chgrpcmd="$chgrpprog $2" shift shift continue;; --help) echo "$usage"; exit $?;; -m) mode=$2 shift shift case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac continue;; -o) chowncmd="$chownprog $2" shift shift continue;; -s) stripcmd=$stripprog shift continue;; -t) dstarg=$2 shift shift continue;; -T) no_target_directory=true shift continue;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac done if test $# -ne 0 && test -z "$dir_arg$dstarg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dstarg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dstarg" shift # fnord fi shift # arg dstarg=$arg done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call `install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then trap '(exit $?); exit' 1 2 13 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names starting with `-'. case $src in -*) src=./$src ;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dstarg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dstarg # Protect names starting with `-'. case $dst in -*) dst=./$dst ;; esac # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dstarg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writeable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix=/ ;; -*) prefix=./ ;; *) prefix= ;; esac case $posix_glob in '') if (set -f) 2>/dev/null; then posix_glob=true else posix_glob=false fi ;; esac oIFS=$IFS IFS=/ $posix_glob && set -f set fnord $dstdir shift $posix_glob && set +f IFS=$oIFS prefixes= for d do test -z "$d" && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } \ && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } \ && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } \ && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # Now rename the file to the real destination. { $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null \ || { # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { if test -f "$dst"; then $doit $rmcmd -f "$dst" 2>/dev/null \ || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null \ && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; }; }\ || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } else : fi } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } } || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-end: "$" # End: bumprace-1.5.4/configure.in0000644000175000017500000000277011754254544012572 00000000000000######## Process this file with autoconf to produce a configure script. AC_INIT(README) ######## Detect the canonical host and target build environment AC_CANONICAL_HOST AC_CANONICAL_TARGET ######## Setup for automake NAME="bumprace" SDL_VERSION=1.1.5 AM_INIT_AUTOMAKE($NAME, 1.5.4) ######## Check for tools AC_PROG_CC AC_PROG_INSTALL AC_PROG_RANLIB ######## Check for compiler environment AC_C_CONST ######## Figure out which math library to use case "$target" in *-*-mingw32*) MATHLIB="" ;; *-*-beos*) MATHLIB="" ;; *) MATHLIB="-lm" AC_CHECK_LIB(m, main, , AC_MSG_ERROR(Your system is missing libm (mathlib)!)) ;; esac AC_SUBST(MATHLIB) ######## Check for SDL AM_PATH_SDL($SDL_VERSION, :, AC_MSG_ERROR([*** SDL version $SDL_VERSION not found!]) ) ######## Check for other libs AC_CHECK_LIB(jpeg, main, , AC_MSG_ERROR(Your system is missing libjpeg!)) #Commented out because of a bug in the SuSE 6.2 #AC_CHECK_LIB(png, main, , AC_MSG_ERROR(Your system is missing libpng!)) AC_CHECK_LIB(SDL_mixer, main, SOUND="-lSDL_mixer";CFLAGS="$CFLAGS -DSOUND") AC_CHECK_LIB(SDL_image, main, , AC_MSG_ERROR(Your system is missing libSDL_image!)) ######## Set compiler flags and libraries CFLAGS="$CFLAGS $SDL_CFLAGS -DDATADIR=\\\"$datadir/bumprace\\\"" LIBS="$LIBS $SDL_LIBS -lSDL_image $SOUND -lz -lSDL" ######## Check for headers ######## Finally create all the generated files AC_OUTPUT([ Makefile src/Makefile data/Makefile data/gfx/Makefile ]) bumprace-1.5.4/COPYING0000644000175000017500000004307011217461066011303 00000000000000 GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 675 Mass Ave, Cambridge, MA 02139, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. bumprace-1.5.4/README0000644000175000017500000000314011217461066011122 00000000000000 --------------------------------< BumpRace >------------------------------------ BumpRace is a simple arcade game. I'd like to receive a lot of comments and suggestions. You can get the newest version of BumpRace at: http://members.linuxstart.com/~karlb/ And you can reach me via e-mail: karlb@gmx.net Keys: PLAYER 1 moving special ability PLAYER 2 left right thrust special ability To run this, you need the SDL-library. If you don't have it, get it from: http://www.devolution.com/~slouken/SDL/ -----------------------------< RACER ABILITIES >-------------------------------- UFO-Racer: slows down automatically V-Shaped-Racer: has 10% extra time Rocket-Racer: press control for extra speed Last Racer: press control to stick to walls --------------------------------< PARAMETER >----------------------------------- "--levelset 1" selects an alternative, hard level set "--nofullscreen" "-f" guess "--nosound" "-s" guess again "--notfinal" "-n" no title screen (nice for develolopers) "--noparticles" "-t" turns of paticles. good for slow computers. "--pageflip" "-p" flicker-free fullscreen, slow and extremly buggy "--precision [value]" sets the precison of the collisions (default=10) using this is not recommended ---------------------------------< LICENSE >------------------------------------ This game is available under the GNU General Public License version 2. See COPYING for details. bumprace-1.5.4/src/0000777000175000017500000000000011754254553011126 500000000000000bumprace-1.5.4/src/gfx.c0000644000175000017500000002606611217461066011775 00000000000000#include "bumprace.h" #include "SDL_image.h" #include #include #define PATHNUM 8 #define BPP 0 #define RECTS_NUM 40000 #ifndef DATADIR #define DATADIR "BumpRace.app/Contents/Resources/data" #endif char DATAPATH[200]=DATADIR; const char PATH[PATHNUM][200]={DATADIR,".","data","/usr/local/share/bumprace" ,"/usr/lib/bumprace","../data","/usr/share/bumprace", DATADIR}; SDL_Surface *Screen,*BackBuffer,*fadebuffer; SDL_Rect blitrect,blitrects[RECTS_NUM]; int blitrects_num=0; #ifdef DATADIR void ComplainAndExit(void) { fprintf(stderr, "Problem: %s\n", SDL_GetError()); exit(1); } #endif int abrand(int a,int b) //random number between a and b (inclusive) { return(a+(rand() % (b-a+1))); } int (*_PutPixel)(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color); int fast_putpixel1(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { if (X < 0 || X > Surface->w || Y < 0 || Y > Surface->h) return -1; *((Uint8 *)Surface->pixels + Y * Surface->pitch + X) = Color; return 0; } int fast_putpixel2(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { if (X < 0 || X > Surface->w || Y < 0 || Y > Surface->h) return -1; *((Uint16 *)Surface->pixels + Y * Surface->pitch/2 + X) = Color; return 0; } int fast_putpixel3(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { Uint8 *pix; int shift; if (X < 0 || X > Surface->w || Y < 0 || Y > Surface->h) return -1; /* Gack - slow, but endian correct */ pix = (Uint8 *)Surface->pixels + Y * Surface->pitch + X*3; shift = Surface->format->Rshift; *(pix+shift/8) = Color>>shift; shift = Surface->format->Gshift; *(pix+shift/8) = Color>>shift; shift = Surface->format->Bshift; *(pix+shift/8) = Color>>shift; return 0; } int fast_putpixel4(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { if (X < 0 || X > Surface->w || Y < 0 || Y > Surface->h) return -1; *((Uint32 *)Surface->pixels + Y * Surface->pitch/4 + X) = Color; return 0; } void init_SDL() // sets the video mode { int bpp=BPP; const SDL_VideoInfo *info; if ( SDL_Init(SDL_INIT_VIDEO|SDL_INIT_TIMER|SDL_INIT_AUDIO) < 0 ) {ComplainAndExit();} info = SDL_GetVideoInfo(); if (info->vfmt->BitsPerPixel==8) bpp=16; atexit(SDL_Quit); // Set the video mode (800x600 at 16-bit depth) if (fullscreen) Screen = SDL_SetVideoMode(800, 600, BPP, SDL_FULLSCREEN); else { Screen = SDL_SetVideoMode(800, 600, BPP, 0); } if ( Screen == NULL ) {ComplainAndExit();} // create BackBuffer BackBuffer = SDL_AllocSurface(Screen->flags, 800, 600, Screen->format->BitsPerPixel, Screen->format->Rmask, Screen->format->Gmask, Screen->format->Bmask, 0); if (BackBuffer == NULL) printf("ERROR: Couldn't create BackBuffer: %s\n", SDL_GetError()); fadebuffer = SDL_AllocSurface(Screen->flags, 800, 600, Screen->format->BitsPerPixel, Screen->format->Rmask, Screen->format->Gmask, Screen->format->Bmask, 0); if (fadebuffer == NULL) printf("ERROR: Couldn't create fadebuffer: %s\n", SDL_GetError()); // Figure out what putpixel routine to use switch (Screen->format->BytesPerPixel) { case 1: _PutPixel = fast_putpixel1; break; case 2: _PutPixel = fast_putpixel2; break; case 3: _PutPixel = fast_putpixel3; break; case 4: _PutPixel = fast_putpixel4; break; } } void lock() { if ( SDL_MUSTLOCK(Screen) ) { if ( SDL_LockSurface(Screen) < 0 ) return; } } void unlock() { if ( SDL_MUSTLOCK(Screen) ) { SDL_UnlockSurface(Screen); } } // Performs Callback at each line point. This came straight from the // asphyxia vga trainers int DoLine (SDL_Surface *Surface, Sint32 X1, Sint32 Y1, Sint32 X2, Sint32 Y2, Uint32 Color, int Callback (SDL_Surface *Surf, Sint32 X, Sint32 Y, Uint32 Color)) { Sint32 dx, dy, sdx, sdy, x, y, px, py; dx = X2 - X1; dy = Y2 - Y1; sdx = (dx < 0) ? -1 : 1; sdy = (dy < 0) ? -1 : 1; dx = sdx * dx + 1; dy = sdy * dy + 1; x = y = 0; px = X1; py = Y1; if (dx >= dy) { for (x = 0; x < dx; x++) { Callback(Surface, px, py, Color); y += dy; if (y >= dx) { y -= dx; py += sdy; } px += sdx; } } else { for (y = 0; y < dy; y++) { Callback(Surface, px, py, Color); x += dx; if (x >= dy) { x -= dy; px += sdx; } py += sdy; } } return 0; } void fadeout() { int y; SDL_Rect rect; Uint32 time; rect.x = 0; rect.w = 800; rect.h = 1; for (y=0; y<600; y+=2) { time = SDL_GetTicks(); rect.y = y; SDL_FillRect(Screen, &rect, SDL_MapRGB(Screen->format, 0,0,0)); SDL_UpdateRects(Screen, 1, &rect); if (time == SDL_GetTicks()) SDL_Delay(1); } for (y=599; y>0; y-=2) { rect.y = y; SDL_FillRect(Screen, &rect, SDL_MapRGB(Screen->format, 0,0,0)); SDL_UpdateRects(Screen, 1, &rect); } /* int x,y; if (dofadeout==0) return; for (x=0;x<800;x++) { lock(); for (y=0;y<300;y++) { PutPixel(Screen,x,y*2,SDL_MapRGB(Screen->format,0,0,0)); } unlock(); Update(); } for (x=799;x>=0;x--) { lock(); for (y=299;y>0;y--) { PutPixel(Screen,x,y*2+1,SDL_MapRGB(Screen->format,0,0,0)); } unlock(); Update(); }*/ } void Update() { SDL_UpdateRects(Screen,blitrects_num,blitrects); blitrects_num=0; } void AddRect(int x1, int y1, int x2, int y2) { int temp; /* Make sure X1 is before X2 */ if (x2 < x1){ temp = x2; x2 = x1; x1 = temp; } /* Make sure Y1 is before Y2 */ if (y2 < y1){ temp = y2; y2 = y1; y1 = temp; } blitrect.x = x1; blitrect.y = y1; blitrect.w = x2-x1+1; blitrect.h = y2-y1+1; if (x1<0) printf("x is too small in function AddRect! - %d\n",x1);else if (y1<0) printf("y is too small in function AddRect! - %d\n",y1);else if (x2>=800) printf("x is too big in function AddRect! - %d\n",x2);else if (y2>=600) printf("y is too big in function AddRect! - %d\n",y2);else { blitrects[blitrects_num]=blitrect; if (++blitrects_num>=RECTS_NUM-2) {printf("Too many blits!\n");blitrects_num--;Update();} } } void AddThisRect(SDL_Rect blitrect) { blitrects[blitrects_num]=blitrect; if (++blitrects_num>=RECTS_NUM-2) {printf("Too many blits!\n");blitrects_num--;Update();} } void Blit(int Xpos,int Ypos,SDL_Surface *image) //blits one GIF or BMP from the memory to the screen { blitrect.x = Xpos; blitrect.y = Ypos; blitrect.w = image->w; blitrect.h = image->h; if (Xpos<-image->w) printf("WRONG BLIT: Xpos is too small! - %d\n",Xpos); else if (Xpos>=800) printf("WRONG BLIT: Xpos is too big! - %d\n",Xpos); else if (Ypos<-image->h) printf("WRONG BLIT: Ypos is too small! - %d\n",Ypos); else if (Ypos>=600) printf("WRONG BLIT: Ypos is too big! - %d\n",Ypos); else if ( SDL_BlitSurface(image, NULL, Screen, &blitrect) < 0 ) { SDL_FreeSurface(image); ComplainAndExit(); } blitrects[blitrects_num]=blitrect; blitrects_num++; } SDL_Surface *LoadImage(char *datafile, int transparent) // reads one png into the memory { SDL_Surface *pic,*pic2; char filename[200]; int i=0; sprintf(filename,"%s/gfx/%s",DATAPATH,datafile); pic=IMG_Load(filename); while ( pic == NULL ) { strcpy(DATAPATH,PATH[i]); sprintf(filename,"%s/gfx/%s",DATAPATH,datafile); pic=IMG_Load(filename); i++; if (i>=PATHNUM) { fprintf(stderr,"Couldn't load %s: %s\n", filename, SDL_GetError()); exit(2); } } if (transparent==3) return(pic); if (transparent==1) SDL_SetColorKey(pic,SDL_SRCCOLORKEY|SDL_RLEACCEL,SDL_MapRGB(pic->format,0xFF,0xFF,0xFF)); if (transparent==2) SDL_SetColorKey(pic,SDL_SRCCOLORKEY|SDL_RLEACCEL,SDL_MapRGB(pic->format,0x00,0x00,0x00)); pic2 = SDL_DisplayFormat(pic); SDL_FreeSurface(pic); // blit(0,0,pic2); // SDL_UpdateRect(screen,0,0,0,0); return (pic2); } void BlitToBB(int Xpos,int Ypos,SDL_Surface *image) //blits one GIF or BMP from the memory to the screen { blitrect.x = Xpos; blitrect.y = Ypos; blitrect.w = image->w; blitrect.h = image->h; if ( SDL_BlitSurface(image, NULL, BackBuffer, &blitrect) < 0 ) { SDL_FreeSurface(image); ComplainAndExit(); } } void BlitPart(int Xpos,int Ypos,SDL_Surface *image, SDL_Rect srcrect) { blitrect.x = srcrect.x; blitrect.y = srcrect.y; blitrect.w = srcrect.w; blitrect.h = srcrect.h; if ( SDL_BlitSurface(image, &srcrect , Screen, &blitrect) < 0 ) { SDL_FreeSurface(image); ComplainAndExit(); } blitrects[blitrects_num]=blitrect; blitrects_num++; } void FadeScreen(float speed) { Sint32 now,i; SDL_BlitSurface(Screen,NULL,fadebuffer,NULL); now=SDL_GetTicks(); for (i=255*speed;i>=0;i-=SDL_GetTicks()-now) { now=SDL_GetTicks(); SDL_BlitSurface(fadebuffer,&blitrect,Screen,&blitrect); SDL_SetAlpha(BackBuffer,SDL_SRCALPHA,255-(int)(i/speed)); Blit(0,0,BackBuffer); Update(); } SDL_SetAlpha(BackBuffer,SDL_SRCALPHA,255); Blit(0,0,BackBuffer); Update(); } int PutPixel(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { if (X<0) printf("X < 0 in function PutPixel! - %d\n",X); else if (X>=800) printf("X >= 800 in function PutPixel! - %d\n",X); else if (Y<0) printf("Y < 0 in function PutPixel! - %d\n",Y); else if (Y>=600) printf("Y >= 600 in function PutPixel! - %d\n",Y); else { _PutPixel(Surface,X,Y,Color); AddRect(X,Y,X,Y); } return 0; } int PutPixelC(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color) { if (X<0) printf("X < 0 in function PutPixelC! - %d\n",X); else if (X>=800) printf("X >= 800 in function PutPixelC! - %d\n",X); else if (Y<0) printf("Y < 0 in function PutPixelC! - %d\n",Y); else if (Y>=600) printf("Y >= 600 in function PutPixelC! - %d\n",Y); else { _PutPixel(Surface,X,Y,Color); AddRect(X,Y,X,Y); } return 0; } void PutBackPixel(SDL_Surface *Surface, Sint32 X, Sint32 Y) { SDL_Rect rect; rect.w=1; rect.h=1; rect.x=X; rect.y=Y; SDL_BlitSurface(BackBuffer, &rect, Surface, &rect); AddThisRect(rect); } bumprace-1.5.4/src/options.h0000644000175000017500000000012011217461066012670 00000000000000extern void ReadOptions(); extern void FinalScore(); extern void ShowHiscore(); bumprace-1.5.4/src/Makefile.am0000644000175000017500000000031111217461066013062 00000000000000bin_PROGRAMS = bumprace bumprace_SOURCES = bumprace.c \ gfx.c particles.c menu.c \ bumprace.h gfx.h \ levels.h levels2.h menu.h particles.h \ options.h options.c font.h font.c #SUBDIRS = mixerbumprace-1.5.4/src/levels.h0000644000175000017500000005744611217461066012516 00000000000000#include // ********************* These are the levels: ********************** // 1=normal 2=lightning 3=stopper 4=finish 5=teleporter 6=time bonus // 7=vertical laser 8=cannon Uint8 map[26][15][20]; Uint8 origMap[26][15][20] = { // 0 { {0,0,0,0,1,1,1,3,3,3,3,1,0,0,0,0,0,0,0,0}, {0,0,0,0,1,1,1,3,3,0,0,1,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,1,0,0,0,0,0,0,0,0}, {0,0,1,1,1,0,0,0,1,0,0,1,1,1,1,1,0,0,0,0}, {0,0,1,0,0,0,0,0,1,0,0,0,0,0,1,1,0,0,1,1}, {0,0,1,0,0,0,1,1,1,1,0,0,0,0,0,1,0,0,0,0}, {0,0,0,0,0,0,0,0,2,2,1,1,1,0,0,1,0,0,0,0}, {0,0,0,1,1,1,0,0,2,2,1,1,0,0,0,1,0,0,0,0}, {0,0,0,1,0,0,0,0,2,1,0,0,0,0,1,1,1,1,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,1,1,1,0,0,0,0}, {0,0,0,1,0,0,0,0,1,0,0,0,0,1,1,1,0,0,0,0}, {0,0,0,1,0,0,1,1,1,0,0,0,0,1,1,1,0,0,0,4}, {1,1,1,1,0,0,0,0,0,0,0,0,0,1,1,1,0,11,12,13}, {1,1,1,1,1,0,0,0,0,0,0,1,1,1,1,1,1,14,15,16} }, { {0,0,1,1,1,1,1,1,1,1,1,1,1,1,1,0,0,0,0,0}, {0,0,0,0,0,1,1,1,1,1,1,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,1,1,0,0,0,1,0,1,0,0,4,0,0}, {1,1,1,1,0,0,0,0,1,0,2,0,1,0,1,0,0,0,0,0}, {0,0,0,1,1,0,0,0,0,0,1,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,1,0,1,0,0,1,0,1,0,0}, {0,0,0,0,0,0,1,1,1,0,2,0,1,0,0,0,0,0,0,0}, {0,0,0,0,0,1,1,0,0,0,0,0,1,0,2,0,0,0,0,1}, {0,0,1,1,1,1,0,0,1,1,1,0,0,0,0,0,0,0,1,1}, {0,0,1,1,1,1,0,0,1,1,1,1,1,1,1,0,0,1,1,1}, {0,0,0,0,1,1,1,0,1,1,1,0,0,0,0,0,0,1,1,1}, {0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,1,1,1}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,1}, {0,0,0,0,0,1,0,0,1,0,0,0,0,1,0,0,0,11,12,13}, {0,0,0,0,0,1,0,0,1,1,1,0,0,1,0,0,0,14,15,16} }, { {0,0,0,0,1,11,12,13,0,1,0,0,0,0,0,0,0,0,0,4}, {0,0,0,0,1,14,15,16,0,1,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,1,0,0,0,0,1,0,0,0,0,0}, {1,1,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,1,1,1,0,0,1,1,1,1,0,1,1,1,3,1,3}, {0,0,0,0,1,1,1,0,0,1,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,1,1,1,0,0,1,1,1,1,1,1,0,0,1,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,1,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,1,0,0}, {1,1,1,1,1,1,1,0,0,1,1,1,0,0,1,0,0,1,0,0}, {0,0,0,0,0,0,1,0,0,1,8,1,0,0,1,0,0,1,0,0}, {0,0,0,0,0,0,1,0,0,1,1,1,0,0,1,0,0,1,0,0}, {0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,1,1,1,1,1,1,1,1,0,0,0,0,0,0} }, { {0,0,0,1,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0}, {0,0,0,1,0,0,1,0,0,1,0,0,0,0,0,0,0,0,0,0}, {0,0,0,1,0,0,1,0,0,0,0,0,0,0,0,1,0,0,0,0}, {0,0,0,1,0,0,0,0,1,1,1,0,0,0,0,1,0,0,0,0}, {0,0,0,1,0,0,0,0,1,1,1,0,1,0,0,1,0,0,0,0}, {0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0,0,0}, {0,0,0,0,0,0,1,0,0,0,0,0,1,0,1,0,0,0,0,0}, {0,0,1,1,1,0,1,0,0,0,0,0,0,0,0,0,1,1,1,1}, {0,0,0,0,0,0,0,0,1,1,1,1,1,1,0,0,0,0,0,0}, {0,0,0,0,0,1,0,0,0,0,0,0,0,1,0,0,0,0,0,0}, {2,2,2,0,0,0,0,0,0,0,0,2,0,8,0,0,0,0,4,4}, {0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,2,0,4,4}, {0,0,0,0,0,1,1,1,0,0,0,2,0,0,0,0,0,0,4,4}, {0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,11,12,13}, {0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,14,15,16} }, { {0,0,0,1,0,0,0,7,0,0,0,1,0,0,0,0,0,0,0,4}, {0,0,0,1,0,0,0,7,0,0,0,1,0,0,0,0,0,1,0,0}, {0,0,0,1,0,0,0,7,0,0,0,1,0,0,0,0,0,0,1,0}, {0,0,0,1,0,0,0,1,0,0,0,1,1,0,0,0,0,0,0,0}, {0,0,0,1,0,0,0,1,0,0,0,1,0,0,0,1,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,0,1,0,1,0,0,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,0,1,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,0,1,0,0,0,0,1,0,0,0}, {1,1,1,1,1,1,1,1,0,0,0,1,0,0,1,0,0,1,0,0}, {0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,1,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,1,0,0,2,0,0,1,0,0}, {0,0,3,1,1,1,1,1,1,1,1,1,0,0,2,1,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,2,0,0,0,0,4}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,2,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,2,0,4,14,15,16} }, // 5 { {0,0,0,0,0,0,5,0,0,0,0,0,0,0,1,4,4,4,4,4}, {0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,1,0,0,0,0}, {0,0,0,0,0,0,1,3,0,0,0,0,0,0,0,0,1,0,0,0}, {5,0,0,0,0,0,1,0,0,3,0,1,0,0,1,0,0,1,0,0}, {1,1,1,1,1,0,1,0,0,0,0,1,0,0,0,1,0,0,1,0}, {0,0,0,0,0,0,1,0,3,0,0,1,0,0,0,0,1,0,0,0}, {0,0,0,0,0,0,1,0,0,0,0,1,0,0,0,0,0,1,0,0}, {0,0,0,0,0,0,1,3,0,3,0,1,0,0,0,0,0,0,1,0}, {0,0,0,0,0,0,1,0,0,0,0,1,0,0,0,0,0,0,1,0}, {2,0,0,1,1,1,1,0,0,0,3,1,0,0,0,0,0,0,1,0}, {0,0,0,0,0,0,0,0,3,0,0,1,0,0,0,0,0,0,1,0}, {0,0,0,0,0,0,0,0,0,0,0,1,0,1,1,1,1,0,1,0}, {0,0,0,0,0,0,1,0,0,3,0,1,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,1,0,0,3,0,1,2,0,2,0,2,11,12,13}, {0,0,0,0,0,0,1,0,0,3,0,1,2,0,4,0,2,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,1,1,1,1,1,1,1,1,1,1,1,1,1,0,0}, {0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,1,0,0}, {0,0,0,0,0,1,0,1,1,1,1,1,1,1,1,0,0,1,0,0}, {0,0,0,0,0,1,0,0,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,1,0,0,1,0,0,0,1,0,1,0,0,0,0,0}, {0,0,0,0,0,1,0,0,2,4,4,4,1,0,1,0,1,1,1,1}, {0,0,0,0,0,1,0,0,2,4,4,4,1,0,1,0,0,0,0,0}, {0,0,0,0,0,1,0,0,2,4,4,4,1,0,1,0,0,0,0,0}, {0,0,0,0,0,8,0,0,1,0,0,0,1,0,1,0,0,0,1,0}, {0,0,0,0,0,1,0,0,0,0,0,0,0,0,1,0,0,0,1,0}, {0,0,0,0,0,1,0,1,1,1,1,1,1,1,1,0,0,0,1,6}, {0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,1,6}, {0,0,0,0,0,1,1,1,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,1,5,5,1,4,4,4,4}, {0,0,0,0,0,0,0,0,1,0,0,0,1,0,0,1,0,0,0,0}, {0,0,1,1,1,1,0,0,1,0,0,0,1,0,0,1,0,5,5,0}, {0,0,1,0,0,0,0,0,1,0,0,0,1,0,0,1,0,2,2,0}, {0,0,1,0,0,0,0,0,1,0,0,0,0,0,0,1,0,0,0,0}, {0,0,1,0,0,0,0,0,1,0,0,0,0,0,0,1,0,0,0,0}, {0,0,0,0,0,0,0,0,1,1,1,1,2,0,0,1,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,1,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,1,0,0,0,0}, {0,1,1,1,1,1,2,0,1,0,0,0,0,0,1,1,0,0,0,0}, {0,0,1,1,1,1,2,0,1,0,0,1,1,1,1,1,0,0,0,0}, {0,0,0,1,1,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0}, {2,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,11,12,13}, {2,2,0,0,0,0,0,0,0,0,0,3,3,3,3,3,3,14,15,16} }, { {0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,1,0,2,2,2,2,2,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,2,0,0,0,2,0,0,0,0,1,0,0,0,0,0,1,3}, {1,0,0,2,0,2,4,2,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,0,2,0,2,2,2,0,0,0,0,0,0,1,0,0,0,3,4}, {0,0,1,0,0,1,1,1,0,0,0,0,1,0,0,0,0,0,1,3}, {0,0,1,0,1,1,1,1,0,1,0,1,0,0,0,0,1,0,0,0}, {0,0,0,0,0,1,1,1,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,1,1,8,0,0,1,0,1,0,0,0,0,0,1,0}, {0,0,0,0,0,1,1,0,0,0,1,0,0,0,0,0,1,0,0,0}, {0,0,0,0,0,1,1,0,0,0,1,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,1,0,0,0,1,1,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,1,0,0,0,1,1,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,1,1,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,1,1,1,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,1,1,1,1,1,0,0,0,0,1,1,1,1}, {0,0,0,0,0,0,0,1,1,1,0,0,0,0,0,0,0,1,1,1}, {0,0,0,0,0,0,0,1,1,0,0,0,0,1,0,0,0,0,1,1}, {1,1,1,1,0,0,1,1,0,0,0,1,1,1,1,0,0,0,0,1}, {0,0,0,0,0,0,0,1,0,0,1,1,1,1,1,1,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,0,1,1,1,1,1,0,0,0,0}, {2,2,2,2,3,3,0,1,0,0,0,1,1,1,1,0,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,0,0,1,1,0,0,0,1,1,0}, {0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,4,4,0}, {0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0,0}, {0,0,0,0,0,1,0,1,0,0,0,0,0,1,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,1,1,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,1,1,2,2,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,1,1,1,6,6,0,11,12,13}, {0,0,0,0,0,0,0,0,0,1,1,1,1,1,1,1,2,14,15,16} }, // 10 { {0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,1,1,1,1,1,1,1,0,0,0}, {0,0,0,1,1,1,1,1,1,1,1,0,0,0,0,5,1,0,0,0}, {0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,0,1,0,0,0,1,0,0,0,0,1,1,0,0,1,0,0,0}, {0,0,0,1,0,0,4,1,1,1,0,0,0,1,1,1,1,0,0,0}, {0,0,0,1,0,0,4,1,1,1,0,0,0,0,0,1,1,1,1,0}, {1,0,0,1,0,0,1,1,1,1,0,0,0,0,0,0,1,0,0,0}, {0,0,0,1,0,0,0,1,0,0,0,0,8,0,0,0,0,0,0,0}, {0,0,0,1,0,0,0,0,0,0,0,0,1,1,0,0,0,0,0,0}, {0,0,1,1,0,0,0,0,0,0,0,0,1,1,1,1,0,0,0,0}, {0,0,0,1,1,1,1,1,1,1,1,0,0,1,1,1,1,1,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,11,12,13}, {1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,1,14,15,16} }, { {0,0,0,0,1,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0}, {0,0,1,0,0,0,1,0,1,0,0,0,0,1,1,1,1,1,0,0}, {0,0,0,0,0,0,0,0,1,0,0,1,0,1,0,0,0,0,0,1}, {1,0,0,0,1,0,0,0,1,0,0,0,0,1,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,1,0,0,0,1,0,0,0,0,0,0}, {0,0,1,0,0,0,1,0,0,0,0,0,0,1,0,2,2,2,2,4}, {0,0,0,0,0,0,0,0,0,0,1,0,0,1,0,0,0,0,0,3}, {1,1,1,1,1,0,0,0,1,1,1,0,0,0,0,2,2,2,2,4}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0}, {0,1,1,1,1,1,0,0,1,0,0,0,0,0,1,0,0,1,0,0}, {0,1,0,0,0,1,0,0,1,0,0,1,0,0,1,0,0,1,0,0}, {0,1,5,1,0,1,0,0,1,0,0,1,1,0,1,0,0,1,0,5}, {0,1,1,1,0,1,0,0,0,0,0,1,0,0,0,0,0,11,12,13}, {0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,1,1,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,2,3,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,1,1,0,0,3,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,2,2,0,0,3,0}, {0,0,0,0,1,0,0,0,0,0,0,1,1,0,0,0,0,0,3,0}, {0,0,0,0,1,0,0,0,0,0,0,2,2,0,0,8,0,0,3,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,3,0}, {0,0,0,0,1,0,0,0,1,1,0,0,0,0,0,0,0,0,3,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,3,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,4}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,2,2,2,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,1,6,6,4,0,0,0,0,0}, {0,0,0,0,1,1,1,0,0,0,0,0,1,0,0,0,4,0,0,0}, {0,0,0,0,0,0,0,1,0,1,0,0,1,1,4,0,0,0,4,0}, {0,0,0,0,0,0,0,0,1,0,0,0,1,1,1,0,4,0,0,0}, {0,0,0,1,0,0,0,0,8,0,0,0,0,0,0,1,1,1,0,0}, {1,1,1,0,0,0,0,0,1,0,0,0,0,0,0,0,0,1,0,0}, {0,0,0,0,0,1,0,0,11,12,13,0,0,0,0,0,0,1,0,0}, {0,0,0,0,0,1,0,0,14,15,16,0,0,0,2,0,0,1,0,0}, {1,1,1,0,0,0,0,0,1,0,0,0,0,1,0,0,0,1,0,0}, {0,0,0,1,0,0,0,0,1,0,0,0,1,0,0,0,0,1,0,0}, {0,0,0,0,1,0,0,0,1,0,1,1,0,0,0,0,0,1,0,0}, {0,0,0,0,0,1,0,0,1,0,0,1,0,0,0,0,1,0,0,0}, {0,0,0,0,0,0,0,0,1,1,0,1,0,0,0,1,0,0,0,0}, {0,0,1,1,1,1,1,1,1,0,0,1,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,1,3,3,0,0,0,0,0,0} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,1,1,1,1,1,1,1,1,1,1,1,1,1,0,0,0}, {0,0,1,1,1,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,1,0,0,0,1,1,1,1,1,1,1,1,0,0,1,0,0,0}, {0,0,1,2,0,0,1,0,0,0,0,0,0,1,0,0,1,0,0,0}, {0,0,1,6,0,0,1,0,1,1,1,1,0,1,0,0,1,0,0,0}, {0,0,1,2,0,0,1,0,1,0,0,1,0,1,0,0,1,0,0,0}, {0,0,1,6,0,0,1,0,0,0,0,1,0,1,0,0,1,0,0,0}, {0,0,1,2,0,0,1,1,1,1,1,1,0,1,0,0,1,0,0,0}, {0,0,1,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0}, {0,0,0,1,1,1,1,1,1,1,1,1,1,1,0,0,0,0,0,0}, {0,0,0,1,4,0,0,0,0,0,0,0,0,1,1,1,1,1,0,0}, {0,0,0,1,1,1,1,1,1,1,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, // 15 { {0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,1,0,0,0}, {0,0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,0,3,2,0,0,0,1,0,0,1,0,0,1,0,0,1,0,0,0}, {2,0,0,0,2,0,0,0,0,0,0,0,0,1,0,0,1,0,0,0}, {0,2,0,0,0,1,0,0,1,0,0,0,0,1,0,0,0,0,0,0}, {0,0,2,3,0,0,1,0,0,0,0,0,0,1,0,0,0,0,0,1}, {0,0,0,2,0,0,3,2,0,0,1,0,0,1,0,0,0,0,1,0}, {0,0,0,0,2,0,0,0,2,0,0,0,0,1,0,0,0,1,0,0}, {0,0,0,0,0,1,0,0,0,1,0,0,0,1,0,0,1,0,0,0}, {0,0,0,0,0,0,1,3,0,0,2,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,1,0,0,3,2,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,1,1,1,1,1,1,1,1}, {0,0,0,0,0,0,0,0,0,1,0,0,1,0,0,0,4,1,1,1}, {0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,4,11,12,13}, {0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,4,14,15,16} }, { {0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,7,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,7,0,1,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0}, {0,0,7,0,0,1,1,1,2,2,1,1,1,0,0,0,0,0,0,0}, {0,0,7,0,0,0,1,6,2,2,6,1,0,0,0,0,0,0,0,0}, {0,0,7,0,0,0,0,2,2,2,2,0,0,0,0,0,0,0,0,0}, {0,0,1,1,1,1,1,1,2,2,1,1,1,1,1,0,0,0,0,0}, {0,0,0,0,0,0,0,2,4,4,2,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,1,1,5,5,1,2,0,0,0,0,0,0,0,0}, {1,1,0,0,0,8,0,1,5,5,1,0,2,0,0,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,2,0,0,0,0,0,0}, {0,0,0,1,0,0,0,0,0,0,0,0,0,0,2,0,0,0,0,0}, {0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,2,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,2,0,2,0,2,0,2,0,2,0,2,0,0,0,0,0}, {0,0,0,0,2,0,2,0,2,0,2,0,2,0,2,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,1,0,4,4,0,0,0,4,4,0,1,0,0,0,0,0}, {0,0,0,0,1,0,4,4,0,0,0,4,4,0,1,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,8,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,1,0,0,0,3,3,3,0,0,0,1,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,1,0,4,4,4,4,4,4,4,0,1,0,0,0,0,0}, {0,0,0,0,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,1,1,1,1,1,1,1,1,1,1,1,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,2,0,0}, {1,1,1,1,1,1,0,0,1,0,0,1,1,0,0,0,0,2,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,1,0,0,0,0,1,0,0}, {0,0,0,0,0,0,0,0,1,4,4,0,1,0,0,1,1,1,0,0}, {0,0,0,0,1,0,0,0,1,1,1,1,1,1,0,7,0,0,0,0}, {0,0,0,0,1,0,0,0,2,0,0,8,1,1,1,7,0,0,0,0}, {0,0,0,0,1,0,0,0,7,0,0,0,1,1,1,1,0,0,0,0}, {0,0,0,0,1,0,0,0,2,0,0,0,1,1,1,0,0,0,0,0}, {0,0,0,0,1,1,1,1,1,0,0,0,1,0,0,0,0,0,0,1}, {0,0,0,0,0,0,1,0,0,0,0,0,2,0,0,0,0,0,1,1}, {1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,1}, {0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3,11,12,13}, {6,7,0,0,0,0,1,0,0,0,0,0,0,0,0,0,3,14,15,16} }, { {0,0,1,0,0,7,0,0,0,1,0,0,0,7,0,0,1,1,1,1}, {0,0,1,0,0,7,0,1,0,0,0,1,0,7,0,0,1,1,1,1}, {0,0,1,0,0,1,1,1,1,1,1,1,1,1,0,0,0,1,0,0}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,1,0,4}, {0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,1,0,1,0,4}, {1,1,1,1,1,1,0,0,1,0,0,1,1,0,0,1,0,0,0,4}, {0,0,0,0,0,0,0,0,1,0,0,1,1,0,0,1,0,0,0,4}, {0,0,0,0,0,0,0,0,1,0,0,1,1,0,0,0,0,1,0,4}, {0,0,0,0,1,1,1,1,1,0,0,0,1,0,0,0,0,1,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,1,1,1}, {0,1,0,0,0,0,0,0,0,0,0,0,1,1,1,1,0,0,0,0}, {0,1,0,0,0,1,1,1,1,0,0,0,2,0,0,0,0,0,0,0}, {0,1,0,0,0,1,1,1,1,1,0,0,0,0,0,0,0,0,0,0}, {0,1,1,1,1,1,1,1,1,1,1,1,1,1,1,0,3,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3,14,15,16} }, // 20 { {0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,3,0,0,0}, {0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,7,1,0,0,0,0,0,0,1,0,0,0,0,2,0,0,0}, {0,0,0,7,7,1,0,0,0,0,0,1,4,0,0,0,1,0,0,0}, {0,0,0,7,7,0,1,0,0,0,0,1,4,0,0,0,1,3,0,0}, {0,0,0,7,7,0,0,1,0,0,0,1,4,0,0,0,1,0,0,3}, {0,0,0,7,7,0,0,0,1,0,0,1,4,0,0,0,3,0,0,0}, {0,0,0,7,7,0,3,0,0,0,0,1,0,0,0,0,1,0,0,0}, {0,0,0,7,7,0,0,0,1,0,0,0,0,0,0,0,1,0,3,0}, {0,0,0,7,7,0,0,1,0,0,0,0,0,0,0,1,3,0,0,0}, {0,0,0,7,7,0,1,0,0,0,0,0,0,0,1,0,0,0,0,3}, {0,0,0,7,7,1,1,1,1,1,1,1,1,1,0,0,3,0,0,1}, {0,0,0,7,1,0,0,0,0,0,1,1,1,3,0,0,0,0,1,1}, {0,0,0,1,0,0,0,1,0,0,0,1,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,1,1,1,0,0,0,0,0,0,3,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, { {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,12,13}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,15,16} }, }; bumprace-1.5.4/src/levels2.h0000644000175000017500000002071411217461066012564 00000000000000#include // ********************* These are the levels: ********************** // 1=normal 2=lightning 3=stopper 4=finish 5=teleporter 6=time bonus // 7=vertical laser 8=cannon Uint8 origMap2[28][15][20] = { { {6,0,6,2,6,6,6,2,6,0,0,0,0,0,0,0,0,0,0,8}, {0,0,0,2,0,0,0,2,0,0,0,0,0,0,0,0,0,0,0,0}, {0,6,0,2,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,2,0,0,0,7,0,0,0,2,2,0,0,2,2,2,2,2}, {0,0,0,2,0,0,0,7,0,0,0,2,2,0,0,0,2,2,0,0}, {0,0,0,2,0,0,0,2,0,0,0,2,2,0,0,0,0,2,2,0}, {0,0,0,2,0,0,0,2,0,0,0,2,2,2,0,0,0,0,2,2}, {0,0,0,7,0,0,0,2,0,0,0,2,0,2,2,0,0,0,0,0}, {0,0,0,7,0,0,0,2,0,0,0,2,0,0,2,2,0,0,0,0}, {0,0,0,7,0,0,0,2,0,0,0,2,0,0,0,2,2,0,0,0}, {0,0,0,2,0,0,0,2,0,0,0,2,0,0,0,0,2,2,0,0}, {0,0,0,2,0,0,0,2,0,0,0,2,0,0,0,0,0,2,2,4}, {0,0,0,2,0,0,0,2,0,0,0,2,0,0,0,0,0,0,0,0}, {0,0,0,2,0,0,0,2,0,0,0,2,0,0,0,0,11,12,13}, {0,0,0,2,0,0,0,2,0,0,0,2,0,0,0,0,14,15,16} }, { {0,0,0,0,7,7,7,7,6,0,7,7,7,7,6,0,7,0,0,8}, {0,0,0,0,7,0,0,7,0,0,7,0,0,7,0,0,7,0,0,2}, {0,0,0,0,7,0,0,7,7,7,7,0,0,7,0,0,7,0,0,2}, {1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,2,0,0}, {2,0,0,0,2,0,0,7,0,0,2,0,0,7,0,0,2,0,0,2}, {3,0,2,0,0,0,0,2,0,0,0,0,0,2,0,0,0,0,0,2}, {2,0,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1}, {3,0,1,5,5,5,5,5,5,5,1,0,0,0,0,2,0,0,6,2}, {2,0,1,1,1,1,1,1,1,1,1,0,2,2,0,0,0,2,6,2}, {0,0,0,0,6,7,7,7,7,7,7,0,2,2,2,2,2,2,7,7}, {0,0,0,0,0,7,7,7,7,7,7,0,0,2,2,2,2,2,7,7}, {0,0,0,0,0,7,7,7,7,7,7,0,0,0,0,0,2,2,7,7}, {0,2,2,2,2,2,2,0,2,1,1,1,1,1,2,0,2,2,2,4}, {0,0,2,0,7,0,2,0,7,0,2,0,7,0,2,0,2,11,12,13}, {2,0,0,6,2,0,0,6,2,0,0,0,2,0,0,0,2,14,15,16} }, { {0,0,1,7,7,7,1,1,7,1,7,7,7,0,0,5,0,0,0,2}, {0,0,1,7,7,7,1,1,7,1,7,7,7,0,0,0,0,0,5,2}, {0,0,0,0,1,0,0,0,7,7,7,7,1,6,2,0,5,0,0,2}, {0,0,0,0,1,0,0,0,1,7,7,7,1,6,2,6,0,0,5,2}, {1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,5,0,0,2}, {0,0,0,0,0,1,0,0,0,1,0,0,0,1,0,0,0,5,0,5}, {6,1,0,1,0,0,0,1,0,0,0,1,0,0,0,5,0,0,0,0}, {1,1,0,1,1,1,1,1,1,1,1,1,1,1,1,1,5,5,0,5}, {0,2,0,2,0,0,0,2,0,0,0,0,1,1,6,1,1,1,1,1}, {0,2,0,2,0,2,0,2,1,0,2,0,0,1,0,0,0,3,6,2}, {2,2,0,2,0,2,7,2,0,0,8,1,0,0,0,3,3,3,6,2}, {2,0,0,2,0,2,7,2,0,1,1,1,1,3,0,0,0,3,7,2}, {2,0,2,2,0,2,7,2,0,0,0,0,0,1,0,3,3,3,7,4}, {2,0,0,0,0,2,0,2,1,1,1,1,0,1,0,0,0,11,12,13}, {2,2,2,2,2,2,0,0,6,0,0,0,0,1,0,3,3,14,15,16} }, { {2,6,6,2,0,0,0,0,0,2,2,0,0,0,0,2,0,0,2,2}, {0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}, {0,0,0,0,0,2,2,0,0,0,0,0,2,2,0,0,0,0,0,0}, {0,0,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,0,0}, {7,7,2,1,6,0,0,0,1,0,0,0,1,6,0,0,0,2,0,0}, {7,7,2,1,0,0,1,0,0,0,1,0,0,1,0,1,0,2,0,0}, {7,7,2,1,1,0,0,1,1,1,0,0,1,0,0,2,0,2,0,0}, {0,0,2,1,0,1,0,1,0,0,0,1,0,0,0,2,0,2,0,0}, {0,0,0,1,0,0,0,1,0,8,1,1,0,1,0,2,0,2,0,0}, {0,0,0,0,0,1,1,1,0,0,0,0,0,2,0,2,0,2,0,0}, {2,2,2,1,1,1,0,1,1,1,1,1,1,1,1,1,0,2,0,0}, {4,4,2,0,2,0,0,7,0,0,7,0,0,0,0,0,0,2,0,0}, {4,4,6,0,0,0,0,7,0,0,7,0,0,0,0,0,0,2,0,0}, {4,4,0,0,0,0,0,7,0,6,7,0,0,2,2,2,2,11,12,13}, {2,2,2,2,2,2,2,2,2,2,2,2,2,2,5,5,5,14,15,16} }, { {0,1,0,0,0,0,0,0,0,0,0,0,1,1,1,1,1,1,1,1}, {0,0,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,2}, {1,0,0,1,0,0,0,0,0,0,0,0,1,0,1,1,1,1,7,1}, {0,1,0,0,1,1,1,1,1,1,1,1,1,0,1,0,0,1,0,1}, {0,0,1,0,0,0,2,3,3,0,3,3,1,0,1,0,0,1,0,1}, {0,2,0,1,0,1,1,3,0,0,0,3,1,0,1,0,0,1,0,1}, {1,0,1,1,0,1,0,3,0,3,0,3,1,0,1,0,0,1,0,1}, {0,0,0,1,0,0,1,3,0,3,0,0,1,0,1,0,0,1,0,1}, {0,1,0,0,1,0,1,3,0,3,3,0,0,0,1,0,0,1,0,1}, {0,1,0,1,0,0,1,3,6,0,3,3,0,0,1,0,0,1,0,1}, {0,1,0,0,0,1,3,3,3,0,3,2,1,1,1,0,0,1,0,1}, {0,0,1,1,1,3,0,0,0,0,1,0,0,0,0,0,0,0,0,1}, {1,0,0,1,0,0,0,3,3,3,1,0,1,1,1,1,1,1,2,1}, {0,1,0,0,0,0,3,1,0,0,1,0,0,0,0,6,4,11,12,13}, {0,0,1,1,1,1,1,0,0,0,1,1,1,1,1,1,1,14,15,16} }, { {0,0,2,5,5,5,6,3,1,6,0,0,0,3,0,0,0,0,6,6}, {0,0,2,0,0,5,6,3,1,0,3,3,3,3,0,0,0,0,0,0}, {0,0,2,0,0,5,0,3,1,0,1,1,0,0,0,0,0,2,0,2}, {2,0,2,0,2,2,0,3,1,0,1,0,0,1,2,0,0,0,0,0}, {2,0,2,0,2,2,0,3,1,0,1,0,0,1,2,0,2,0,2,0}, {0,0,2,0,0,2,0,3,1,0,1,0,1,1,0,0,0,0,0,0}, {0,0,2,0,0,2,0,3,1,0,1,0,0,1,0,2,0,2,0,0}, {0,2,2,2,0,2,0,3,1,0,1,1,0,1,1,1,0,0,0,0}, {0,2,2,2,0,2,0,3,1,0,1,0,0,1,2,0,2,0,2,0}, {0,0,2,0,0,2,0,3,1,0,1,0,1,2,0,0,0,0,0,0}, {0,0,2,0,0,2,0,3,1,0,0,0,1,0,0,2,0,2,0,2}, {2,0,0,0,0,2,0,3,1,1,0,1,3,0,0,0,0,0,0,0}, {2,0,0,0,2,2,0,3,1,0,0,1,3,0,2,0,2,0,0,6}, {6,0,0,0,0,2,0,0,0,0,1,4,3,0,0,0,0,11,12,13}, {2,2,2,2,2,2,1,1,1,1,4,4,3,0,0,2,6,14,15,16} }, { {0,0,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2}, {0,0,0,0,2,6,6,2,6,6,2,6,6,2,0,0,2,0,0,0}, {1,1,0,0,7,0,0,2,0,0,2,0,0,2,0,0,7,0,0,0}, {0,2,0,0,7,0,0,2,0,0,2,0,0,2,0,0,7,0,0,2}, {0,2,0,0,7,0,0,2,0,0,2,0,0,2,0,0,2,0,0,2}, {0,2,0,0,2,0,0,7,0,0,2,0,0,7,0,0,2,0,0,0}, {0,2,0,0,2,0,0,7,0,0,2,0,0,7,0,0,2,0,0,0}, {0,2,0,0,2,0,0,7,0,0,2,0,0,7,0,0,7,0,0,0}, {0,2,0,0,2,0,0,2,0,0,2,0,0,2,0,0,7,0,0,0}, {0,2,0,0,2,0,0,2,0,0,2,0,0,2,0,0,2,0,0,0}, {0,2,0,0,2,0,0,2,0,0,7,0,0,2,0,0,2,0,0,0}, {0,2,0,0,2,0,0,2,0,0,7,0,0,2,0,0,2,0,2,0}, {0,2,0,0,2,0,0,2,0,0,7,0,0,2,0,0,2,0,2,4}, {0,2,0,0,2,0,0,2,0,0,2,0,0,2,0,0,2,11,12,13}, {0,2,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,14,15,16} }, { {5,8,6,6,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,4}, {5,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5}, {6,1,0,0,1,1,1,1,5,5,1,1,5,5,1,1,5,1,1,5}, {6,0,0,0,0,0,0,0,0,5,5,5,5,5,5,5,0,0,6,6}, {0,2,1,0,1,1,0,0,0,0,0,0,0,0,0,0,1,0,0,0}, {0,1,5,5,5,1,1,1,0,0,0,1,0,1,0,1,0,0,0,0}, {0,1,5,5,0,0,0,1,1,1,0,0,0,0,0,0,0,1,0,0}, {0,1,6,6,0,0,0,0,6,1,1,1,0,1,1,0,0,0,0,1}, {7,1,0,0,0,1,0,0,0,0,0,5,5,5,1,1,1,1,0,0}, {0,1,0,1,0,0,0,0,0,0,0,1,6,0,0,0,0,0,0,0}, {0,1,0,0,0,0,1,1,1,0,0,1,0,0,0,0,1,1,1,1}, {0,1,1,0,0,1,1,0,1,1,0,0,1,0,0,1,1,0,0,0}, {0,0,0,0,1,1,0,0,0,1,1,0,0,0,1,1,0,0,0,0}, {0,0,0,1,1,0,0,0,0,0,1,1,0,1,1,0,0,11,12,13}, {0,0,1,1,0,0,0,0,0,0,5,1,1,1,0,0,0,14,15,16} }, { {8,7,7,7,7,0,0,7,7,7,7,7,7,7,7,7,7,7,7,7}, {6,0,7,7,7,0,0,7,7,7,0,0,6,7,7,7,0,0,0,7}, {0,0,7,7,7,7,7,7,7,7,0,0,0,7,7,7,0,0,0,7}, {0,0,7,2,2,2,2,2,2,2,2,2,2,2,2,2,2,0,0,7}, {7,7,2,2,7,7,7,7,7,7,7,7,7,7,7,7,2,7,7,7}, {7,7,7,2,7,7,7,7,0,0,7,7,7,7,7,7,2,7,7,7}, {7,7,7,2,7,7,7,7,0,0,7,7,7,7,7,7,2,7,7,7}, {7,7,7,2,7,0,6,7,7,2,7,7,7,7,7,7,2,0,0,7}, {0,6,7,2,7,0,0,7,2,7,7,4,7,7,7,7,2,0,6,7}, {0,0,7,2,7,0,0,7,2,7,7,7,7,7,7,7,2,7,7,7}, {7,7,7,2,7,7,7,7,2,7,7,7,7,7,7,7,2,7,7,7}, {7,7,7,2,7,7,7,7,7,2,2,2,2,2,2,2,2,7,0,0}, {0,0,7,7,2,7,0,0,0,0,7,7,7,6,0,7,7,7,6,0}, {0,0,7,7,2,2,7,2,0,0,7,7,7,0,0,7,7,11,12,13}, {0,0,7,7,7,7,7,7,7,7,7,7,7,7,7,7,7,14,15,16} }, }; bumprace-1.5.4/src/font.h0000644000175000017500000000667311217461066012166 00000000000000/* SFont: a simple font-library that uses special .pngs as fonts Copyright (C) 2003 Karl Bartel License: GPL or LGPL (at your choice) WWW: http://www.linux-games.com/sfont/ This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Karl Bartel Cecilienstr. 14 12307 Berlin GERMANY karlb@gmx.net */ /************************************************************************ * SFONT - SDL Font Library by Karl Bartel * * * * All functions are explained below. There are two versions of each * * funtction. The first is the normal one, the function with the * * 2 at the end can be used when you want to handle more than one font * * in your program. * * * ************************************************************************/ #ifndef SFONT_H #define SFONT_H #include #ifdef __cplusplus extern "C" { #endif // Delcare one variable of this type for each font you are using. // To load the fonts, load the font image into YourFont->Surface // and call InitFont( YourFont ); typedef struct { SDL_Surface *Surface; int CharPos[512]; int h; } SFont_FontInfo; // Initializes the font // Font: this contains the suface with the font. // The font must be loaded before using this function. void InitFont (SDL_Surface *Font); void InitFont2(SFont_FontInfo *Font); // Blits a string to a surface // Destination: the suface you want to blit to // text: a string containing the text you want to blit. void PutString (SDL_Surface *Surface, int x, int y, char *text); void PutString2(SDL_Surface *Surface, SFont_FontInfo *Font, int x, int y, char *text); // Returns the width of "text" in pixels int SFont_TextWidth(char *text); int SFont_TextWidth2(SFont_FontInfo *Font, char *text); // Blits a string to with centered x position void XCenteredString (SDL_Surface *Surface, int y, char *text); void XCenteredString2(SDL_Surface *Surface, SFont_FontInfo *Font, int y, char *text); // Allows the user to enter text // Width: What is the maximum width of the text (in pixels) // text: This string contains the text which was entered by the user void SFont_Input ( SDL_Surface *Destination, int x, int y, int Width, char *text); void SFont_Input2( SDL_Surface *Destination, SFont_FontInfo *Font, int x, int y, int Width, char *text); #ifdef __cplusplus } #endif #endif /* SFONT_H */ bumprace-1.5.4/src/font.c0000644000175000017500000001765411217461066012162 00000000000000/* SFont: a simple font-library that uses special .pngs as fonts Copyright (C) 2003 Karl Bartel License: GPL or LGPL (at your choice) WWW: http://www.linux-games.com/sfont/ This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Karl Bartel Cecilienstr. 14 12307 Berlin GERMANY karlb@gmx.net */ #include "SDL.h" #include "font.h" #include #include // needed for exit() SFont_FontInfo InternalFont; static Uint32 GetPixel(SDL_Surface *Surface, Sint32 X, Sint32 Y) { Uint8 *bits; Uint32 Bpp; if (X<0) puts("SFONT ERROR: x too small in GetPixel. Report this to "); if (X>=Surface->w) puts("SFONT ERROR: x too big in GetPixel. Report this to "); Bpp = Surface->format->BytesPerPixel; bits = ((Uint8 *)Surface->pixels)+Y*Surface->pitch+X*Bpp; // Get the pixel switch(Bpp) { case 1: return *((Uint8 *)Surface->pixels + Y * Surface->pitch + X); break; case 2: return *((Uint16 *)Surface->pixels + Y * Surface->pitch/2 + X); break; case 3: { // Format/endian independent Uint8 r, g, b; r = *((bits)+Surface->format->Rshift/8); g = *((bits)+Surface->format->Gshift/8); b = *((bits)+Surface->format->Bshift/8); return SDL_MapRGB(Surface->format, r, g, b); } break; case 4: return *((Uint32 *)Surface->pixels + Y * Surface->pitch/4 + X); break; } return -1; } void InitFont2(SFont_FontInfo *Font) { int x = 0, i = 0; if ( Font->Surface==NULL ) { printf("The font has not been loaded!\n"); exit(1); } if (SDL_MUSTLOCK(Font->Surface)) SDL_LockSurface(Font->Surface); while ( x < Font->Surface->w ) { if(GetPixel(Font->Surface,x,0)==SDL_MapRGB(Font->Surface->format,255,0,255)) { Font->CharPos[i++]=x; while (( x < Font->Surface->w-1) && (GetPixel(Font->Surface,x,0)==SDL_MapRGB(Font->Surface->format,255,0,255))) x++; Font->CharPos[i++]=x; } x++; } if (SDL_MUSTLOCK(Font->Surface)) SDL_UnlockSurface(Font->Surface); Font->h=Font->Surface->h; SDL_SetColorKey(Font->Surface, SDL_SRCCOLORKEY, GetPixel(Font->Surface, 0, Font->Surface->h-1)); } void InitFont(SDL_Surface *Font) { InternalFont.Surface=Font; InitFont2(&InternalFont); } void PutString2(SDL_Surface *Surface, SFont_FontInfo *Font, int x, int y, char *text) { int ofs; int i=0; SDL_Rect srcrect,dstrect; while (text[i]!='\0') { if (text[i]==' ') { x+=Font->CharPos[2]-Font->CharPos[1]; i++; } else { // printf("-%c- %c - %u\n",228,text[i],text[i]); ofs=((unsigned char)text[i]-33)*2+1; // ofs=(text[i]-33)*2+1; // printf("printing %c %d\n",text[i],ofs); srcrect.w = dstrect.w = (Font->CharPos[ofs+2]+Font->CharPos[ofs+1])/2-(Font->CharPos[ofs]+Font->CharPos[ofs-1])/2; srcrect.h = dstrect.h = Font->Surface->h-1; srcrect.x = (Font->CharPos[ofs]+Font->CharPos[ofs-1])/2; srcrect.y = 1; dstrect.x = x-(float)(Font->CharPos[ofs]-Font->CharPos[ofs-1])/2; dstrect.y = y; SDL_BlitSurface( Font->Surface, &srcrect, Surface, &dstrect); x+=Font->CharPos[ofs+1]-Font->CharPos[ofs]; i++; } } } void PutString(SDL_Surface *Surface, int x, int y, char *text) { PutString2(Surface, &InternalFont, x, y, text); } int SFont_TextWidth2(SFont_FontInfo *Font, char *text) { int ofs=0; int i=0,x=0; while (text[i]!='\0') { if (text[i]==' ') { x+=Font->CharPos[2]-Font->CharPos[1]; i++; } else { // ofs=(text[i]-33)*2+1; ofs=((unsigned char)text[i]-33)*2+1; x+=Font->CharPos[ofs+1]-Font->CharPos[ofs]; i++; } } // printf ("--%d\n",x); return x; } int SFont_TextWidth(char *text) { return SFont_TextWidth2(&InternalFont, text); } void XCenteredString2(SDL_Surface *Surface, SFont_FontInfo *Font, int y, char *text) { PutString2(Surface, Font, Surface->w/2-SFont_TextWidth2(Font,text)/2, y, text); } void XCenteredString(SDL_Surface *Surface, int y, char *text) { XCenteredString2(Surface, &InternalFont, y, text); } void SFont_InternalInput( SDL_Surface *Dest, SFont_FontInfo *Font, int x, int y, int PixelWidth, char *text) { SDL_Event event; int ch=-1,blink=0; long blinktimer=0; SDL_Surface *Back; SDL_Rect rect; SDLKey sym; int previous; // int ofs=(text[0]-33)*2+1; // int leftshift=(Font->CharPos[ofs]-Font->CharPos[ofs-1])/2; Back = SDL_AllocSurface(Dest->flags, Dest->w, Font->h, Dest->format->BitsPerPixel, Dest->format->Rmask, Dest->format->Gmask, Dest->format->Bmask, 0); rect.x=0; rect.y=y; rect.w=Dest->w; rect.h=Font->Surface->h; SDL_BlitSurface(Dest, &rect, Back, NULL); PutString2(Dest,Font,x,y,text); SDL_UpdateRects(Dest, 1, &rect); // start input previous=SDL_EnableUNICODE(1); blinktimer=SDL_GetTicks(); while (ch!=SDLK_RETURN) { printf("%d\n", ch); printf("%s\n", text); if (event.type == SDL_KEYDOWN) { ch = event.key.keysym.unicode; sym = event.key.keysym.sym; if (((ch>31)||(sym==SDLK_BACKSPACE)) && (ch<128)) { if ((sym==SDLK_BACKSPACE)&&(strlen(text)>0)) text[strlen(text)-1]='\0'; else if (sym!=SDLK_BACKSPACE) sprintf(text,"%s%c",text,ch); if (SFont_TextWidth2(Font,text)>PixelWidth) text[strlen(text)-1]='\0'; SDL_BlitSurface( Back, NULL, Dest, &rect); PutString2(Dest, Font, x, y, text); SDL_UpdateRects(Dest, 1, &rect); // printf("%s ## %d\n",text,strlen(text)); SDL_WaitEvent(&event); } } if (SDL_GetTicks()>blinktimer) { blink=1-blink; blinktimer=SDL_GetTicks()+500; if (blink) { PutString2(Dest, Font, x+SFont_TextWidth2(Font,text), y, "|"); SDL_UpdateRects(Dest, 1, &rect); // SDL_UpdateRect(Dest, x+SFont_TextWidth2(Font,text), y, SFont_TextWidth2(Font,"|"), Font->Surface->h); } else { SDL_BlitSurface( Back, NULL, Dest, &rect); PutString2(Dest, Font, x, y, text); SDL_UpdateRects(Dest, 1, &rect); // SDL_UpdateRect(Dest, x-(Font->CharPos[ofs]-Font->CharPos[ofs-1])/2, y, PixelWidth, Font->Surface->h); } } SDL_Delay(1); SDL_PollEvent(&event); } text[strlen(text)]='\0'; SDL_FreeSurface(Back); SDL_EnableUNICODE(previous); //restore the previous state } void SFont_Input2( SDL_Surface *Dest, SFont_FontInfo *Font, int x, int y, int PixelWidth, char *text) { SFont_InternalInput( Dest, Font, x, y, PixelWidth, text); } void SFont_Input( SDL_Surface *Dest, int x, int y, int PixelWidth, char *text) { SFont_Input2( Dest, &InternalFont, x, y, PixelWidth, text); } bumprace-1.5.4/src/gfx.h0000644000175000017500000000264411217461066011776 00000000000000#include #define backbuffer BackBuffer extern SDL_Surface *Screen,*BackBuffer,*fadebuffer; extern SDL_Rect blitrect; extern char DATAPATH[200]; // inits a lot of SDL stuff void init_SDL(); // fades screen to BackBuffer void FadeScreen(float speed); // prints error and quits void ComplainAndExit(void); // Updates all blitted rects; void Update(); // Puts a pixel (lock and unlock needed!) extern int PutPixel(SDL_Surface *Surface, Sint32 X, Sint32 Y, Uint32 Color); // Add rect to update queue void AddRect(int x1, int y1, int x2, int y2); void AddThisRect(SDL_Rect blitrect); // random number between a and b (inclusive) int abrand(int a,int b); // Draws a circle int Circle (SDL_Surface *Surface, Sint32 X, Sint32 Y, Sint32 Rad, float Aspect, Uint32 Color); // Draws the background (as a circle) int UndoCircle (SDL_Surface *Surface, Sint32 X, Sint32 Y, Sint32 Rad, float Aspect); // returns the flipped surface SDL_Surface *FlippedSurface(SDL_Surface *Surface); // returns the color value of a pixel Uint32 GetPixel (SDL_Surface *Surface, Sint32 X, Sint32 Y); void lock(); void unlock(); void fadeout(); SDL_Surface *LoadImage(char *datafile, int transparent); void Blit(int Xpos,int Ypos,SDL_Surface *image); void BlitToBB(int Xpos,int Ypos,SDL_Surface *image); //blits to BackBuffer void BlitPart(int Xpos,int Ypos,SDL_Surface *image, SDL_Rect srcrect); void PutBackPixel(SDL_Surface *Surface, Sint32 x, Sint32 y); bumprace-1.5.4/src/bumprace.h0000644000175000017500000000306111217461066013002 00000000000000#ifndef _BUMPRACE_H_ #define _BUMPRACE_H_ #include #include "gfx.h" #include "font.h" void BlitMenu(); #define SDL_SetAlpha(A,B,C) SDL_SetAlpha(A,0,0);SDL_SetAlpha(A,B,C) typedef struct{ float slowdown,turbo_possible,sticky_possible,extra_time; float realx,realy,xspeed,yspeed,turn,teleported; int crashed,completed,racernum,points; SDL_Rect oldrect; SDLKey up,down,left,right,extra; SDL_Surface *racer[18]; }player; typedef struct { int shot_delay; // delay between two shots float time_to_shot; // time to the next shot float turn; // current degree of rotation int x,y; // coordinates int last_pic; // last blitted picture int type; // shooting method } cannon_type; extern cannon_type cannon; typedef struct { float x,y; // coordinates float xspeed,yspeed; // speed and direction float anim; // # of shown picture SDL_Rect oldrect; // the background has to be restored here } shot_type; #define MAX_PLAYER_NUM 2 extern player user[MAX_PLAYER_NUM]; extern SDL_Surface *screen, *back, *backbuffer, *fore[16], *racer_pic[6], *selector_pic, *selectp_pic[2], *mode_select_pic[4], *title_pic; extern float game_speed, gravity; extern int particle,which_racer,pl,i,mode,playernum,Score,fullscreen,precision,dofadeout; extern Uint8 *keys; extern SDL_Event event; extern struct BitFont font; extern Sint32 now; extern char text[200]; //extern char *DATAPATH[200]; extern void BlitMenu(); //blits menu for SelectRacer #endif bumprace-1.5.4/src/menu.h0000644000175000017500000000024711217461066012153 00000000000000void Menu(); // Main Menu void help(); // Help and Credits void SelectRacer(); void clear_screen(); void load_racer(); void clear_screen(); void PrepareMenu(); bumprace-1.5.4/src/menu.c0000644000175000017500000002002211217461066012137 00000000000000#include "bumprace.h" #include void clear_screen() { SDL_Rect fillrect; fillrect.x=0; fillrect.y=0; fillrect.w=800; fillrect.h=600; SDL_FillRect(Screen,&fillrect,0); } void clear_bb() { SDL_Rect fillrect; fillrect.x=0; fillrect.y=0; fillrect.w=800; fillrect.h=600; SDL_FillRect(backbuffer,&fillrect,0); } //************************ HELP MENU *********************** void help() //prints the help & credits screeen { int i; clear_screen(); for (i=0;i<=5;i++) { Blit(25,160+i*70,fore[i]); } Blit(300,-30,racer_pic[4]); PutString(Screen, 80, 175, "Normal wall"); PutString(Screen, 80, 245, "Deadly wall"); PutString(Screen, 80, 315, "Stopper"); PutString(Screen, 80, 385, "Your goal is to arrive here"); PutString(Screen, 80, 455, "Teleporter"); PutString(Screen, 80, 525, "Time bonus"); PutString(Screen, 350, 165, "Code:"); PutString(Screen, 350, 180, "Karl Bartel (main code) "); PutString(Screen, 350, 195, "Lion Kimbro (particles) "); PutString(Screen, 350, 220, "Graphics:"); PutString(Screen, 350, 235, "Karl Bartel"); PutString(Screen, 500, 220, "Background:"); PutString(Screen, 500, 235, "tozzie (www.tozzie-designs.com)"); PutString(Screen, 350, 265, "Packaging:"); PutString(Screen, 350, 280, "Christian T. Steigies (debian)"), PutString(Screen, 350, 305, "Music:"); PutString(Screen, 350, 320, "The Lizard King (www.itv.se/~a1055/frames.html)"); PutString(Screen, 350, 365, "Sound Effects:"); PutString(Screen, 350, 380, "grabbed from ClanBomber"); PutString(Screen, 350, 405, "Levels:"); PutString(Screen, 350, 420, "Karl Bartel"); PutString(Screen, 350, 435, "Stephan "); PutString(Screen, 350, 465, "Libraries used:"); PutString(Screen, 350, 480, "SDL by Sam Lantinga"); PutString(Screen, 350, 495, "SFont by Karl Bartel"); PutString(Screen, 350, 510, "modified MikMod (for SDL)"); PutString(Screen, 40, 580, "You can find the BumpRace web page at: http://www.linux-games.com"); SDL_UpdateRect(Screen,0,0,0,0); SDL_WaitEvent(&event); SDL_WaitEvent(&event); clear_screen(); BlitMenu(); Blit(100,0,selectp_pic[pl]); SDL_UpdateRect(Screen,0,0,0,0); } // ******************************** Main Menu ***************** void PrepareMenu() { SDL_EventState(SDL_KEYUP, SDL_ENABLE); SDL_EventState(SDL_KEYDOWN, SDL_ENABLE); clear_bb(); BlitToBB(0,0,title_pic); FadeScreen(7); } SDL_Rect DrawMode(int num, int y, SDL_Rect *rect) //for Menu only { if (y<600) { if (num<3) Blit(50+num*250,y,mode_select_pic[num]); else Blit(300+(num-3)*250,y,mode_select_pic[num]); }else { blitrect.x=1; blitrect.y=1; blitrect.w=1; blitrect.h=1; } return blitrect; } void FadeSelectorOut(int y, int mode) { SDL_Rect dstrect; now=SDL_GetTicks(); for (i=0;i<=255;i+=SDL_GetTicks()-now) { now=SDL_GetTicks(); dstrect.x=40+mode*250;dstrect.y=y-10;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y+100;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); dstrect.x=250+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); SDL_SetAlpha(selector_pic,(SDL_SRCALPHA),255-i); Blit (40+250*mode,y-10,selector_pic); Update(); } dstrect.x=40+mode*250;dstrect.y=y-10;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y+100;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); dstrect.x=250+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); SDL_UpdateRect(Screen,40+mode*250,y-10,220,120); } void FadeSelectorIn(int y, int mode) { SDL_Rect dstrect; now=SDL_GetTicks(); if (mode==3) {y+=120;mode=1;} for (i=255;i>=0;i-=SDL_GetTicks()-now) { now=SDL_GetTicks(); dstrect.x=40+mode*250;dstrect.y=y-10;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y+100;dstrect.w=220;dstrect.h=10; SDL_FillRect(Screen,&dstrect,0); dstrect.x=40+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); dstrect.x=250+mode*250;dstrect.y=y;dstrect.w=10;dstrect.h=100; SDL_FillRect(Screen,&dstrect,0); SDL_SetAlpha(selector_pic,(SDL_SRCALPHA),255-i); Blit (40+250*mode,y-10,selector_pic); Update(); } } void Menu() { int y=599,update; float startTime; SDL_Rect oldrect[4]; // blit(0,0,title_pic); for (i=0;i<4;i++) { oldrect[i].x=0;oldrect[i].y=0;oldrect[i].w=1;oldrect[i].h=1; } startTime = now = SDL_GetTicks(); while (startTime + 1000 > now) { for (i=0;i<4;i++) { SDL_FillRect(Screen,&oldrect[i],0); AddThisRect(oldrect[i]); } oldrect[0]=DrawMode(0, y, oldrect); oldrect[1]=DrawMode(1, y, oldrect); oldrect[2]=DrawMode(2, y, oldrect); oldrect[3]=DrawMode(3, y+120, oldrect); now = SDL_GetTicks(); y = 599 - (int)( sin((now - startTime) * M_PI / 2000) * 310); Update(); } mode=0;update=1; SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); while ( keys[SDLK_RETURN]!=SDL_PRESSED) { if (update) FadeSelectorIn(y,mode); SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); update=0; if (( keys[SDLK_RIGHT] == SDL_PRESSED )&&(mode<2)) {FadeSelectorOut(y,mode);mode++;update=1;} if (( keys[SDLK_LEFT] == SDL_PRESSED )&&(mode>0)&&(mode<3)) {FadeSelectorOut(y,mode);mode--;update=1;} if (( keys[SDLK_DOWN] == SDL_PRESSED )&&(mode<3)) {FadeSelectorOut(y,mode);mode=3;update=1;} if (( keys[SDLK_UP] == SDL_PRESSED )&&(mode==3)) {FadeSelectorOut(y+120,1);mode=1;update=1;} SDL_WaitEvent(&event); } if (mode==0) playernum=1; else playernum=2; } // ************************** Racer Selection void load_racer() //loads the racer data { if (user[pl].racernum==0) { for (i=0;i<=17;i++) { sprintf(text,"racerc%d.gif",i+1); user[pl].racer[i]=LoadImage(text,1); } }else if (user[pl].racernum==1) { for (i=0;i<=17;i++) { sprintf(text,"racerd%d.gif",i+1); user[pl].racer[i]=LoadImage(text,1); } }else if (user[pl].racernum==2) { for (i=0;i<=17;i++) { sprintf(text,"racere%d.gif",i+1); user[pl].racer[i]=LoadImage(text,1); } }else { for (i=0;i<=17;i++) { sprintf(text,"racerf%d.gif",i+1); user[pl].racer[i]=LoadImage(text,1); } } user[pl].slowdown=0; user[pl].turbo_possible=0; user[pl].sticky_possible=0; user[pl].extra_time=0; if (user[pl].racernum==0) {user[pl].slowdown=0.00012;} if (user[pl].racernum==1) {user[pl].extra_time=15;} if (user[pl].racernum==2) {user[pl].turbo_possible=1; user[pl].slowdown=0.00004;} if (user[pl].racernum==3) {user[pl].sticky_possible=1; user[pl].slowdown=0.00003;} } void SelectRacer() //menu for racer selection { SDL_Rect fillrect; fillrect.x=50; fillrect.y=140; fillrect.w=700; fillrect.h=430; SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); while (keys[SDLK_RETURN]==SDL_PRESSED) { SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); } while (keys[SDLK_RETURN]!=SDL_PRESSED) { SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); while (!SDL_WaitEvent(&event)) { SDL_PollEvent(&event); keys = SDL_GetKeyState(NULL); } if (( keys[SDLK_RIGHT] == SDL_PRESSED )&&(user[pl].racernum<5)) {user[pl].racernum++;} if (( keys[SDLK_LEFT] == SDL_PRESSED )&&(user[pl].racernum>0)) {user[pl].racernum--;} if (( keys[SDLK_DOWN] == SDL_PRESSED )&&(user[pl].racernum<3)) {user[pl].racernum+=3;} if (( keys[SDLK_UP] == SDL_PRESSED )&&(user[pl].racernum>2)) {user[pl].racernum-=3;} if (user[pl].racernum>5) user[pl].racernum=5; BlitMenu(); SDL_UpdateRects(Screen,1,&fillrect); } } bumprace-1.5.4/src/options.c0000644000175000017500000000673611217461066012706 00000000000000#include "bumprace.h" #include #include #include char Player[10][200]; int Hiscore[10],i; FILE *OpenOptionsFile( char *mode ) { char filename[200]; FILE *file; if ((char *)getenv("HOME") != NULL) snprintf( filename, sizeof(filename), "%s/.bumprace", getenv("HOME")); else sprintf( filename, "bumprace.dat"); file = fopen(filename, mode); if (file==NULL) { fprintf(stderr, "\nWarning: I could not open the options file "); if (strcmp(mode, "r") == 0) fprintf(stderr, "for read:"); else if (strcmp(mode, "w") == 0) fprintf(stderr, "for write:"); fprintf(stderr, "\n%s\n" "The error that occured was:\n" "%s\n\n", filename, strerror(errno)); } return file; } void ReadOptions() { FILE *file; file=OpenOptionsFile("r"); if (file==NULL) { file=OpenOptionsFile("w"); if (file==NULL) exit(1); fprintf(file, "# BumpRace Options File\n\n"); fprintf(file, "Sam\nLion\nBill\nJohn\nAndreas\nAaron\nMichael\nPhoenix\nPierre\nRobert\n"); for (i=0;i<10;i++) fprintf(file, "%d\n", 4000-i*400); fclose(file); file=OpenOptionsFile("r"); } fscanf(file, "%*s%*s%*s%*s\n"); for (i=0;i<10;i++) fscanf(file, "%199[^\n]\n",Player[i]); for (i=0;i<10;i++) fscanf(file, "%d\n",&Hiscore[i]); // for (i=0;i<10;i++) // printf("%s %d\n",Player[i],Hiscore[i]); fclose(file); } void FinalScore() { char Name[200]="",text[200]; int a; FILE *file; if (Score>Hiscore[9]) { Blit(0,0,back); XCenteredString(Screen, 200, "< YOUR FINAL SCORE >"); sprintf(text,"%d", Score); XCenteredString(Screen, 250, text); XCenteredString(Screen, 300, "Enter Your Name:"); Update(); SDL_EventState(SDL_KEYUP, SDL_ENABLE); SDL_EventState(SDL_KEYDOWN, SDL_ENABLE); SFont_Input(Screen, 350, 350, 200, Name); if (strcmp(Name,"")==0) strcpy(Name,"Anonymous Coward"); for (i=0;i<10;i++) { if (Score>Hiscore[i]) { // Move other players down on the list for (a=9;a>=i;a--) { strcpy(Player[a],Player[a-1]); Hiscore[a]=Hiscore[a-1]; } // add the player strcpy(Player[i],Name); Hiscore[i]=Score; break; } } // for (i=0;i<10;i++) // printf("%s %d\n",Player[i],Hiscore[i]); // write everything into the options file file=OpenOptionsFile("w"); if (file==NULL) exit(1); fprintf(file, "# BumpRace Options File\n\n"); for (i=0;i<10;i++) fprintf(file, "%s\n", Player[i]); for (i=0;i<10;i++) fprintf(file, "%d\n", Hiscore[i]); fclose(file); } else { if (Score<0) Score=0; Blit(0,0,back); XCenteredString(Screen, 200, "< YOUR FINAL SCORE >"); sprintf(text,"%d", Score); XCenteredString(Screen, 250, text); XCenteredString(Screen, 300, "You didn't qualify for the highscore list..."); Update(); SDL_EventState(SDL_KEYUP, SDL_ENABLE); SDL_EventState(SDL_KEYDOWN, SDL_ENABLE); SDL_WaitEvent(&event); SDL_WaitEvent(&event); }} void ShowHiscore() { SDL_Event WaitEvent; char text[200]; int i; Blit(0,0,back); XCenteredString(Screen, 100, "< BUMPRACE HIGHSCORES >"); for (i=0;i<10;i++) { sprintf(text,"%s", Player[i]); PutString(Screen,200,150+i*30,text); sprintf(text,"%d", Hiscore[i]); PutString(Screen,600-SFont_TextWidth(text),150+i*30,text); } Update(); while ((WaitEvent.type!=SDL_KEYDOWN)&&(WaitEvent.type!=SDL_MOUSEBUTTONDOWN)) { SDL_PollEvent(&WaitEvent); SDL_WaitEvent(&WaitEvent); } } bumprace-1.5.4/src/Makefile.in0000644000175000017500000003230311754254551013106 00000000000000# Makefile.in generated by automake 1.10.1 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ target_triplet = @target@ bin_PROGRAMS = bumprace$(EXEEXT) subdir = src DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/acinclude.m4 \ $(top_srcdir)/configure.in am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_CLEAN_FILES = am__installdirs = "$(DESTDIR)$(bindir)" binPROGRAMS_INSTALL = $(INSTALL_PROGRAM) PROGRAMS = $(bin_PROGRAMS) am_bumprace_OBJECTS = bumprace.$(OBJEXT) gfx.$(OBJEXT) \ particles.$(OBJEXT) menu.$(OBJEXT) options.$(OBJEXT) \ font.$(OBJEXT) bumprace_OBJECTS = $(am_bumprace_OBJECTS) bumprace_LDADD = $(LDADD) DEFAULT_INCLUDES = -I.@am__isrc@ depcomp = $(SHELL) $(top_srcdir)/depcomp am__depfiles_maybe = depfiles COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \ $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(AM_LDFLAGS) $(LDFLAGS) -o $@ SOURCES = $(bumprace_SOURCES) DIST_SOURCES = $(bumprace_SOURCES) ETAGS = etags CTAGS = ctags DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPPFLAGS = @CPPFLAGS@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EXEEXT = @EXEEXT@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MATHLIB = @MATHLIB@ MKDIR_P = @MKDIR_P@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ RANLIB = @RANLIB@ SDL_CFLAGS = @SDL_CFLAGS@ SDL_CONFIG = @SDL_CONFIG@ SDL_LIBS = @SDL_LIBS@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ ac_ct_CC = @ac_ct_CC@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target = @target@ target_alias = @target_alias@ target_cpu = @target_cpu@ target_os = @target_os@ target_vendor = @target_vendor@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ bumprace_SOURCES = bumprace.c \ gfx.c particles.c menu.c \ bumprace.h gfx.h \ levels.h levels2.h menu.h particles.h \ options.h options.c font.h font.c all: all-am .SUFFIXES: .SUFFIXES: .c .o .obj $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu src/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --gnu src/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh install-binPROGRAMS: $(bin_PROGRAMS) @$(NORMAL_INSTALL) test -z "$(bindir)" || $(MKDIR_P) "$(DESTDIR)$(bindir)" @list='$(bin_PROGRAMS)'; for p in $$list; do \ p1=`echo $$p|sed 's/$(EXEEXT)$$//'`; \ if test -f $$p \ ; then \ f=`echo "$$p1" | sed 's,^.*/,,;$(transform);s/$$/$(EXEEXT)/'`; \ echo " $(INSTALL_PROGRAM_ENV) $(binPROGRAMS_INSTALL) '$$p' '$(DESTDIR)$(bindir)/$$f'"; \ $(INSTALL_PROGRAM_ENV) $(binPROGRAMS_INSTALL) "$$p" "$(DESTDIR)$(bindir)/$$f" || exit 1; \ else :; fi; \ done uninstall-binPROGRAMS: @$(NORMAL_UNINSTALL) @list='$(bin_PROGRAMS)'; for p in $$list; do \ f=`echo "$$p" | sed 's,^.*/,,;s/$(EXEEXT)$$//;$(transform);s/$$/$(EXEEXT)/'`; \ echo " rm -f '$(DESTDIR)$(bindir)/$$f'"; \ rm -f "$(DESTDIR)$(bindir)/$$f"; \ done clean-binPROGRAMS: -test -z "$(bin_PROGRAMS)" || rm -f $(bin_PROGRAMS) bumprace$(EXEEXT): $(bumprace_OBJECTS) $(bumprace_DEPENDENCIES) @rm -f bumprace$(EXEEXT) $(LINK) $(bumprace_OBJECTS) $(bumprace_LDADD) $(LIBS) mostlyclean-compile: -rm -f *.$(OBJEXT) distclean-compile: -rm -f *.tab.c @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/bumprace.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/font.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gfx.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/menu.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/options.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/particles.Po@am__quote@ .c.o: @am__fastdepCC_TRUE@ $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ $< @am__fastdepCC_TRUE@ mv -f $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c $< .c.obj: @am__fastdepCC_TRUE@ $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ `$(CYGPATH_W) '$<'` @am__fastdepCC_TRUE@ mv -f $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c `$(CYGPATH_W) '$<'` ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonemtpy = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile $(PROGRAMS) installdirs: for dir in "$(DESTDIR)$(bindir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-binPROGRAMS clean-generic mostlyclean-am distclean: distclean-am -rm -rf ./$(DEPDIR) -rm -f Makefile distclean-am: clean-am distclean-compile distclean-generic \ distclean-tags dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-dvi: install-dvi-am install-exec-am: install-binPROGRAMS install-html: install-html-am install-info: install-info-am install-man: install-pdf: install-pdf-am install-ps: install-ps-am installcheck-am: maintainer-clean: maintainer-clean-am -rm -rf ./$(DEPDIR) -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-compile mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-binPROGRAMS .MAKE: install-am install-strip .PHONY: CTAGS GTAGS all all-am check check-am clean clean-binPROGRAMS \ clean-generic ctags distclean distclean-compile \ distclean-generic distclean-tags distdir dvi dvi-am html \ html-am info info-am install install-am install-binPROGRAMS \ install-data install-data-am install-dvi install-dvi-am \ install-exec install-exec-am install-html install-html-am \ install-info install-info-am install-man install-pdf \ install-pdf-am install-ps install-ps-am install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-compile \ mostlyclean-generic pdf pdf-am ps ps-am tags uninstall \ uninstall-am uninstall-binPROGRAMS #SUBDIRS = mixer # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: bumprace-1.5.4/src/particles.h0000644000175000017500000000042311217461066013171 00000000000000/* Thanks to Lion Kimbro for his great prticle code. You can reach him via email at SnowLion@sprynet.com */ extern int NullParticle; void UndrawParticles(); void HandleParticles(); void DisplayParticles(); void NewParticles(float turn, int X, int Y, float spread_percent); bumprace-1.5.4/src/bumprace.c0000644000175000017500000011357111676103525013007 00000000000000/* BumpRace: an easy-to-learn arcade game for up to two players Copyright (C) 2006 Karl Bartel This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Karl Bartel Cecilienstr. 14 12307 Berlin GERMANY karlb@gmx.net */ #include #include #include #include #include #include #include #include #include #ifdef SOUND #include "SDL_mixer.h" #endif #include "levels.h" #include "levels2.h" #include "particles.h" #include "menu.h" #include "bumprace.h" #include "font.h" #include "options.h" #ifndef VERSION #define VERSION "1.5.3" #endif #define MAX_PLAYER_NUM 2 #define FOREGROUND_TILE_NUM 8 #define MAX_SHOTNUM 50 #define BPP 0 #define RR 3 //this is a value of unprecision for the racer collision //the players player user[MAX_PLAYER_NUM]; int pl=0,playernum=2; //general setting int final=1,fullscreen=1,pageflip=0,sound=1,precision=10,fps=0,particle=1,mode,dofadeout=1,levelset=0; const int NUMBER_OF_LEVELS[2]={21,9}; //level settings float gravity=0,turbo=5,laser_switch; int startx,starty; //sounds #ifdef SOUND char modname[20]="lizard.mod"; Mix_Chunk *explode_sound,*winlevel_sound,*teleport_sound; Mix_Music *music; #endif //images SDL_Surface *timeout_pic, *explosion_pic, *title_pic, *back, *fore[16], *pic_completed,*pic_crashed, *racer_pic[6], *cannon_pic[21], *shot_pic[5], *mode_select_pic[4], *selector_pic, *selectp_pic[2], *Font,*laser_pic[9]; //event handling SDL_Event event; Uint8 *keys; //game states int endgame=0,dontshow=0,levelnum=0,quit=0,already=0,laser_state; //level vars char finished[28]={0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0}; // is level number X finished (1 or 0) int levels_completed=0,Stage; //assorted float game_speed=100,average_speed,time_since_start,accel_speed,turn_speed; int frame_count=0,count_start=0,Score=0; float frames_per_second,PARTICLES_OF_EXHAUST=150; int stop=0,stop2=0,infox,infoy,shotnum=0,cannonnum; Sint32 now,lifetime=800000,last_lifetime,NextParticle; char text[200]; int y,x,time_bonus; shot_type shot[MAX_SHOTNUM]; cannon_type cannon; void ComplainAndExit(void); void free_memory() { #ifdef SOUND if (sound) { Mix_FreeMusic(music); Mix_FreeChunk(explode_sound); Mix_FreeChunk(winlevel_sound); Mix_FreeChunk(teleport_sound); Mix_CloseAudio(); } #endif } void timing() { #ifdef SOUND if ((!Mix_PlayingMusic())&&(sound)) {Mix_PlayMusic(music,1);} #endif time_since_start+=game_speed; average_speed=time_since_start/frame_count; //printf("gamespeed: %f average: %f \n",game_speed,average_speed); lifetime-=game_speed; if ( keys[SDLK_ESCAPE] == SDL_PRESSED ) {quit=1;endgame=1;} frame_count++; frames_per_second=frame_count*1000/((SDL_GetTicks()-count_start)+1); game_speed=(SDL_GetTicks()-now)*7; while (game_speed<140) { SDL_Delay(1); game_speed=(SDL_GetTicks()-now)*7; } // printf("x:%f y:%f delay:%d fps%f\n",user[pl].realx,user[pl].realy,(SDL_GetTicks()-now),frames_per_second); now=SDL_GetTicks(); } void corner_collision( Uint8 xblock, Uint8 yblock) { float hyp,alpha,xold,yold; xold=user[pl].xspeed; yold=user[pl].yspeed; hyp=hypot(user[pl].realx+15-xblock*40,user[pl].realy+15-yblock*40); if (hyp<15-RR) { alpha=atan(-(user[pl].realx+15-xblock*40)/(user[pl].realy+15-yblock*40)); user[pl].xspeed=2*(xold*cos(alpha)+yold*sin(alpha))*cos(alpha)-xold; user[pl].yspeed=2*(xold*cos(alpha)+yold*sin(alpha))*sin(alpha)-yold; already=1; } } void ResetLevels() { for (i=0;i<=NUMBER_OF_LEVELS[levelset];i++) { int x,y; finished[i]=0; for (x=0; x<20; x++) { for (y=0; y<15; y++) { if (levelset == 0) map[i][y][x] = origMap[i][y][x]; else map[i][y][x] = origMap2[i][y][x]; } } } } /** * If players p1 and p2 collide, moves them out of the collision and makes them bounce. */ void player_collision(int p1, int p2) { const float radius = 12; /**< assumed radius of ships */ // calculate distance between ships float dist_x = user[p1].realx - user[p2].realx; float dist_y = user[p1].realy - user[p2].realy; float dist = sqrt((dist_x * dist_x) + (dist_y * dist_y)); // abort if ships do not touch/intersect if (dist > (radius + radius)) return; // calculate penetration depth float depth = (radius + radius) - dist; // calculate unity vector of hit direction float hit_x = dist_x / sqrt((dist_x * dist_x) + (dist_y * dist_y)); float hit_y = dist_y / sqrt((dist_x * dist_x) + (dist_y * dist_y)); // calculate fraction of speeds in direction of hit vector float scalar1 = (user[p1].xspeed * hit_x) + (user[p1].yspeed * hit_y); float scalar2 = (user[p2].xspeed * hit_x) + (user[p2].yspeed * hit_y); // abort if nobody seems to have caused the collision if (fabsf(scalar1) + fabsf(scalar2) == 0) return; // calculate "contribution" of each ship to the collision as a fraction of 1, judging by its speed // TODO: this penalizes a ship moving *out* of the collision, too float contrib1 = fabsf(scalar1) / (fabsf(scalar1) + fabsf(scalar2)); float contrib2 = 1-contrib1; // move ships just out of collision with total distance based on "contribution" figure user[p1].realx += hit_x * (depth * contrib1); user[p1].realy += hit_y * (depth * contrib1); user[p2].realx -= hit_x * (depth * contrib2); user[p2].realy -= hit_y * (depth * contrib2); // calculate changes in speed float delta1_x = scalar1 * hit_x; float delta1_y = scalar1 * hit_y; float delta2_x = scalar2 * hit_x; float delta2_y = scalar2 * hit_y; // modify speeds user[p1].xspeed -= delta1_x; user[p1].yspeed -= delta1_y; user[p1].xspeed += delta2_x; user[p1].yspeed += delta2_y; user[p2].xspeed += delta1_x; user[p2].yspeed += delta1_y; user[p2].xspeed -= delta2_x; user[p2].yspeed -= delta2_y; } void kollision() //calcualtes all collisions { Uint8 x,y,x2,y2,sticky; SDL_Rect reblit_back; if (( keys[user[pl].extra] == SDL_PRESSED )&&(user[pl].sticky_possible)) sticky=1; else sticky=0; // handle collisions with other players // TODO: does this belong here? int pl2; for (pl2 = pl+1; pl2 < playernum; pl2++) { player_collision(pl, pl2); } if (already) {already=0;} else for (y=0;y<=14;y++) { for (x=0;x<=19;x++) { //wall if (((map[levelnum][y][x]==1)||(map[levelnum][y][x]>10)||(map[levelnum][y][x]==8))&&((user[pl].realx+30>x*40)&&(user[pl].realxy*40)&&(user[pl].realyy*40)&&(!already)&& (user[pl].realx+15<(x+1)*40)&&(user[pl].realx+15>x*40)&&(map[levelnum][y-1][x]!=1)) { if (sticky) {user[pl].yspeed*=0.1;user[pl].xspeed*=0.1;} else if (user[pl].yspeed>0) {user[pl].yspeed=-user[pl].yspeed;already=1;} } if ((user[pl].realx+15>(x+1)*40)&&(user[pl].realx+RR<(x+1)*40)&&(!already)&& (user[pl].realy+15<(y+1)*40)&&(user[pl].realy+15>y*40)&&(map[levelnum][y][x+1]!=1)) { if (sticky) {user[pl].yspeed*=0.1;user[pl].xspeed*=0.1;} else if (user[pl].xspeed<0) {user[pl].xspeed=-user[pl].xspeed;already=1;} } if ((user[pl].realy+15>(y+1)*40)&&(user[pl].realy+RR<(y+1)*40)&&(!already)&& (user[pl].realx+15<(x+1)*40)&&(user[pl].realx+15>x*40)&&(map[levelnum][y+1][x]!=1)) { if (sticky) {user[pl].yspeed*=0.1;user[pl].xspeed*=0.1;} else if (user[pl].yspeed<0) {user[pl].yspeed=-user[pl].yspeed;already=1;} } if ((user[pl].realx+15x*40)&&(!already)&& (user[pl].realy+15<(y+1)*40)&&(user[pl].realy+15>y*40)&&(map[levelnum][y][x-1]!=1)) { if (sticky) {user[pl].yspeed*=0.1;user[pl].xspeed*=0.1;} else if (user[pl].xspeed>0) {user[pl].xspeed=-user[pl].xspeed;already=1;} } // corners if ((user[pl].realx+15>(x+1)*40)&&(user[pl].realy+150))*/ corner_collision(x+1,y); if ((user[pl].realx+150)&&(user[pl].yspeed>0))*/ corner_collision(x,y); if ((user[pl].realx+15>(x+1)*40)&&(user[pl].realy+15>(y+1)*40)&&(!already)&&(map[levelnum][y][x+1]!=1)&&(map[levelnum][y+1][x]!=1)) /*if ((user[pl].xspeed<0)&&(user[pl].yspeed<0))*/ corner_collision(x+1,y+1); if ((user[pl].realx+15(y+1)*40)&&(!already)&&(map[levelnum][y][x-1]!=1)&&(map[levelnum][y+1][x]!=1)) /*if ((user[pl].xspeed>0)&&(user[pl].yspeed<0))*/ corner_collision(x,y+1); } if (stop) {stop--;} if (stop2) {stop2--;} //lightning if ((map[levelnum][y][x]==2)&&((user[pl].realx+24>x*40)&&(user[pl].realxy*40)&&(user[pl].realyx*40)&&(user[pl].realxy*40)&&(user[pl].realyx*40)&&(user[pl].realxy*40)&&(user[pl].realyx*40)&&(user[pl].realxy*40)&&(user[pl].realy0) {user[pl].teleported-=game_speed;} if (user[pl].teleported<0) {user[pl].teleported=0;} //time bonus if ((map[levelnum][y][x]==6)&&((user[pl].realx+10>x*40)&&(user[pl].realxy*40)&&(user[pl].realyw/2; reblit_back.y=y*40+20-fore[5]->h/2; reblit_back.w=fore[5]->w; reblit_back.h=fore[5]->h; BlitPart(0,0,back,reblit_back); SDL_BlitSurface( back, &reblit_back, backbuffer, &reblit_back ); if (!fullscreen) {SDL_UpdateRects(Screen,1,&reblit_back);} } //laser if ((map[levelnum][y][x]==7)&&((user[pl].realx+24>x*40)&&(user[pl].realxy*40)&&(user[pl].realy 1) spread_percent = 100; while (NextParticle<0) { NewParticles(user[pl].turn, user[pl].realx, user[pl].realy, spread_percent); NextParticle+=350; } } //void thrust() //{ // float deltaspeedx, deltaspeedy; // // deltaspeedy = -cos(user[pl].turn*0.01745)*(game_speed/precision); // 0.01745=(2*PI)/360 thats RAD to DEG // deltaspeedx = sin(user[pl].turn*0.01745)*(game_speed/precision); // user[pl].yspeed+=deltaspeedy; // user[pl].xspeed+=deltaspeedx; // NextParticle-=game_speed; // while (NextParticle<0) { // NewParticles(user[pl].turn, user[pl].realx, user[pl].realy); // NextParticle+=350; // } //} void HandleRacer() //reads keys and sets new coordinates { float alpha,hyp; for(i=0;i774) {user[pl].realx=774;user[pl].xspeed=-user[pl].xspeed;} if (user[pl].realy<-6) {user[pl].realy=-6;user[pl].yspeed=-user[pl].yspeed;} if (user[pl].realy>574) {user[pl].realy=574;user[pl].yspeed=-user[pl].yspeed;} kollision(); } //gravity user[pl].yspeed+=(gravity)*game_speed; //slowdown if (user[pl].slowdown>0) { if (user[pl].xspeed!=0) {alpha=atan(user[pl].yspeed/user[pl].xspeed);} else alpha=1; hyp=hypot(user[pl].xspeed,user[pl].yspeed); if ((user[pl].xspeed<0)) { if (!gravity) {user[pl].yspeed+=sin(alpha)*hyp*user[pl].slowdown*game_speed;} {user[pl].xspeed+=cos(alpha)*hyp*user[pl].slowdown*game_speed;} }else { if (!gravity) {user[pl].yspeed-=sin(alpha)*hyp*user[pl].slowdown*game_speed;} {user[pl].xspeed-=cos(alpha)*hyp*user[pl].slowdown*game_speed;} } } } void DontReadKeys() { SDL_EventState(SDL_KEYUP, SDL_IGNORE); SDL_EventState(SDL_KEYDOWN, SDL_IGNORE); } void UndrawLaser(int update) { SDL_Rect src_rect; Uint8 x,y; for (y=0;y<=14;y++) { for (x=0;x<=19;x++) { if (map[levelnum][y][x]==7){ src_rect.x=x*40; src_rect.y=y*40; src_rect.w=40; src_rect.h=40; BlitPart(x*40,y*40,backbuffer,src_rect); // SDL_BlitSurface(back , &src_rect , backbuffer, &src_rect); if (update) SDL_UpdateRect(Screen,x*40,y*40,40,40); } } } } void DrawLaser() { SDL_Rect src_rect; Uint8 x,y; for (y=0;y<=14;y++) { for (x=0;x<=19;x++) { if (map[levelnum][y][x]==7){ src_rect.x=x*40; src_rect.y=y*40; src_rect.w=40; src_rect.h=40; Blit(x*40 ,y*40,laser_pic[abrand(0,8)]); Blit(x*40+15,y*40,laser_pic[abrand(0,8)]); Blit(x*40+30,y*40,laser_pic[abrand(0,8)]); SDL_UpdateRect(Screen,x*40,y*40,40,40); } } } } void draw_cannon() { int pic=0; while (cannon.turn<0) cannon.turn+=360; cannon.turn+=90; // bad fix -> should be changed! pic=((cannon.turn)*21/360); if (pic>20) pic-=21; // bad fix -> should be changed! if (pic!=cannon.last_pic) { Blit(cannon.x*40,cannon.y*40,cannon_pic[pic]); BlitToBB(cannon.x*40,cannon.y*40,cannon_pic[pic]); } cannon.last_pic=pic; cannon.turn-=90; // bad fix -> should be changed! while (cannon.turn>360) cannon.turn-=360; } void checks_common() { //laser if ((laser_state==0)&&(div(SDL_GetTicks(),laser_switch)).rem<(int)(laser_switch/2)) laser_state=1; if ((laser_state==1)&&(div(SDL_GetTicks(),laser_switch).rem>(int)(laser_switch/2))) { laser_state=0; UndrawLaser(1); } //cannon if (cannonnum) { cannon.turn+=game_speed/(15+cannon.type*15); if (cannon.turn>360) cannon.turn-=360; if (cannon.turn<0) cannon.turn+=360; cannon.time_to_shot-=game_speed*1; if ((cannon.time_to_shot<0)&&(shotnumw/2+1400*shot[shotnum].xspeed; shot[shotnum].y=cannon.y*40+20-shot_pic[0]->h/2+1400*shot[shotnum].yspeed; shotnum++; //printf("%d\n",(int)cannon.turn); } } } void DisplayMsg(SDL_Surface *img, float speed) { Blit(400-img->w/2,250,img); now=SDL_GetTicks(); for (i=255*speed;i>=0;i-=(float)(SDL_GetTicks()-now)/2) { timing(); SDL_SetAlpha(backbuffer,(SDL_SRCALPHA),255); UndrawParticles(); HandleParticles(); DisplayParticles(); Blit(400-img->w/2,250,img); SDL_SetAlpha(backbuffer,(SDL_SRCALPHA),(int)(i/speed)); SDL_BlitSurface(backbuffer,&blitrect,Screen,&blitrect); Update(); } BlitToBB(400-img->w/2,250,img); SDL_SetAlpha(backbuffer,SDL_SRCALPHA,255); while (NullParticle>0) { timing(); UndrawParticles(); HandleParticles(); DisplayParticles(); Update(); } SDL_SetAlpha(backbuffer,SDL_SRCALPHA,255); } void DrawExplosion() { int x,y; x=abrand(-14,+8);y=abrand(-14,+8); Blit(user[pl].realx+x,user[pl].realy+y,explosion_pic); BlitToBB(user[pl].realx+x,user[pl].realy+y,explosion_pic); } void checks_1p() { //level end if ( user[pl].completed ) { #ifdef SOUND if (sound) {Mix_PlayChannel(-1,winlevel_sound,0);} #endif DontReadKeys(); DisplayMsg(pic_completed,1); SDL_Delay(1000); endgame=1; lifetime+=(int)(150000*(1+(time_bonus)/100)); } //crash if ( user[pl].crashed ) { DontReadKeys(); #ifdef SOUND if (sound) {Mix_PlayChannel(-1,explode_sound,0);} #endif SDL_SetAlpha(explosion_pic,(SDL_SRCALPHA),255-80); DrawExplosion(); DrawExplosion(); DrawExplosion(); DisplayMsg(pic_crashed,1); SDL_Delay(1000); endgame=1; fadeout(); } //timeout if (lifetime<0) { DontReadKeys(); DisplayMsg(timeout_pic,1); SDL_Delay(1000); endgame=1; quit=1; fadeout(); } } void checks_2p() { for (pl=0;plformat,255-xcol,xcol,y)); } } unlock(); timerect.x=infox*40+5; timerect.y=infoy*40; timerect.w=110; timerect.h=38; if (!fullscreen) {SDL_UpdateRects(Screen,1,&timerect);} SDL_BlitSurface(Screen,&timerect,backbuffer,&timerect); } } } SDL_Rect SetShotRect(int i) { SDL_Rect rect; rect.x=shot[i].x; rect.y=shot[i].y; rect.w=shot_pic[0]->w; rect.h=shot_pic[0]->h; if (rect.w+rect.x>800) rect.w=800-rect.x; if (rect.h+rect.y>600) rect.h=600-rect.y; if (rect.x<0) {rect.w=rect.w+rect.x;rect.x=0;} if (rect.y<0) {rect.h=rect.h+rect.y;rect.y=0;} return (rect); } void UndrawShots() { for (i=0;i4) shot[i].anim-=5; shot[i].x+=shot[i].xspeed*game_speed; shot[i].y+=shot[i].yspeed*game_speed; if ((shot[i].x<=-shot_pic[0]->w)||(shot[i].x>=800) ||(shot[i].y<=-shot_pic[0]->h)||(shot[i].y>=600)) { SDL_UpdateRects( Screen, 1, &shot[i].oldrect ); for (i2=i;i2360) {user[pl].turn=user[pl].turn-360;} for (i=0;i<=17;i++) //selects the correct picture if (user[pl].turn+10>i*20) {pic=i;} Blit(user[pl].realx,user[pl].realy,user[pl].racer[pic]); user[pl].oldrect=blitrect; } void HandleAndDraw_RacerParticlesAndShots() { if (laser_state) UndrawLaser(0); UndrawShots(); UndrawParticles(); for (pl=0;plw/2+20, y*40-fore[map[levelnum][y][x]-1]->h/2+20, fore[map[levelnum][y][x]-1]); } } } void LookForInfo() //looks for the info box in this level { infox=-1; infoy=-1; cannon.x=-1; for (y=0;y<=14;y++) { for (x=0;x<=19;x++) { if ((map[levelnum][y][x]==11)&&(infoy==-1)) { infox=x; infoy=y; } if (map[levelnum][y][x]==8) { cannon.y=y; cannon.x=x; } } } if (cannon.x<0) cannonnum=0; else cannonnum=1; } void load_images() { Uint8 i; racer_pic[0]=LoadImage("racer_big.gif",0); racer_pic[1]=LoadImage("racerb_big.gif",0); racer_pic[2]=LoadImage("racere_big.gif",0); racer_pic[4]=LoadImage("racerd_big.gif",0); racer_pic[3]=LoadImage("racerf_big.gif",0); racer_pic[5]=LoadImage("highscore.png",0); timeout_pic=LoadImage("timeout.png",3); explosion_pic=LoadImage("explosion1.gif",1); pic_completed=LoadImage("completed.png",3); pic_crashed=LoadImage("crashed.png",3); back=LoadImage("back2.jpg",0); mode_select_pic[0]=LoadImage("1player.jpg",0); mode_select_pic[1]=LoadImage("2playercomp.jpg",0); mode_select_pic[2]=LoadImage("2playerteam.jpg",0); mode_select_pic[3]=LoadImage("quit.jpg",0); selectp_pic[0]=LoadImage("selectp1.jpg",0); selectp_pic[1]=LoadImage("selectp2.jpg",0); selector_pic=LoadImage("select.gif",1); for (i=0;i<=FOREGROUND_TILE_NUM-1;i++) { sprintf(text,"fore%d.png",i+1); fore[i]=LoadImage(text,3); } for (i=10;i<16;i++) { sprintf(text,"fore%d.gif",i+1); fore[i]=LoadImage(text,0); } for (i=0;i<21;i++) { sprintf(text,"cannon%d.jpg",i+1); cannon_pic[i]=LoadImage(text,0); } for (i=0;i<5;i++) { sprintf(text,"star%d.gif",i+1); shot_pic[i]=LoadImage(text,1); } for (i=0;i<9;i++) { sprintf(text,"laser%d.png",i+1); laser_pic[i]=LoadImage(text,3); } } void TextHelp(char *argv[]) { printf("\nBumpRace Version %s\n",VERSION); puts("The newest version can be obtained at http://www.linux-games.com/\n"); printf("Usage: %s [options]\n",argv[0]); puts(" [-f | --fullscreen] start in fullscreen mode (default)"); puts(" [-w,| --windowed] start in windowed mode"); puts(" [-s,| --nosound] start without sound"); puts(" [-n,| --notfinal] no title screen (nice for develolopers)"); puts(" [-t,| --noparticles] turns of paticles. good for slow computers."); puts(" [-o,| --nofadeout] no fadeout after crash (for slow coputers)"); puts(" [ --precision] sets the precison of the collisions (default=10)"); puts(" [-h,| --help] this text\n"); exit(0); } void ReadCommandLine(char *argv[]) { int i; for ( i=1;argv[i];i++ ) { if ((strcmp(argv[i],"--nosound")==0)||(strcmp(argv[i],"-s")==0)) {sound=0;} else if ((strcmp(argv[i],"--fullscreen")==0)||(strcmp(argv[i],"-f")==0)) {fullscreen=1;} else if ((strcmp(argv[i],"--windowed")==0)||(strcmp(argv[i],"-w")==0)) {fullscreen=0;} else if ((strcmp(argv[i],"--pageflip")==0)||(strcmp(argv[i],"-p")==0)) {pageflip=1;fullscreen=1;} else if ((strcmp(argv[i],"--notfinal")==0)||(strcmp(argv[i],"-n")==0)) {final=0;} else if ((strcmp(argv[i],"--noparticles")==0)||(strcmp(argv[i],"-t")==0)) {particle=0;} else if ((strcmp(argv[i],"--nofadeout")==0)||(strcmp(argv[i],"-o")==0)) {dofadeout=0;} else if ((strcmp(argv[i],"--precision")==0)&&(argv[i+1])) {i++;precision=atoi(argv[i]);printf("Precision is set to %d\n",precision);} else if ((strcmp(argv[i],"--levelset")==0)&&(argv[i+1])) {i++;levelset=atoi(argv[i]);printf("Levelset is set to %d\n",levelset);} else if ((strcmp(argv[i],"--help")==0)||(strcmp(argv[i],"-h")==0)) TextHelp(argv); else { printf("Unknown parameter (-h for help): \"%s\" \n", argv[i]); TextHelp(argv); } } } void BlitMenu() //blits menu for SelectRacer { SDL_Rect fillrect; NullParticle = 0; for (i=0;i<=5;i++) { if (i==user[pl].racernum) { SDL_SetAlpha(racer_pic[i],(SDL_SRCALPHA),255); } else { SDL_SetAlpha(racer_pic[i],(SDL_SRCALPHA),75); } } fillrect.x=0; fillrect.y=160; fillrect.w=800; fillrect.h=440; SDL_FillRect(Screen,&fillrect,0); Blit(50,160,racer_pic[0]); Blit(300,160,racer_pic[1]); Blit(550,160,racer_pic[2]); Blit(50,370,racer_pic[3]); Blit(300,370,racer_pic[4]); Blit(550,370,racer_pic[5]); PutString(Screen, 100, 350, "Best steering"); PutString(Screen, 330, 350, "15% extra time"); PutString(Screen, 540, 350, "High velocity (ctrl key)"); PutString(Screen, 40, 560, "Sticks to walls (ctrl key)"); } void NextStage() { Blit(0,0,back); XCenteredString(Screen, 100, "Congratulations!"); XCenteredString(Screen, 130, "You have completed a stage!"); XCenteredString(Screen, 200, "You gain 200 points for completing this stage"); sprintf(text, "and %d points for the time that is left,", lifetime/3000); XCenteredString(Screen, 230, text); XCenteredString(Screen, 260, "but the game gets a bit harder."); sprintf(text, "You are in Stage %d now", ++Stage); XCenteredString(Screen, 360, text); sprintf(text, "Your current score is %d", Score+=200+lifetime/3000); XCenteredString(Screen, 390, text); levels_completed=0; lifetime=800000-(Stage-1)*70000; SDL_UpdateRect(Screen,0,0,0,0); SDL_EventState(SDL_KEYUP, SDL_ENABLE); SDL_EventState(SDL_KEYDOWN, SDL_ENABLE); SDL_WaitEvent(&event); SDL_WaitEvent(&event); } void nextlevel() //selects the next level at random { int i; finished[levelnum]=1; quit=1; for (i=0;iuser[1].points) sprintf(text,"Player 1 has won!"); else if (user[0].pointsX >= 0 ) if( (int)ThisParticle->X < 800 ) if( (int)ThisParticle->Y >= 0 ) if( (int)ThisParticle->Y < 600 ) PutBackPixel( Screen, (int)ThisParticle->X, (int)ThisParticle->Y ); } } void HandleParticles() { int i; for( i = 0; i < NullParticle; i++ ) { Particle* ThisParticle = &particles[ i ]; ThisParticle->Lifetime-=game_speed/(float)1000; if( ThisParticle->Lifetime <= 0 ) { // Delete this particle if( i != NullParticle -1 ) { // We aren't the end particle, so we have to preserve the end. Particle* OtherParticle = &particles[ NullParticle - 1 ]; *ThisParticle = *OtherParticle; // Default: Memberwise Assignment } NullParticle--; i--; // Do this cell once more... } else { int MorphColor; // Move this particle ThisParticle->X += ThisParticle->dX*game_speed; ThisParticle->Y += ThisParticle->dY*game_speed; ThisParticle->dY+= gravity/(float)2000; // printf("%f\t%f\n",ThisParticle->dX*game_speed,ThisParticle->dY*game_speed); MorphColor = 0; switch( (int)ThisParticle->Lifetime ) { case 25: case 20: MorphColor = 1; break; case 8: case 2: MorphColor = -1; break; } ThisParticle->R += MorphColor; ThisParticle->G += MorphColor; ThisParticle->B += MorphColor; // Strangely enough, it looks better *WITHOUT* the logical constraints! // if (ThisParticle->R>255) ThisParticle->R=255; // if (ThisParticle->R<0) ThisParticle->R=0; // if (ThisParticle->G>255) ThisParticle->G=255; // if (ThisParticle->G<0) ThisParticle->G=0; // if (ThisParticle->B>255) ThisParticle->B=255; // if (ThisParticle->B<0) ThisParticle->B=0; } } } void DisplayParticles() { int i; lock(); for( i = 0; i < NullParticle; i++ ){ Particle* ThisParticle = &particles[ i ]; int X, Y; X = ThisParticle->X; Y = ThisParticle->Y; if( ThisParticle->X >= 0 ) if( ThisParticle->X < 800 ) if( ThisParticle->Y >= 0 ) if( ThisParticle->Y < 600 ){ PutPixel( Screen, ThisParticle->X, ThisParticle->Y, SDL_MapRGB(Screen->format,ThisParticle->R, ThisParticle->G, ThisParticle->B) ); } } unlock(); } void NewParticles(float turn, int X, int Y, float spread_percent) { if(( NullParticle < PARTICLES_OF_EXHAUST )&&(particle)) { int ColorIndex; int Percent; // Damn. C is really really finicky about declarations! Urusai! Particle* ThisParticle = &particles[ NullParticle ]; ThisParticle->Lifetime = PARTICLE_LIFETIME + abrand( -5, 5 ); ThisParticle->X = X + 15; ThisParticle->Y = Y + 15; ColorIndex = abrand( 0, PARTICLE_COLORS-1 ); ThisParticle->R = ParticleColorsR[ ColorIndex ]; ThisParticle->G = ParticleColorsG[ ColorIndex ]; ThisParticle->B = ParticleColorsB[ ColorIndex ]; // Introduce Orthogonal (y, -x) Component Percent = abrand( -spread_percent/2, spread_percent/2 ); turn+=190; turn+=Percent; if (turn>360) turn-=360; ThisParticle->dX = sin(turn*0.01745)*(precision); ThisParticle->dY = -cos(turn*0.01745)*(precision); // scale particle speed // (because I'm having such difficulty finding a good scaling value...) ThisParticle->dX /= (float)2000; ThisParticle->dY /= (float)2000; NullParticle++; } } bumprace-1.5.4/mkinstalldirs0000755000175000017500000000664711217461066013067 00000000000000#! /bin/sh # mkinstalldirs --- make directory hierarchy scriptversion=2006-05-11.19 # Original author: Noah Friedman # Created: 1993-05-16 # Public domain. # # This file is maintained in Automake, please report # bugs to or send patches to # . nl=' ' IFS=" "" $nl" errstatus=0 dirmode= usage="\ Usage: mkinstalldirs [-h] [--help] [--version] [-m MODE] DIR ... Create each directory DIR (with mode MODE, if specified), including all leading file name components. Report bugs to ." # process command line arguments while test $# -gt 0 ; do case $1 in -h | --help | --h*) # -h for help echo "$usage" exit $? ;; -m) # -m PERM arg shift test $# -eq 0 && { echo "$usage" 1>&2; exit 1; } dirmode=$1 shift ;; --version) echo "$0 $scriptversion" exit $? ;; --) # stop option processing shift break ;; -*) # unknown option echo "$usage" 1>&2 exit 1 ;; *) # first non-opt arg break ;; esac done for file do if test -d "$file"; then shift else break fi done case $# in 0) exit 0 ;; esac # Solaris 8's mkdir -p isn't thread-safe. If you mkdir -p a/b and # mkdir -p a/c at the same time, both will detect that a is missing, # one will create a, then the other will try to create a and die with # a "File exists" error. This is a problem when calling mkinstalldirs # from a parallel make. We use --version in the probe to restrict # ourselves to GNU mkdir, which is thread-safe. case $dirmode in '') if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then echo "mkdir -p -- $*" exec mkdir -p -- "$@" else # On NextStep and OpenStep, the `mkdir' command does not # recognize any option. It will interpret all options as # directories to create, and then abort because `.' already # exists. test -d ./-p && rmdir ./-p test -d ./--version && rmdir ./--version fi ;; *) if mkdir -m "$dirmode" -p --version . >/dev/null 2>&1 && test ! -d ./--version; then echo "mkdir -m $dirmode -p -- $*" exec mkdir -m "$dirmode" -p -- "$@" else # Clean up after NextStep and OpenStep mkdir. for d in ./-m ./-p ./--version "./$dirmode"; do test -d $d && rmdir $d done fi ;; esac for file do case $file in /*) pathcomp=/ ;; *) pathcomp= ;; esac oIFS=$IFS IFS=/ set fnord $file shift IFS=$oIFS for d do test "x$d" = x && continue pathcomp=$pathcomp$d case $pathcomp in -*) pathcomp=./$pathcomp ;; esac if test ! -d "$pathcomp"; then echo "mkdir $pathcomp" mkdir "$pathcomp" || lasterr=$? if test ! -d "$pathcomp"; then errstatus=$lasterr else if test ! -z "$dirmode"; then echo "chmod $dirmode $pathcomp" lasterr= chmod "$dirmode" "$pathcomp" || lasterr=$? if test ! -z "$lasterr"; then errstatus=$lasterr fi fi fi fi pathcomp=$pathcomp/ done done exit $errstatus # Local Variables: # mode: shell-script # sh-indentation: 2 # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-end: "$" # End: bumprace-1.5.4/aclocal.m40000644000175000017500000007700111754254551012116 00000000000000# generated automatically by aclocal 1.10.1 -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl m4_if(AC_AUTOCONF_VERSION, [2.61],, [m4_warning([this file was generated for autoconf 2.61. You have another version of autoconf. It may work, but is not guaranteed to. If you have problems, you may need to regenerate the build system entirely. To do so, use the procedure documented by the package, typically `autoreconf'.])]) # Copyright (C) 2002, 2003, 2005, 2006, 2007 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. # (This private macro should not be called outside this file.) AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version='1.10' dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to dnl require some minimum version. Point them to the right macro. m4_if([$1], [1.10.1], [], [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl ]) # _AM_AUTOCONF_VERSION(VERSION) # ----------------------------- # aclocal traces this macro to find the Autoconf version. # This is a private macro too. Using m4_define simplifies # the logic in aclocal, which can simply ignore this definition. m4_define([_AM_AUTOCONF_VERSION], []) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. # This function is AC_REQUIREd by AC_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.10.1])dnl m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl _AM_AUTOCONF_VERSION(AC_AUTOCONF_VERSION)]) # AM_AUX_DIR_EXPAND -*- Autoconf -*- # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # AM_CONDITIONAL -*- Autoconf -*- # Copyright (C) 1997, 2000, 2001, 2003, 2004, 2005, 2006 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 8 # AM_CONDITIONAL(NAME, SHELL-CONDITION) # ------------------------------------- # Define a conditional. AC_DEFUN([AM_CONDITIONAL], [AC_PREREQ(2.52)dnl ifelse([$1], [TRUE], [AC_FATAL([$0: invalid condition: $1])], [$1], [FALSE], [AC_FATAL([$0: invalid condition: $1])])dnl AC_SUBST([$1_TRUE])dnl AC_SUBST([$1_FALSE])dnl _AM_SUBST_NOTMAKE([$1_TRUE])dnl _AM_SUBST_NOTMAKE([$1_FALSE])dnl if $2; then $1_TRUE= $1_FALSE='#' else $1_TRUE='#' $1_FALSE= fi AC_CONFIG_COMMANDS_PRE( [if test -z "${$1_TRUE}" && test -z "${$1_FALSE}"; then AC_MSG_ERROR([[conditional "$1" was never defined. Usually this means the macro was only invoked conditionally.]]) fi])]) # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 9 # There are a few dirty hacks below to avoid letting `AC_PROG_CC' be # written in clear, in which case automake, when reading aclocal.m4, # will think it sees a *use*, and therefore will trigger all it's # C support machinery. Also note that it means that autoscan, seeing # CC etc. in the Makefile, will ask for an AC_PROG_CC use... # _AM_DEPENDENCIES(NAME) # ---------------------- # See how the compiler implements dependency checking. # NAME is "CC", "CXX", "GCJ", or "OBJC". # We try a few techniques and use that to set a single cache variable. # # We don't AC_REQUIRE the corresponding AC_PROG_CC since the latter was # modified to invoke _AM_DEPENDENCIES(CC); we would have a circular # dependency, and given that the user is not expected to run this macro, # just rely on AC_PROG_CC. AC_DEFUN([_AM_DEPENDENCIES], [AC_REQUIRE([AM_SET_DEPDIR])dnl AC_REQUIRE([AM_OUTPUT_DEPENDENCY_COMMANDS])dnl AC_REQUIRE([AM_MAKE_INCLUDE])dnl AC_REQUIRE([AM_DEP_TRACK])dnl ifelse([$1], CC, [depcc="$CC" am_compiler_list=], [$1], CXX, [depcc="$CXX" am_compiler_list=], [$1], OBJC, [depcc="$OBJC" am_compiler_list='gcc3 gcc'], [$1], UPC, [depcc="$UPC" am_compiler_list=], [$1], GCJ, [depcc="$GCJ" am_compiler_list='gcc3 gcc'], [depcc="$$1" am_compiler_list=]) AC_CACHE_CHECK([dependency style of $depcc], [am_cv_$1_dependencies_compiler_type], [if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_$1_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n ['s/^#*\([a-zA-Z0-9]*\))$/\1/p'] < ./depcomp` fi for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf case $depmode in nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; none) break ;; esac # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. if depmode=$depmode \ source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst1.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_$1_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_$1_dependencies_compiler_type=none fi ]) AC_SUBST([$1DEPMODE], [depmode=$am_cv_$1_dependencies_compiler_type]) AM_CONDITIONAL([am__fastdep$1], [ test "x$enable_dependency_tracking" != xno \ && test "$am_cv_$1_dependencies_compiler_type" = gcc3]) ]) # AM_SET_DEPDIR # ------------- # Choose a directory name for dependency files. # This macro is AC_REQUIREd in _AM_DEPENDENCIES AC_DEFUN([AM_SET_DEPDIR], [AC_REQUIRE([AM_SET_LEADING_DOT])dnl AC_SUBST([DEPDIR], ["${am__leading_dot}deps"])dnl ]) # AM_DEP_TRACK # ------------ AC_DEFUN([AM_DEP_TRACK], [AC_ARG_ENABLE(dependency-tracking, [ --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors]) if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi AM_CONDITIONAL([AMDEP], [test "x$enable_dependency_tracking" != xno]) AC_SUBST([AMDEPBACKSLASH])dnl _AM_SUBST_NOTMAKE([AMDEPBACKSLASH])dnl ]) # Generate code to set up dependency tracking. -*- Autoconf -*- # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. #serial 3 # _AM_OUTPUT_DEPENDENCY_COMMANDS # ------------------------------ AC_DEFUN([_AM_OUTPUT_DEPENDENCY_COMMANDS], [for mf in $CONFIG_FILES; do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`AS_DIRNAME("$mf")` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`AS_DIRNAME(["$file"])` AS_MKDIR_P([$dirpart/$fdir]) # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done ])# _AM_OUTPUT_DEPENDENCY_COMMANDS # AM_OUTPUT_DEPENDENCY_COMMANDS # ----------------------------- # This macro should only be invoked once -- use via AC_REQUIRE. # # This code is only required when automatic dependency tracking # is enabled. FIXME. This creates each `.P' file that we will # need in order to bootstrap the dependency handling code. AC_DEFUN([AM_OUTPUT_DEPENDENCY_COMMANDS], [AC_CONFIG_COMMANDS([depfiles], [test x"$AMDEP_TRUE" != x"" || _AM_OUTPUT_DEPENDENCY_COMMANDS], [AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"]) ]) # Do all the work for Automake. -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 13 # This macro actually does too much. Some checks are only needed if # your package does certain things. But this isn't really a big deal. # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.60])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl # test to see if srcdir already configured if test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT. m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,, [m4_fatal([AC_INIT should be called with package and version arguments])])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AM_PROG_INSTALL_SH AM_PROG_INSTALL_STRIP AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl AC_PROVIDE_IFELSE([AC_PROG_OBJC], [_AM_DEPENDENCIES(OBJC)], [define([AC_PROG_OBJC], defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl ]) ]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_arg=$1 _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count]) # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl install_sh=${install_sh-"\$(SHELL) $am_aux_dir/install-sh"} AC_SUBST(install_sh)]) # Copyright (C) 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Check to see how 'make' treats includes. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 3 # AM_MAKE_INCLUDE() # ----------------- # Check to see how make treats includes. AC_DEFUN([AM_MAKE_INCLUDE], [am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo done .PHONY: am__doit END # If we don't find an include directive, just comment out the code. AC_MSG_CHECKING([for style of include used by $am_make]) am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # We grep out `Entering directory' and `Leaving directory' # messages which can occur if `w' ends up in MAKEFLAGS. # In particular we don't look at `^make:' because GNU make might # be invoked under some other name (usually "gmake"), in which # case it prints its new name instead of `make'. if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then am__include=include am__quote= _am_result=GNU fi # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then am__include=.include am__quote="\"" _am_result=BSD fi fi AC_SUBST([am__include]) AC_SUBST([am__quote]) AC_MSG_RESULT([$_am_result]) rm -f confinc confmf ]) # Fake the existence of programs that GNU maintainers use. -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl AC_REQUIRE_AUX_FILE([missing])dnl test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing" # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # Copyright (C) 2003, 2004, 2005, 2006 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_MKDIR_P # --------------- # Check for `mkdir -p'. AC_DEFUN([AM_PROG_MKDIR_P], [AC_PREREQ([2.60])dnl AC_REQUIRE([AC_PROG_MKDIR_P])dnl dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P, dnl while keeping a definition of mkdir_p for backward compatibility. dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile. dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of dnl Makefile.ins that do not define MKDIR_P, so we do our own dnl adjustment using top_builddir (which is defined more often than dnl MKDIR_P). AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl case $mkdir_p in [[\\/$]]* | ?:[[\\/]]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac ]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 3 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # ------------------------------ # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ---------------------------------- # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [AC_FOREACH([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # Check to make sure that the build environment is sane. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 4 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_STRIP # --------------------- # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Copyright (C) 2006 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # _AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in. # This macro is traced by Automake. AC_DEFUN([_AM_SUBST_NOTMAKE]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. AM_MISSING_PROG([AMTAR], [tar]) m4_if([$1], [v7], [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR m4_include([acinclude.m4]) bumprace-1.5.4/macosx/0000777000175000017500000000000011217461066011622 500000000000000bumprace-1.5.4/macosx/SDLMain.m0000755000175000017500000002147211217461066013154 00000000000000/* SDLMain.m - main entry point for our Cocoa-ized SDL app Initial Version: Darrell Walisser Non-NIB-Code & other changes: Max Horn Feel free to customize this file to suit your needs */ #import "SDL.h" #import "SDLMain.h" #import /* for MAXPATHLEN */ #import /* Use this flag to determine whether we use SDLMain.nib or not */ #define SDL_USE_NIB_FILE 1 static int gArgc; static char **gArgv; static BOOL gFinderLaunch; #if SDL_USE_NIB_FILE /* A helper category for NSString */ @interface NSString (ReplaceSubString) - (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString; @end #else /* An internal Apple class used to setup Apple menus */ @interface NSAppleMenuController:NSObject {} - (void)controlMenu:(NSMenu *)aMenu; @end #endif @interface SDLApplication : NSApplication @end @implementation SDLApplication /* Invoked from the Quit menu item */ - (void)terminate:(id)sender { /* Post a SDL_QUIT event */ SDL_Event event; event.type = SDL_QUIT; SDL_PushEvent(&event); } @end /* The main class of the application, the application's delegate */ @implementation SDLMain - (IBAction)prefsMenu:(id)sender { printf ("prefs menu\n"); } - (IBAction)newGame:(id)sender { printf ("new game\n"); NSRunAlertPanel (@"Get ready to blow up some... stuff!", @"Click OK to begin total carnage. Click Cancel to prevent total carnage.", @"OK", @"Cancel", nil); } - (IBAction)openGame:(id)sender { NSString *path = nil; NSOpenPanel *openPanel = [ NSOpenPanel openPanel ]; if ( [ openPanel runModalForDirectory:nil file:@"SavedGame" types:nil ] ) { path = [ [ openPanel filenames ] objectAtIndex:0 ]; } printf ("open game: %s\n", [ path cString ]); } - (IBAction)saveGame:(id)sender { NSString *path = nil; NSSavePanel *savePanel = [ NSSavePanel savePanel ]; if ( [ savePanel runModalForDirectory:nil file:@"SaveGameFile" ] ) { path = [ savePanel filename ]; } printf ("save game: %s\n", [ path cString ]); } - (IBAction)saveGameAs:(id)sender { printf ("save game as\n"); } - (IBAction)help:(id)sender { NSRunAlertPanel (@"Oh help, where have ye gone?", @"Sorry, there is no help available.\n\nThis message brought to you by We Don't Document, Inc.\n\n", @"Rats", @"Good, I never read it anyway", nil); } /* Set the working directory to the .app's parent directory */ - (void) setupWorkingDirectory:(BOOL)shouldChdir { char parentdir[MAXPATHLEN]; char *c; strncpy ( parentdir, gArgv[0], sizeof(parentdir) ); c = (char*) parentdir; while (*c != '\0') /* go to end */ c++; while (*c != '/') /* back up to parent */ c--; *c++ = '\0'; /* cut off last part (binary name) */ if (shouldChdir) { assert ( chdir (parentdir) == 0 ); /* chdir to the binary app's parent */ assert ( chdir ("../../../") == 0 ); /* chdir to the .app's parent */ } } #if SDL_USE_NIB_FILE /* Fix menu to contain the real app name instead of "SDL App" */ - (void)fixMenu:(NSMenu *)aMenu withAppName:(NSString *)appName { NSRange aRange; NSEnumerator *enumerator; NSMenuItem *menuItem; aRange = [[aMenu title] rangeOfString:@"SDL App"]; if (aRange.length != 0) [aMenu setTitle: [[aMenu title] stringByReplacingRange:aRange with:appName]]; enumerator = [[aMenu itemArray] objectEnumerator]; while ((menuItem = [enumerator nextObject])) { aRange = [[menuItem title] rangeOfString:@"SDL App"]; if (aRange.length != 0) [menuItem setTitle: [[menuItem title] stringByReplacingRange:aRange with:appName]]; if ([menuItem hasSubmenu]) [self fixMenu:[menuItem submenu] withAppName:appName]; } [ aMenu sizeToFit ]; } #else void setupAppleMenu(void) { /* warning: this code is very odd */ NSAppleMenuController *appleMenuController; NSMenu *appleMenu; NSMenuItem *appleMenuItem; appleMenuController = [[NSAppleMenuController alloc] init]; appleMenu = [[NSMenu alloc] initWithTitle:@""]; appleMenuItem = [[NSMenuItem alloc] initWithTitle:@"" action:nil keyEquivalent:@""]; [appleMenuItem setSubmenu:appleMenu]; /* yes, we do need to add it and then remove it -- if you don't add it, it doesn't get displayed if you don't remove it, you have an extra, titleless item in the menubar when you remove it, it appears to stick around very, very odd */ [[NSApp mainMenu] addItem:appleMenuItem]; [appleMenuController controlMenu:appleMenu]; [[NSApp mainMenu] removeItem:appleMenuItem]; [appleMenu release]; [appleMenuItem release]; } /* Create a window menu */ void setupWindowMenu(void) { NSMenu *windowMenu; NSMenuItem *windowMenuItem; NSMenuItem *menuItem; windowMenu = [[NSMenu alloc] initWithTitle:@"Window"]; /* "Minimize" item */ menuItem = [[NSMenuItem alloc] initWithTitle:@"Minimize" action:@selector(performMiniaturize:) keyEquivalent:@"m"]; [windowMenu addItem:menuItem]; [menuItem release]; /* Put menu into the menubar */ windowMenuItem = [[NSMenuItem alloc] initWithTitle:@"Window" action:nil keyEquivalent:@""]; [windowMenuItem setSubmenu:windowMenu]; [[NSApp mainMenu] addItem:windowMenuItem]; /* Tell the application object that this is now the window menu */ [NSApp setWindowsMenu:windowMenu]; /* Finally give up our references to the objects */ [windowMenu release]; [windowMenuItem release]; } /* Replacement for NSApplicationMain */ void CustomApplicationMain (argc, argv) { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; SDLMain *sdlMain; /* Ensure the application object is initialised */ [SDLApplication sharedApplication]; /* Set up the menubar */ [NSApp setMainMenu:[[NSMenu alloc] init]]; setupAppleMenu(); setupWindowMenu(); /* Create SDLMain and make it the app delegate */ sdlMain = [[SDLMain alloc] init]; [NSApp setDelegate:sdlMain]; /* Start the main event loop */ [NSApp run]; [sdlMain release]; [pool release]; } #endif /* Called when the internal event loop has just started running */ - (void) applicationDidFinishLaunching: (NSNotification *) note { int status; /* Set the working directory to the .app's parent directory */ [self setupWorkingDirectory:gFinderLaunch]; #if SDL_USE_NIB_FILE /* Set the main menu to contain the real app name instead of "SDL App" */ [self fixMenu:[NSApp mainMenu] withAppName:[[NSProcessInfo processInfo] processName]]; #endif /* Hand off to main application code */ status = SDL_main (gArgc, gArgv); /* We're done, thank you for playing */ exit(status); } @end @implementation NSString (ReplaceSubString) - (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString { unsigned int bufferSize; unsigned int selfLen = [self length]; unsigned int aStringLen = [aString length]; unichar *buffer; NSRange localRange; NSString *result; bufferSize = selfLen + aStringLen - aRange.length; buffer = NSAllocateMemoryPages(bufferSize*sizeof(unichar)); /* Get first part into buffer */ localRange.location = 0; localRange.length = aRange.location; [self getCharacters:buffer range:localRange]; /* Get middle part into buffer */ localRange.location = 0; localRange.length = aStringLen; [aString getCharacters:(buffer+aRange.location) range:localRange]; /* Get last part into buffer */ localRange.location = aRange.location + aRange.length; localRange.length = selfLen - localRange.location; [self getCharacters:(buffer+aRange.location+aStringLen) range:localRange]; /* Build output string */ result = [NSString stringWithCharacters:buffer length:bufferSize]; NSDeallocateMemoryPages(buffer, bufferSize); return result; } @end #ifdef main # undef main #endif /* Main entry point to executable - should *not* be SDL_main! */ int main (int argc, char **argv) { /* Copy the arguments into a global variable */ int i; /* This is passed if we are launched by double-clicking */ if ( argc >= 2 && strncmp (argv[1], "-psn", 4) == 0 ) { gArgc = 1; gFinderLaunch = YES; } else { gArgc = argc; gFinderLaunch = NO; } gArgv = (char**) malloc (sizeof(*gArgv) * (gArgc+1)); assert (gArgv != NULL); for (i = 0; i < gArgc; i++) gArgv[i] = argv[i]; gArgv[i] = NULL; #if SDL_USE_NIB_FILE [SDLApplication poseAsClass:[NSApplication class]]; NSApplicationMain (argc, (const char **)argv); #else CustomApplicationMain (argc, argv); #endif return 0; } bumprace-1.5.4/macosx/SDLMain.h0000755000175000017500000000077311217461066013150 00000000000000/* SDLMain.m - main entry point for our Cocoa-ized SDL app Initial Version: Darrell Walisser Non-NIB-Code & other changes: Max Horn Feel free to customize this file to suit your needs */ #import @interface SDLMain : NSObject { } - (IBAction)prefsMenu:(id)sender; - (IBAction)newGame:(id)sender; - (IBAction)openGame:(id)sender; - (IBAction)saveGame:(id)sender; - (IBAction)saveGameAs:(id)sender; - (IBAction)help:(id)sender; @end bumprace-1.5.4/macosx/SDLMain.nib/0000777000175000017500000000000011217461066013620 500000000000000bumprace-1.5.4/macosx/SDLMain.nib/objects.nib0000644000175000017500000000366711217461066015673 00000000000000 typedstream@NSIBObjectDataNSObjectNSCustomObject)@@NSMutableStringNSString+ NSApplicationiNSMenu̔i@@@HelpNSMutableArrayNSArray NSMenuItem i@@IIi@@@@:i@SDL Help?NSCustomResource)NSImageNSMenuCheckmarkNSMenuMixedStateSDLMainSDL AppsubmenuAction: About SDL AppPreferences...@ Hide SDL Apph Hide OthersShow All@ Quit SDL Appq _NSAppleMenuWindowWindowƠMinimizem_NSWindowsMenu _NSMainMenuHelpĖƖSDLMainGame҄ӠNew GameӠ Save GameӠBlue NSFontManagerī 2ۄ Font ManagerɄ NSMenuItem1 File's OwnerЖƄNSMenu1111MainMenuĄ NSMenuItem11 NSMenuItem NSMutableSetNSSetI NSNibControlConnectorτNSNibConnector@@@orderFrontStandardAboutPanel:hideOtherApplications:hide:unhideAllApplications:NSNibOutletConnectorτdelegateɅperformMiniaturize: terminate:τhelp:τ prefsMenu:ۚ@iɁgہāρªс'$:D Ī%o9EƁj8ÚFIBCocoaFrameworkbumprace-1.5.4/macosx/SDLMain.nib/info.nib0000644000175000017500000000075411217461066015167 00000000000000 IBDocumentLocation 52 97 356 240 0 0 1024 746 IBEditorPositions 29 76 438 233 44 0 0 1024 746 IBFramework Version 349.0 IBSystem Version 7M34 bumprace-1.5.4/macosx/SDLMain.nib/classes.nib0000644000175000017500000000073011217461066015663 00000000000000{ IBClasses = ( {CLASS = FirstResponder; LANGUAGE = ObjC; SUPERCLASS = NSObject; }, { ACTIONS = { help = id; newGame = id; openGame = id; prefsMenu = id; saveGame = id; saveGameAs = id; }; CLASS = SDLMain; LANGUAGE = ObjC; SUPERCLASS = NSObject; } ); IBVersion = 1; }bumprace-1.5.4/macosx/bumprace.xcodeproj/0000777000175000017500000000000011217461066015414 500000000000000bumprace-1.5.4/macosx/bumprace.xcodeproj/karl.mode10000644000175000017500000011572411217461066017222 00000000000000 ActivePerspectiveName Project AllowedModules BundleLoadPath MaxInstances n Module PBXSmartGroupTreeModule Name Groups and Files Outline View BundleLoadPath MaxInstances n Module PBXNavigatorGroup Name Editor BundleLoadPath MaxInstances n Module XCTaskListModule Name Task List BundleLoadPath MaxInstances n Module XCDetailModule Name File and Smart Group Detail Viewer BundleLoadPath MaxInstances 1 Module PBXBuildResultsModule Name Detailed Build Results Viewer BundleLoadPath MaxInstances 1 Module PBXProjectFindModule Name Project Batch Find Tool BundleLoadPath MaxInstances n Module PBXRunSessionModule Name Run Log BundleLoadPath MaxInstances n Module PBXBookmarksModule Name Bookmarks Tool BundleLoadPath MaxInstances n Module PBXClassBrowserModule Name Class Browser BundleLoadPath MaxInstances n Module PBXCVSModule Name Source Code Control Tool BundleLoadPath MaxInstances n Module PBXDebugBreakpointsModule Name Debug Breakpoints Tool BundleLoadPath MaxInstances n Module XCDockableInspector Name Inspector BundleLoadPath MaxInstances n Module PBXOpenQuicklyModule Name Open Quickly Tool BundleLoadPath MaxInstances 1 Module PBXDebugSessionModule Name Debugger BundleLoadPath MaxInstances 1 Module PBXDebugCLIModule Name Debug Console Description DefaultDescriptionKey DockingSystemVisible Extension mode1 FavBarConfig PBXProjectModuleGUID CB06E925086BFC0F001241D7 XCBarModuleItemNames XCBarModuleItems FirstTimeWindowDisplayed Identifier com.apple.perspectives.project.mode1 MajorVersion 31 MinorVersion 1 Name Default Notifications OpenEditors PerspectiveWidths -1 -1 Perspectives ChosenToolbarItems active-target-popup action NSToolbarFlexibleSpaceItem buildOrClean build-and-runOrDebug com.apple.ide.PBXToolbarStopButton get-info toggle-editor NSToolbarFlexibleSpaceItem com.apple.pbx.toolbar.searchfield ControllerClassBaseName IconName WindowOfProjectWithEditor Identifier perspective.project IsVertical Layout ContentConfiguration PBXBottomSmartGroupGIDs 1C37FBAC04509CD000000102 1C37FAAC04509CD000000102 1C08E77C0454961000C914BD 1C37FABC05509CD000000102 1C37FABC05539CD112110102 E2644B35053B69B200211256 1C37FABC04509CD000100104 1CC0EA4004350EF90044410B 1CC0EA4004350EF90041110B PBXProjectModuleGUID 1CE0B1FE06471DED0097A5F4 PBXProjectModuleLabel Files PBXProjectStructureProvided yes PBXSmartGroupTreeModuleColumnData PBXSmartGroupTreeModuleColumnWidthsKey 186 PBXSmartGroupTreeModuleColumnsKey_v4 MainColumn PBXSmartGroupTreeModuleOutlineStateKey_v7 PBXSmartGroupTreeModuleOutlineStateExpansionKey 29B97314FDCFA39411CA2CEA 29B97315FDCFA39411CA2CEA 1C37FBAC04509CD000000102 CB85A3B50BB6EDC300FCCB7B 1C37FAAC04509CD000000102 1C37FABC05509CD000000102 PBXSmartGroupTreeModuleOutlineStateSelectionKey 25 21 20 PBXSmartGroupTreeModuleOutlineStateVisibleRectKey {{0, 0}, {186, 799}} PBXTopSmartGroupGIDs XCIncludePerspectivesSwitch XCSharingToken com.apple.Xcode.GFSharingToken GeometryConfiguration Frame {{0, 0}, {203, 817}} GroupTreeTableConfiguration MainColumn 186 RubberWindowFrame 92 165 1156 858 0 0 1680 1028 Module PBXSmartGroupTreeModule Proportion 203pt Dock BecomeActive ContentConfiguration PBXProjectModuleGUID 1CE0B20306471E060097A5F4 PBXProjectModuleLabel bumprace.c PBXSplitModuleInNavigatorKey Split0 PBXProjectModuleGUID 1CE0B20406471E060097A5F4 PBXProjectModuleLabel bumprace.c _historyCapacity 0 bookmark CB85A3B70BB6EDC400FCCB7B history CBF14A630886CB82002B0459 CBF14A650886CB82002B0459 CBF14A670886CB82002B0459 CB94D1B80887D8BB0003B92F CB94D1BA0887D8BB0003B92F CB2C26370B31A39A00ACAC1F CB2C26380B31A39A00ACAC1F CB2C26390B31A39A00ACAC1F CB0070830B7F5E850009A74B CB0070840B7F5E850009A74B CB85A3B60BB6EDC400FCCB7B prevStack CB06E93C086BFC96001241D7 CB06EA6D086C1628001241D7 CBF14A4E0886C78C002B0459 CBF14A690886CB82002B0459 CBF14A6C0886CB82002B0459 CB94D1BE0887D8BB0003B92F CB94D1C00887D8BB0003B92F CB94D3C80887E4570003B92F CBB512EB088CFAB100A155B8 CB2C25F50B31942700ACAC1F CB2C263F0B31A39A00ACAC1F SplitCount 1 StatusBarVisibility GeometryConfiguration Frame {{0, 0}, {948, 676}} RubberWindowFrame 92 165 1156 858 0 0 1680 1028 Module PBXNavigatorGroup Proportion 676pt ContentConfiguration PBXProjectModuleGUID 1CE0B20506471E060097A5F4 PBXProjectModuleLabel Detail GeometryConfiguration Frame {{0, 681}, {948, 136}} RubberWindowFrame 92 165 1156 858 0 0 1680 1028 Module XCDetailModule Proportion 136pt Proportion 948pt Name Project ServiceClasses XCModuleDock PBXSmartGroupTreeModule XCModuleDock PBXNavigatorGroup XCDetailModule TableOfContents CB85A3B80BB6EDC400FCCB7B 1CE0B1FE06471DED0097A5F4 CB85A3B90BB6EDC400FCCB7B 1CE0B20306471E060097A5F4 1CE0B20506471E060097A5F4 ToolbarConfiguration xcode.toolbar.config.default ControllerClassBaseName IconName WindowOfProject Identifier perspective.morph IsVertical 0 Layout BecomeActive 1 ContentConfiguration PBXBottomSmartGroupGIDs 1C37FBAC04509CD000000102 1C37FAAC04509CD000000102 1C08E77C0454961000C914BD 1C37FABC05509CD000000102 1C37FABC05539CD112110102 E2644B35053B69B200211256 1C37FABC04509CD000100104 1CC0EA4004350EF90044410B 1CC0EA4004350EF90041110B PBXProjectModuleGUID 11E0B1FE06471DED0097A5F4 PBXProjectModuleLabel Files PBXProjectStructureProvided yes PBXSmartGroupTreeModuleColumnData PBXSmartGroupTreeModuleColumnWidthsKey 186 PBXSmartGroupTreeModuleColumnsKey_v4 MainColumn PBXSmartGroupTreeModuleOutlineStateKey_v7 PBXSmartGroupTreeModuleOutlineStateExpansionKey 29B97314FDCFA39411CA2CEA 1C37FABC05509CD000000102 PBXSmartGroupTreeModuleOutlineStateSelectionKey 0 PBXSmartGroupTreeModuleOutlineStateVisibleRectKey {{0, 0}, {186, 337}} PBXTopSmartGroupGIDs XCIncludePerspectivesSwitch 1 XCSharingToken com.apple.Xcode.GFSharingToken GeometryConfiguration Frame {{0, 0}, {203, 355}} GroupTreeTableConfiguration MainColumn 186 RubberWindowFrame 373 269 690 397 0 0 1440 878 Module PBXSmartGroupTreeModule Proportion 100% Name Morph PreferredWidth 300 ServiceClasses XCModuleDock PBXSmartGroupTreeModule TableOfContents 11E0B1FE06471DED0097A5F4 ToolbarConfiguration xcode.toolbar.config.default.short PerspectivesBarVisible ShelfIsVisible SourceDescription file at '/System/Library/PrivateFrameworks/DevToolsInterface.framework/Versions/A/Resources/XCPerspectivesSpecificationMode1.xcperspec' StatusbarIsVisible TimeStamp 0.0 ToolbarDisplayMode 1 ToolbarIsVisible ToolbarSizeMode 1 Type Perspectives UpdateMessage The Default Workspace in this version of Xcode now includes support to hide and show the detail view (what has been referred to as the "Metro-Morph" feature). You must discard your current Default Workspace settings and update to the latest Default Workspace in order to gain this feature. Do you wish to update to the latest Workspace defaults for project '%@'? WindowJustification 5 WindowOrderList 1C0AD2B3069F1EA900FABCE6 /Users/karl/code/mygames/bumprace/macosx/bumprace.xcodeproj WindowString 92 165 1156 858 0 0 1680 1028 WindowTools FirstTimeWindowDisplayed Identifier windowTool.build IsVertical Layout Dock ContentConfiguration PBXProjectModuleGUID 1CD0528F0623707200166675 PBXProjectModuleLabel StatusBarVisibility GeometryConfiguration Frame {{0, 0}, {874, 283}} RubberWindowFrame 139 206 874 750 0 0 1680 1028 Module PBXNavigatorGroup Proportion 283pt BecomeActive ContentConfiguration PBXBuildLogShowsTranscriptDefaultKey {{0, 97}, {874, 324}} PBXProjectModuleGUID XCMainBuildResultsModuleGUID PBXProjectModuleLabel Build XCBuildResultsTrigger_Collapse 1021 XCBuildResultsTrigger_Open 1011 GeometryConfiguration Frame {{0, 288}, {874, 421}} RubberWindowFrame 139 206 874 750 0 0 1680 1028 Module PBXBuildResultsModule Proportion 421pt Proportion 709pt Name Build Results ServiceClasses PBXBuildResultsModule StatusbarIsVisible TableOfContents CB06EA77086C166C001241D7 CB2C260C0B319C9A00ACAC1F 1CD0528F0623707200166675 XCMainBuildResultsModuleGUID ToolbarConfiguration xcode.toolbar.config.build WindowString 139 206 874 750 0 0 1680 1028 WindowToolGUID CB06EA77086C166C001241D7 WindowToolIsVisible Identifier windowTool.debugger Layout Dock ContentConfiguration Debugger HorizontalSplitView _collapsingFrameDimension 0.0 _indexOfCollapsedView 0 _percentageOfCollapsedView 0.0 isCollapsed yes sizes {{0, 0}, {317, 164}} {{317, 0}, {377, 164}} VerticalSplitView _collapsingFrameDimension 0.0 _indexOfCollapsedView 0 _percentageOfCollapsedView 0.0 isCollapsed yes sizes {{0, 0}, {694, 164}} {{0, 164}, {694, 216}} LauncherConfigVersion 8 PBXProjectModuleGUID 1C162984064C10D400B95A72 PBXProjectModuleLabel Debug - GLUTExamples (Underwater) GeometryConfiguration DebugConsoleDrawerSize {100, 120} DebugConsoleVisible None DebugConsoleWindowFrame {{200, 200}, {500, 300}} DebugSTDIOWindowFrame {{200, 200}, {500, 300}} Frame {{0, 0}, {694, 380}} RubberWindowFrame 321 238 694 422 0 0 1440 878 Module PBXDebugSessionModule Proportion 100% Proportion 100% Name Debugger ServiceClasses PBXDebugSessionModule StatusbarIsVisible 1 TableOfContents 1CD10A99069EF8BA00B06720 1C0AD2AB069F1E9B00FABCE6 1C162984064C10D400B95A72 1C0AD2AC069F1E9B00FABCE6 ToolbarConfiguration xcode.toolbar.config.debug WindowString 321 238 694 422 0 0 1440 878 WindowToolGUID 1CD10A99069EF8BA00B06720 WindowToolIsVisible 0 FirstTimeWindowDisplayed Identifier windowTool.find IsVertical Layout Dock Dock BecomeActive ContentConfiguration PBXProjectModuleGUID 1CDD528C0622207200134675 PBXProjectModuleLabel options.c StatusBarVisibility GeometryConfiguration Frame {{0, 0}, {928, 444}} RubberWindowFrame 139 211 928 745 0 0 1680 1028 Module PBXNavigatorGroup Proportion 928pt Proportion 444pt ContentConfiguration PBXProjectModuleGUID 1CD0528E0623707200166675 PBXProjectModuleLabel Project Find GeometryConfiguration Frame {{0, 449}, {928, 255}} RubberWindowFrame 139 211 928 745 0 0 1680 1028 Module PBXProjectFindModule Proportion 255pt Proportion 704pt Name Project Find ServiceClasses PBXProjectFindModule StatusbarIsVisible TableOfContents 1C530D57069F1CE1000CFCEE CB94D1B40887D8A50003B92F CB94D1B50887D8A50003B92F 1CDD528C0622207200134675 1CD0528E0623707200166675 WindowString 139 211 928 745 0 0 1680 1028 WindowToolGUID 1C530D57069F1CE1000CFCEE WindowToolIsVisible Identifier MENUSEPARATOR Identifier windowTool.debuggerConsole Layout Dock BecomeActive 1 ContentConfiguration PBXProjectModuleGUID 1C78EAAC065D492600B07095 PBXProjectModuleLabel Debugger Console GeometryConfiguration Frame {{0, 0}, {440, 358}} RubberWindowFrame 650 41 440 400 0 0 1280 1002 Module PBXDebugCLIModule Proportion 358pt Proportion 358pt Name Debugger Console ServiceClasses PBXDebugCLIModule StatusbarIsVisible 1 TableOfContents 1C78EAAD065D492600B07095 1C78EAAE065D492600B07095 1C78EAAC065D492600B07095 WindowString 650 41 440 400 0 0 1280 1002 FirstTimeWindowDisplayed Identifier windowTool.run IsVertical Layout Dock ContentConfiguration LauncherConfigVersion 3 PBXProjectModuleGUID 1CD0528B0623707200166675 PBXProjectModuleLabel Run Runner HorizontalSplitView _collapsingFrameDimension 0.0 _indexOfCollapsedView 0 _percentageOfCollapsedView 0.0 isCollapsed yes sizes {{0, 0}, {491, 168}} {{0, 173}, {491, 270}} VerticalSplitView _collapsingFrameDimension 0.0 _indexOfCollapsedView 0 _percentageOfCollapsedView 0.0 isCollapsed yes sizes {{0, 0}, {406, 443}} {{411, 0}, {517, 443}} GeometryConfiguration Frame {{0, 0}, {459, 159}} RubberWindowFrame 81 58 459 200 0 0 1680 1028 Module PBXRunSessionModule Proportion 159pt Proportion 159pt Name Run Log ServiceClasses PBXRunSessionModule StatusbarIsVisible TableOfContents 1C0AD2B3069F1EA900FABCE6 CB85A3BA0BB6EDC400FCCB7B 1CD0528B0623707200166675 CB85A3BB0BB6EDC400FCCB7B ToolbarConfiguration xcode.toolbar.config.run WindowString 81 58 459 200 0 0 1680 1028 WindowToolGUID 1C0AD2B3069F1EA900FABCE6 WindowToolIsVisible Identifier windowTool.scm Layout Dock ContentConfiguration PBXProjectModuleGUID 1C78EAB2065D492600B07095 PBXProjectModuleLabel <No Editor> PBXSplitModuleInNavigatorKey Split0 PBXProjectModuleGUID 1C78EAB3065D492600B07095 SplitCount 1 StatusBarVisibility 1 GeometryConfiguration Frame {{0, 0}, {452, 0}} RubberWindowFrame 743 379 452 308 0 0 1280 1002 Module PBXNavigatorGroup Proportion 0pt BecomeActive 1 ContentConfiguration PBXProjectModuleGUID 1CD052920623707200166675 PBXProjectModuleLabel SCM GeometryConfiguration ConsoleFrame {{0, 259}, {452, 0}} Frame {{0, 7}, {452, 259}} RubberWindowFrame 743 379 452 308 0 0 1280 1002 TableConfiguration Status 30 FileName 199 Path 197.09500122070312 TableFrame {{0, 0}, {452, 250}} Module PBXCVSModule Proportion 262pt Proportion 266pt Name SCM ServiceClasses PBXCVSModule StatusbarIsVisible 1 TableOfContents 1C78EAB4065D492600B07095 1C78EAB5065D492600B07095 1C78EAB2065D492600B07095 1CD052920623707200166675 ToolbarConfiguration xcode.toolbar.config.scm WindowString 743 379 452 308 0 0 1280 1002 Identifier windowTool.breakpoints IsVertical 0 Layout Dock BecomeActive 1 ContentConfiguration PBXBottomSmartGroupGIDs 1C77FABC04509CD000000102 PBXProjectModuleGUID 1CE0B1FE06471DED0097A5F4 PBXProjectModuleLabel Files PBXProjectStructureProvided no PBXSmartGroupTreeModuleColumnData PBXSmartGroupTreeModuleColumnWidthsKey 168 PBXSmartGroupTreeModuleColumnsKey_v4 MainColumn PBXSmartGroupTreeModuleOutlineStateKey_v7 PBXSmartGroupTreeModuleOutlineStateExpansionKey 1C77FABC04509CD000000102 PBXSmartGroupTreeModuleOutlineStateSelectionKey 0 PBXSmartGroupTreeModuleOutlineStateVisibleRectKey {{0, 0}, {168, 350}} PBXTopSmartGroupGIDs XCIncludePerspectivesSwitch 0 GeometryConfiguration Frame {{0, 0}, {185, 368}} GroupTreeTableConfiguration MainColumn 168 RubberWindowFrame 315 424 744 409 0 0 1440 878 Module PBXSmartGroupTreeModule Proportion 185pt ContentConfiguration PBXProjectModuleGUID 1CA1AED706398EBD00589147 PBXProjectModuleLabel Detail GeometryConfiguration Frame {{190, 0}, {554, 368}} RubberWindowFrame 315 424 744 409 0 0 1440 878 Module XCDetailModule Proportion 554pt Proportion 368pt MajorVersion 2 MinorVersion 0 Name Breakpoints ServiceClasses PBXSmartGroupTreeModule XCDetailModule StatusbarIsVisible 1 TableOfContents 1CDDB66807F98D9800BB5817 1CDDB66907F98D9800BB5817 1CE0B1FE06471DED0097A5F4 1CA1AED706398EBD00589147 ToolbarConfiguration xcode.toolbar.config.breakpoints WindowString 315 424 744 409 0 0 1440 878 WindowToolGUID 1CDDB66807F98D9800BB5817 WindowToolIsVisible 1 Identifier windowTool.debugAnimator Layout Dock Module PBXNavigatorGroup Proportion 100% Proportion 100% Name Debug Visualizer ServiceClasses PBXNavigatorGroup StatusbarIsVisible 1 ToolbarConfiguration xcode.toolbar.config.debugAnimator WindowString 100 100 700 500 0 0 1280 1002 Identifier windowTool.bookmarks Layout Dock Module PBXBookmarksModule Proportion 100% Proportion 100% Name Bookmarks ServiceClasses PBXBookmarksModule StatusbarIsVisible 0 WindowString 538 42 401 187 0 0 1280 1002 Identifier windowTool.classBrowser Layout Dock BecomeActive 1 ContentConfiguration OptionsSetName Hierarchy, all classes PBXProjectModuleGUID 1CA6456E063B45B4001379D8 PBXProjectModuleLabel Class Browser - NSObject GeometryConfiguration ClassesFrame {{0, 0}, {374, 96}} ClassesTreeTableConfiguration PBXClassNameColumnIdentifier 208 PBXClassBookColumnIdentifier 22 Frame {{0, 0}, {630, 331}} MembersFrame {{0, 105}, {374, 395}} MembersTreeTableConfiguration PBXMemberTypeIconColumnIdentifier 22 PBXMemberNameColumnIdentifier 216 PBXMemberTypeColumnIdentifier 97 PBXMemberBookColumnIdentifier 22 PBXModuleWindowStatusBarHidden2 1 RubberWindowFrame 385 179 630 352 0 0 1440 878 Module PBXClassBrowserModule Proportion 332pt Proportion 332pt Name Class Browser ServiceClasses PBXClassBrowserModule StatusbarIsVisible 0 TableOfContents 1C0AD2AF069F1E9B00FABCE6 1C0AD2B0069F1E9B00FABCE6 1CA6456E063B45B4001379D8 ToolbarConfiguration xcode.toolbar.config.classbrowser WindowString 385 179 630 352 0 0 1440 878 WindowToolGUID 1C0AD2AF069F1E9B00FABCE6 WindowToolIsVisible 0 bumprace-1.5.4/macosx/bumprace.xcodeproj/project.pbxproj0000755000175000017500000005151711217461066020420 00000000000000// !$*UTF8*$! { archiveVersion = 1; classes = { }; objectVersion = 42; objects = { /* Begin PBXApplicationTarget section */ 29B97326FDCFA39411CA2CEA /* BumpRace */ = { isa = PBXApplicationTarget; buildConfigurationList = CB06E926086BFC0F001241D7 /* Build configuration list for PBXApplicationTarget "BumpRace" */; buildPhases = ( 29B97327FDCFA39411CA2CEA /* Headers */, 29B97328FDCFA39411CA2CEA /* Resources */, 29B9732BFDCFA39411CA2CEA /* Sources */, 29B9732DFDCFA39411CA2CEA /* Frameworks */, CBCCF5AA07E1DA0D00E580F0 /* CopyFiles */, ); dependencies = ( ); name = BumpRace; productInstallPath = "$(HOME)/Applications"; productName = bumprace; productReference = 17587328FF379C6511CA2CBB /* BumpRace.app */; productSettingsXML = " CFBundleDevelopmentRegion English CFBundleIconFile bumprace CFBundleInfoDictionaryVersion 6.0 CFBundlePackageType APPL CFBundleSignature ???? CFBundleVersion 0.1 NSMainNibFile SDLMain.nib NSPrincipalClass SDLApplication bumprace SDL Cocoa App "; }; /* End PBXApplicationTarget section */ /* Begin PBXBuildFile section */ 089C165EFE840E0CC02AAC07 /* InfoPlist.strings in Resources */ = {isa = PBXBuildFile; fileRef = 089C165CFE840E0CC02AAC07 /* InfoPlist.strings */; }; 1058C7A3FEA54F0111CA2CBB /* Cocoa.framework in Frameworks */ = {isa = PBXBuildFile; fileRef = 1058C7A1FEA54F0111CA2CBB /* Cocoa.framework */; }; B2F367C604C7ADC700A80002 /* SDLMain.nib in Resources */ = {isa = PBXBuildFile; fileRef = B2F367C504C7ADC700A80002 /* SDLMain.nib */; }; CB06EA62086C159B001241D7 /* levels2.h in Headers */ = {isa = PBXBuildFile; fileRef = CB06EA61086C159B001241D7 /* levels2.h */; }; CB2E0CC207315282001B8137 /* data in Resources */ = {isa = PBXBuildFile; fileRef = CB2E0C2107315282001B8137 /* data */; }; CBA4B2070731431B003EC668 /* bumprace.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B1FA0731431B003EC668 /* bumprace.c */; }; CBA4B2080731431B003EC668 /* bumprace.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B1FB0731431B003EC668 /* bumprace.h */; }; CBA4B2090731431B003EC668 /* font.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B1FC0731431B003EC668 /* font.c */; }; CBA4B20A0731431B003EC668 /* font.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B1FD0731431B003EC668 /* font.h */; }; CBA4B20B0731431B003EC668 /* gfx.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B1FE0731431B003EC668 /* gfx.c */; }; CBA4B20C0731431B003EC668 /* gfx.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B1FF0731431B003EC668 /* gfx.h */; }; CBA4B20D0731431B003EC668 /* levels.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B2000731431B003EC668 /* levels.h */; }; CBA4B20E0731431B003EC668 /* menu.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B2010731431B003EC668 /* menu.c */; }; CBA4B20F0731431B003EC668 /* menu.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B2020731431B003EC668 /* menu.h */; }; CBA4B2100731431B003EC668 /* options.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B2030731431B003EC668 /* options.c */; }; CBA4B2110731431B003EC668 /* options.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B2040731431B003EC668 /* options.h */; }; CBA4B2120731431B003EC668 /* particles.c in Sources */ = {isa = PBXBuildFile; fileRef = CBA4B2050731431B003EC668 /* particles.c */; }; CBA4B2130731431B003EC668 /* particles.h in Headers */ = {isa = PBXBuildFile; fileRef = CBA4B2060731431B003EC668 /* particles.h */; }; CBCCF5B607E1DA6200E580F0 /* SDL_image.framework in Frameworks */ = {isa = PBXBuildFile; fileRef = CBCCF5B307E1DA6200E580F0 /* SDL_image.framework */; }; CBCCF5B707E1DA6200E580F0 /* SDL_mixer.framework in Frameworks */ = {isa = PBXBuildFile; fileRef = CBCCF5B407E1DA6200E580F0 /* SDL_mixer.framework */; }; CBCCF5B807E1DA6200E580F0 /* SDL.framework in Frameworks */ = {isa = PBXBuildFile; fileRef = CBCCF5B507E1DA6200E580F0 /* SDL.framework */; }; CBCCF65207E1DA8800E580F0 /* SDL_image.framework in CopyFiles */ = {isa = PBXBuildFile; fileRef = CBCCF5B307E1DA6200E580F0 /* SDL_image.framework */; }; CBCCF65307E1DA8800E580F0 /* SDL_mixer.framework in CopyFiles */ = {isa = PBXBuildFile; fileRef = CBCCF5B407E1DA6200E580F0 /* SDL_mixer.framework */; }; CBCCF65407E1DA8800E580F0 /* SDL.framework in CopyFiles */ = {isa = PBXBuildFile; fileRef = CBCCF5B507E1DA6200E580F0 /* SDL.framework */; }; CBCCF67607E1E21D00E580F0 /* bumprace.icns in Resources */ = {isa = PBXBuildFile; fileRef = CBCCF67507E1E21D00E580F0 /* bumprace.icns */; }; F5A47AA101A0483001D3D55B /* SDLMain.h in Headers */ = {isa = PBXBuildFile; fileRef = F5A47A9D01A0482F01D3D55B /* SDLMain.h */; }; F5A47AA301A0483001D3D55B /* SDLMain.m in Sources */ = {isa = PBXBuildFile; fileRef = F5A47A9E01A0483001D3D55B /* SDLMain.m */; }; /* End PBXBuildFile section */ /* Begin PBXCopyFilesBuildPhase section */ CBCCF5AA07E1DA0D00E580F0 /* CopyFiles */ = { isa = PBXCopyFilesBuildPhase; buildActionMask = 2147483647; dstPath = ""; dstSubfolderSpec = 10; files = ( CBCCF65207E1DA8800E580F0 /* SDL_image.framework in CopyFiles */, CBCCF65307E1DA8800E580F0 /* SDL_mixer.framework in CopyFiles */, CBCCF65407E1DA8800E580F0 /* SDL.framework in CopyFiles */, ); runOnlyForDeploymentPostprocessing = 0; }; /* End PBXCopyFilesBuildPhase section */ /* Begin PBXFileReference section */ 089C165DFE840E0CC02AAC07 /* English */ = {isa = PBXFileReference; fileEncoding = 10; lastKnownFileType = text.plist.strings; name = English; path = English.lproj/InfoPlist.strings; sourceTree = ""; }; 1058C7A1FEA54F0111CA2CBB /* Cocoa.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = Cocoa.framework; path = /System/Library/Frameworks/Cocoa.framework; sourceTree = ""; }; 17587328FF379C6511CA2CBB /* BumpRace.app */ = {isa = PBXFileReference; explicitFileType = wrapper.application; path = BumpRace.app; sourceTree = BUILT_PRODUCTS_DIR; }; 29B97324FDCFA39411CA2CEA /* AppKit.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = AppKit.framework; path = /System/Library/Frameworks/AppKit.framework; sourceTree = ""; }; 29B97325FDCFA39411CA2CEA /* Foundation.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = Foundation.framework; path = /System/Library/Frameworks/Foundation.framework; sourceTree = ""; }; B2F367C504C7ADC700A80002 /* SDLMain.nib */ = {isa = PBXFileReference; lastKnownFileType = wrapper.nib; path = SDLMain.nib; sourceTree = ""; }; CB06EA61086C159B001241D7 /* levels2.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = levels2.h; path = ../src/levels2.h; sourceTree = SOURCE_ROOT; }; CB2E0C2107315282001B8137 /* data */ = {isa = PBXFileReference; lastKnownFileType = folder; name = data; path = ../data; sourceTree = SOURCE_ROOT; }; CBA4B1FA0731431B003EC668 /* bumprace.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = bumprace.c; path = ../src/bumprace.c; sourceTree = SOURCE_ROOT; }; CBA4B1FB0731431B003EC668 /* bumprace.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = bumprace.h; path = ../src/bumprace.h; sourceTree = SOURCE_ROOT; }; CBA4B1FC0731431B003EC668 /* font.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = font.c; path = ../src/font.c; sourceTree = SOURCE_ROOT; }; CBA4B1FD0731431B003EC668 /* font.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = font.h; path = ../src/font.h; sourceTree = SOURCE_ROOT; }; CBA4B1FE0731431B003EC668 /* gfx.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = gfx.c; path = ../src/gfx.c; sourceTree = SOURCE_ROOT; }; CBA4B1FF0731431B003EC668 /* gfx.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = gfx.h; path = ../src/gfx.h; sourceTree = SOURCE_ROOT; }; CBA4B2000731431B003EC668 /* levels.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = levels.h; path = ../src/levels.h; sourceTree = SOURCE_ROOT; }; CBA4B2010731431B003EC668 /* menu.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = menu.c; path = ../src/menu.c; sourceTree = SOURCE_ROOT; }; CBA4B2020731431B003EC668 /* menu.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = menu.h; path = ../src/menu.h; sourceTree = SOURCE_ROOT; }; CBA4B2030731431B003EC668 /* options.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = options.c; path = ../src/options.c; sourceTree = SOURCE_ROOT; }; CBA4B2040731431B003EC668 /* options.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = options.h; path = ../src/options.h; sourceTree = SOURCE_ROOT; }; CBA4B2050731431B003EC668 /* particles.c */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.c; name = particles.c; path = ../src/particles.c; sourceTree = SOURCE_ROOT; }; CBA4B2060731431B003EC668 /* particles.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; name = particles.h; path = ../src/particles.h; sourceTree = SOURCE_ROOT; }; CBCCF5B307E1DA6200E580F0 /* SDL_image.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = SDL_image.framework; path = /Library/Frameworks/SDL_image.framework; sourceTree = ""; }; CBCCF5B407E1DA6200E580F0 /* SDL_mixer.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = SDL_mixer.framework; path = /Library/Frameworks/SDL_mixer.framework; sourceTree = ""; }; CBCCF5B507E1DA6200E580F0 /* SDL.framework */ = {isa = PBXFileReference; lastKnownFileType = wrapper.framework; name = SDL.framework; path = /Library/Frameworks/SDL.framework; sourceTree = ""; }; CBCCF67507E1E21D00E580F0 /* bumprace.icns */ = {isa = PBXFileReference; lastKnownFileType = image.icns; path = bumprace.icns; sourceTree = SOURCE_ROOT; }; F5A47A9D01A0482F01D3D55B /* SDLMain.h */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.h; path = SDLMain.h; sourceTree = SOURCE_ROOT; }; F5A47A9E01A0483001D3D55B /* SDLMain.m */ = {isa = PBXFileReference; fileEncoding = 30; lastKnownFileType = sourcecode.c.objc; path = SDLMain.m; sourceTree = SOURCE_ROOT; }; /* End PBXFileReference section */ /* Begin PBXFrameworksBuildPhase section */ 29B9732DFDCFA39411CA2CEA /* Frameworks */ = { isa = PBXFrameworksBuildPhase; buildActionMask = 2147483647; files = ( 1058C7A3FEA54F0111CA2CBB /* Cocoa.framework in Frameworks */, CBCCF5B607E1DA6200E580F0 /* SDL_image.framework in Frameworks */, CBCCF5B707E1DA6200E580F0 /* SDL_mixer.framework in Frameworks */, CBCCF5B807E1DA6200E580F0 /* SDL.framework in Frameworks */, ); runOnlyForDeploymentPostprocessing = 0; }; /* End PBXFrameworksBuildPhase section */ /* Begin PBXGroup section */ 080E96DDFE201D6D7F000001 /* Classes */ = { isa = PBXGroup; children = ( F5A47A9D01A0482F01D3D55B /* SDLMain.h */, F5A47A9E01A0483001D3D55B /* SDLMain.m */, ); name = Classes; sourceTree = ""; }; 1058C7A0FEA54F0111CA2CBB /* Linked Frameworks */ = { isa = PBXGroup; children = ( 1058C7A1FEA54F0111CA2CBB /* Cocoa.framework */, ); name = "Linked Frameworks"; sourceTree = ""; }; 1058C7A2FEA54F0111CA2CBB /* Other Frameworks */ = { isa = PBXGroup; children = ( 29B97325FDCFA39411CA2CEA /* Foundation.framework */, 29B97324FDCFA39411CA2CEA /* AppKit.framework */, ); name = "Other Frameworks"; sourceTree = ""; }; 19C28FACFE9D520D11CA2CBB /* Products */ = { isa = PBXGroup; children = ( 17587328FF379C6511CA2CBB /* BumpRace.app */, ); name = Products; sourceTree = ""; }; 29B97314FDCFA39411CA2CEA /* bumprace */ = { isa = PBXGroup; children = ( 080E96DDFE201D6D7F000001 /* Classes */, 29B97315FDCFA39411CA2CEA /* Other Sources */, 29B97317FDCFA39411CA2CEA /* Resources */, 29B97323FDCFA39411CA2CEA /* Frameworks */, 19C28FACFE9D520D11CA2CBB /* Products */, ); name = bumprace; sourceTree = ""; }; 29B97315FDCFA39411CA2CEA /* Other Sources */ = { isa = PBXGroup; children = ( CBA4B1FA0731431B003EC668 /* bumprace.c */, CBA4B1FB0731431B003EC668 /* bumprace.h */, CBA4B1FC0731431B003EC668 /* font.c */, CBA4B1FD0731431B003EC668 /* font.h */, CBA4B1FE0731431B003EC668 /* gfx.c */, CBA4B1FF0731431B003EC668 /* gfx.h */, CBA4B2000731431B003EC668 /* levels.h */, CB06EA61086C159B001241D7 /* levels2.h */, CBA4B2010731431B003EC668 /* menu.c */, CBA4B2020731431B003EC668 /* menu.h */, CBA4B2030731431B003EC668 /* options.c */, CBA4B2040731431B003EC668 /* options.h */, CBA4B2050731431B003EC668 /* particles.c */, CBA4B2060731431B003EC668 /* particles.h */, ); name = "Other Sources"; sourceTree = ""; }; 29B97317FDCFA39411CA2CEA /* Resources */ = { isa = PBXGroup; children = ( CBCCF67507E1E21D00E580F0 /* bumprace.icns */, CB2E0C2107315282001B8137 /* data */, 089C165CFE840E0CC02AAC07 /* InfoPlist.strings */, B2F367C504C7ADC700A80002 /* SDLMain.nib */, ); name = Resources; sourceTree = ""; }; 29B97323FDCFA39411CA2CEA /* Frameworks */ = { isa = PBXGroup; children = ( 1058C7A0FEA54F0111CA2CBB /* Linked Frameworks */, 1058C7A2FEA54F0111CA2CBB /* Other Frameworks */, CBCCF5B307E1DA6200E580F0 /* SDL_image.framework */, CBCCF5B407E1DA6200E580F0 /* SDL_mixer.framework */, CBCCF5B507E1DA6200E580F0 /* SDL.framework */, ); name = Frameworks; sourceTree = ""; }; /* End PBXGroup section */ /* Begin PBXHeadersBuildPhase section */ 29B97327FDCFA39411CA2CEA /* Headers */ = { isa = PBXHeadersBuildPhase; buildActionMask = 2147483647; files = ( F5A47AA101A0483001D3D55B /* SDLMain.h in Headers */, CBA4B2080731431B003EC668 /* bumprace.h in Headers */, CBA4B20A0731431B003EC668 /* font.h in Headers */, CBA4B20C0731431B003EC668 /* gfx.h in Headers */, CBA4B20D0731431B003EC668 /* levels.h in Headers */, CBA4B20F0731431B003EC668 /* menu.h in Headers */, CBA4B2110731431B003EC668 /* options.h in Headers */, CBA4B2130731431B003EC668 /* particles.h in Headers */, CB06EA62086C159B001241D7 /* levels2.h in Headers */, ); runOnlyForDeploymentPostprocessing = 0; }; /* End PBXHeadersBuildPhase section */ /* Begin PBXProject section */ 29B97313FDCFA39411CA2CEA /* Project object */ = { isa = PBXProject; buildConfigurationList = CB06E92A086BFC0F001241D7 /* Build configuration list for PBXProject "bumprace" */; compatibilityVersion = "Xcode 2.4"; hasScannedForEncodings = 1; mainGroup = 29B97314FDCFA39411CA2CEA /* bumprace */; projectDirPath = ""; projectRoot = ..; targets = ( 29B97326FDCFA39411CA2CEA /* BumpRace */, ); }; /* End PBXProject section */ /* Begin PBXResourcesBuildPhase section */ 29B97328FDCFA39411CA2CEA /* Resources */ = { isa = PBXResourcesBuildPhase; buildActionMask = 2147483647; files = ( 089C165EFE840E0CC02AAC07 /* InfoPlist.strings in Resources */, B2F367C604C7ADC700A80002 /* SDLMain.nib in Resources */, CB2E0CC207315282001B8137 /* data in Resources */, CBCCF67607E1E21D00E580F0 /* bumprace.icns in Resources */, ); runOnlyForDeploymentPostprocessing = 0; }; /* End PBXResourcesBuildPhase section */ /* Begin PBXSourcesBuildPhase section */ 29B9732BFDCFA39411CA2CEA /* Sources */ = { isa = PBXSourcesBuildPhase; buildActionMask = 2147483647; files = ( F5A47AA301A0483001D3D55B /* SDLMain.m in Sources */, CBA4B2070731431B003EC668 /* bumprace.c in Sources */, CBA4B2090731431B003EC668 /* font.c in Sources */, CBA4B20B0731431B003EC668 /* gfx.c in Sources */, CBA4B20E0731431B003EC668 /* menu.c in Sources */, CBA4B2100731431B003EC668 /* options.c in Sources */, CBA4B2120731431B003EC668 /* particles.c in Sources */, ); runOnlyForDeploymentPostprocessing = 0; }; /* End PBXSourcesBuildPhase section */ /* Begin PBXVariantGroup section */ 089C165CFE840E0CC02AAC07 /* InfoPlist.strings */ = { isa = PBXVariantGroup; children = ( 089C165DFE840E0CC02AAC07 /* English */, ); name = InfoPlist.strings; sourceTree = ""; }; /* End PBXVariantGroup section */ /* Begin XCBuildConfiguration section */ CB06E927086BFC0F001241D7 /* Development */ = { isa = XCBuildConfiguration; buildSettings = { COPY_PHASE_STRIP = NO; FRAMEWORK_SEARCH_PATHS = /Library/Frameworks; GCC_DYNAMIC_NO_PIC = NO; GCC_ENABLE_FIX_AND_CONTINUE = YES; GCC_GENERATE_DEBUGGING_SYMBOLS = YES; GCC_OPTIMIZATION_LEVEL = 0; HEADER_SEARCH_PATHS = ( /Library/Frameworks/SDL_image.framework/Headers, /Library/Frameworks/SDL_mixer.framework/Headers, /Library/Frameworks/SDL.framework/Headers, ); INSTALL_PATH = "$(HOME)/Applications"; LIBRARY_SEARCH_PATHS = ""; OTHER_CFLAGS = ( "-DSOUND", "-Wall", ); OTHER_LDFLAGS = ( "-framework", SDL, "-framework", SDL_image, "-framework", SDL_mixer, "-bind_at_load", ); PRODUCT_NAME = BumpRace; SECTORDER_FLAGS = ""; WARNING_CFLAGS = ( "-Wmost", "-Wno-four-char-constants", "-Wno-unknown-pragmas", ); WRAPPER_EXTENSION = app; ZERO_LINK = YES; }; name = Development; }; CB06E928086BFC0F001241D7 /* Deployment */ = { isa = XCBuildConfiguration; buildSettings = { COPY_PHASE_STRIP = YES; FRAMEWORK_SEARCH_PATHS = /Library/Frameworks; GCC_ENABLE_FIX_AND_CONTINUE = NO; HEADER_SEARCH_PATHS = ( /Library/Frameworks/SDL_image.framework/Headers, /Library/Frameworks/SDL_mixer.framework/Headers, /Library/Frameworks/SDL.framework/Headers, ); INSTALL_PATH = "$(HOME)/Applications"; LIBRARY_SEARCH_PATHS = ""; OTHER_CFLAGS = "-DSOUND"; OTHER_LDFLAGS = ( "-framework", SDL, "-framework", SDL_image, "-framework", SDL_mixer, "-bind_at_load", ); PRODUCT_NAME = BumpRace; SECTORDER_FLAGS = ""; WARNING_CFLAGS = ( "-Wmost", "-Wno-four-char-constants", "-Wno-unknown-pragmas", ); WRAPPER_EXTENSION = app; ZERO_LINK = NO; }; name = Deployment; }; CB06E929086BFC0F001241D7 /* Default */ = { isa = XCBuildConfiguration; buildSettings = { FRAMEWORK_SEARCH_PATHS = /Library/Frameworks; HEADER_SEARCH_PATHS = ( /Library/Frameworks/SDL_image.framework/Headers, /Library/Frameworks/SDL_mixer.framework/Headers, /Library/Frameworks/SDL.framework/Headers, ); INSTALL_PATH = "$(HOME)/Applications"; LIBRARY_SEARCH_PATHS = ""; OTHER_CFLAGS = "-DSOUND"; OTHER_LDFLAGS = ( "-framework", SDL, "-framework", SDL_image, "-framework", SDL_mixer, "-bind_at_load", ); PRODUCT_NAME = BumpRace; SECTORDER_FLAGS = ""; WARNING_CFLAGS = ( "-Wmost", "-Wno-four-char-constants", "-Wno-unknown-pragmas", ); WRAPPER_EXTENSION = app; }; name = Default; }; CB06E92B086BFC0F001241D7 /* Development */ = { isa = XCBuildConfiguration; buildSettings = { }; name = Development; }; CB06E92C086BFC0F001241D7 /* Deployment */ = { isa = XCBuildConfiguration; buildSettings = { }; name = Deployment; }; CB06E92D086BFC0F001241D7 /* Default */ = { isa = XCBuildConfiguration; buildSettings = { }; name = Default; }; /* End XCBuildConfiguration section */ /* Begin XCConfigurationList section */ CB06E926086BFC0F001241D7 /* Build configuration list for PBXApplicationTarget "BumpRace" */ = { isa = XCConfigurationList; buildConfigurations = ( CB06E927086BFC0F001241D7 /* Development */, CB06E928086BFC0F001241D7 /* Deployment */, CB06E929086BFC0F001241D7 /* Default */, ); defaultConfigurationIsVisible = 0; defaultConfigurationName = Default; }; CB06E92A086BFC0F001241D7 /* Build configuration list for PBXProject "bumprace" */ = { isa = XCConfigurationList; buildConfigurations = ( CB06E92B086BFC0F001241D7 /* Development */, CB06E92C086BFC0F001241D7 /* Deployment */, CB06E92D086BFC0F001241D7 /* Default */, ); defaultConfigurationIsVisible = 0; defaultConfigurationName = Default; }; /* End XCConfigurationList section */ }; rootObject = 29B97313FDCFA39411CA2CEA /* Project object */; } bumprace-1.5.4/macosx/bumprace.icns0000644000175000017500000014235711217461066014226 00000000000000icnsics#H????is32"    --*l8:;5 9AEHK  :O^c @p<% %% ft[UH?6,% fۀe_WKB71(# zwneXKC91.& UEfvj\LD<5&FLHB9& '  3I7P>cN$  $E:!   (%  $!  #*&"  "62+# /9/%!    !;0]KlR. Ym7 1aT2  00!  "  !'&!  30("  -6-$  s8mktЮt :;hiDDIIރ4UU4ICN#????????il32     #'%$# %+/,))' -2100/- 38797/  4:<=?@A@5  =DBEF<2   9BHIIJJLQU* 4LNPOOWnk   TVjĂU<& !'%  -iɉ^XTL:/-12/+'#  @{\[ZVQKGB>83.)'# "Ӊa_^ZVRKGB>+840,(%" ~ߐhca`\XRMHD@951/)($!Hmggeb]YRMHD@9730+(&# tѕommlgc_ZRNHDB;840/('%$ 9fqsqsplf_[SNIEB;8410,('! ?Ll~zuofb\TOHDB=:720.*! 3=f|}tjc[SOIDB<8830- 3Igrng]SOJEC>;84"  *:ITSOMIC>6(#%#         *(#  284,% 3@BA6-# ?JTaI4'@Pjc;*7Pe`;+BMOD6* ,=?91'  D  ").-(   !! !!   %$#  &&%#! &'$" )+'%#   "--./.*&%  /2232/*'%  1;974-*&   1?=6/+&  063.&" &#!      '$  .A>5,   +MUND8* Kcc`RC5%#]p{hM<, #_xW@/RzXB1 .dstbQ@/ ;WaVI:) D "0?@:-   $#   ""   # "  %&&##   ())'&#!  ,,--,'%# -001//*&# 07750+'$  0=:3-*%  040+% #!   l8mk4>>4\М\ MM((jj%%JJii~~T˕T/88/ich#H??????????ih32H          "$$!  !%)''&'&%""*0+*)('##*0//..-* '1233211/+ -17889776'  3899::==>>=<'    8@>>?ABABCAD+ 9@CDDEEDFEH1.=  3+%+-,,(&#!&Wvϖf[[XWSRI?76::640,*(#" `.dž_[\[YVSPLIFC@=844/,('#! Ԍc[]][YWSPKIGD@=9630,+(&#!! g'ܠk``__\[WUQLJFC?=:741/,)(&#! ,7qdcb`_^[XUPMJGDA?;8410,*(($" +ugffc``^[XUQNKGDB@:85310+('&$"  *Rxkihggdb_[YVPNKGDD@:87410-)(&&$!)punmllkggc_]ZVQOKGDDA;88420/,('&%$"'*vopononkge`^ZVROKGDDA<985300-*(&&%" %Q`nprprspojfa_\VROLGDDB=:86300/,(&&% %3CTswxxwuolgca]VROKGDDB>;88410/.+(& #,Fpzwsohda]VSPLGDCB=;88510/.,( @gzzwojfb[TRPMGDDA=8620/.$9Sk~{qlid[TSQMGDDB>:88741)&4Nbmoje\USPLHEBB?<9870  (09GTZTSROLHEC@=4* !)+0338950'             $+*'# $242/+&! "38;861+%  2>AA@=71+$ !=DGIMK@5.' $CHMWioT?2+# "BLRfmH5,$ 82*"     /9@?;4.'     $*052.)#   ! !!"#$%%" "  #! $%##"! #%#"!  #&%$"!   "'%#"!  &()('%##!  '+)'$#! *,,-,*'&$! -/./.*'&%" 33124430/+('%" $56751,+'&#   5>=:872.+*&"  1@@<72/-*&#  %3?;61/,&#! "-230-&#! %)%#"!            )00,'   7C?<60)  8MPKG@:1(2NWXUQIB;1%J^bb_ZQIA7-" '[hlnpm_PE;1& -cotv[KA5)+csy‘fOD8,"Yvz̘kQE:- KtxcQE:. 0dstwsfZOE9-  ?`llf\TKA4*    =Q`bYOF<1%    %0AJKF?4)    !!$).0-&  "  !"!!   !#"!  !#!    %$##"!  "'&'&#""  #()(''$#"  (,+,+'&##!  *.-../.-,(&$#   /0/011//.*'%#   !2456642/+''$! 2<;774/+*'%!  0=?870.+)% $3>92/+*%   ",00/*$   #&#"!     h8mk :FF:C辄Cԁ&σ&ss''&&--++ ccYY))vvFF,,TTjj nn nn nn 66 vv ppVVU~ݙ~Uit32Y                                      "    "#"!!     "%%$$##"!  "#"%(&&%%$&$##"!!  "!&%'(('&%&&% $$#"   "&('(())(('&%%&$ *,*,++**)('&# )0/+-.,,+**)(''$ &-00.-,+**)''#&.-.0.-,,-, ++**'!  '-+,/0/.- ,,+& ,0+-0 //..--( ,3/0021210 /.-$  371343443433221122100/*   +7134565655454455320/)  "3455687540'  "46345689;;:9875/#  /835566789;;< ;99;;:71  '567789:;;<<;<=>?<=<5    ,<689::8;;<>>?@AA@?>=@6     9;<<>>=;<<>>@A@ACCA@ADC9     1?;@?@ABACAB@ABCDCA@CDHG=   !%"      ;?@CDCDDCCDEFEEDEFHGGFFHIKE& #8FLIA/    '>>?CDEEFGHGH IIGGFHHJG* $8HMKF3%    5=@@DEFHGGH ILLIGFHHLE. !5GKIC1$    >@ADDFHFHIIJIIJLMLJHKILG0,BDFHHILNNONNMLMMSVWTOMNThJ      3BDFHIJLMNMNOOQPONOTWVSPTfzͼ^  3BEGIJLLNPNOPRQPPOQVSPZnҿbUDGIKLLNOPQPPOPOOPRQPPQRUaky3  GIJLLNNOPQSQRUY`c~ҁ Чk5 GJLNOPRRTTSRQQRSTRSWewځ̨wJ&   $GLNNPQRTUUTRQRTS]dlހϳP#  !!  AFOPPQR&SSTUUTSRRS]wǭ[7%  !##$"!  CFPRRSSTU VUZ`y܁fWJA4  #&%$#!   CJQSTU TT\mހĤeZSSOH9( $' &&%$"!!   GMRUVXWW\arނĬfZXVTSOKD5!  $'()((&&$##!! EQSUVWWV0WY\euȬk\\[YVTSSQJ>0()!  )-,))*))('%%$##!!  &OSUWWVW_ltͰn\\]\[XVUTUSOMJIB) "%-//../.,+*))(&%$$#"!  OSUWYZWWX_z0βn^YZ\\ZXWVUTSSRPOMA81+"")/36533010-,+**((&%$##"!  JRVXZ]bcl~дn^\[ZXWVVUSSRQPOLIGB<61/17:;::9875310-,+))(&%$##"!! ' FLTY_gԵq`]][ZYW VSRRQOOMJIGDA=<==<;:85443110-,,*))(&%#"!! EGVbz ѹn`_^^\[ZYWVSRRQOOMKJHECA??>?><;875432110-,+*)((%%#!! ESm Юg\[\][ ZZYWWVSRQQOOMKHFCCBAA@?>=<986543210.,,*))(&&%#"! " =<:876543210-,+*)((&&%##"!!  % ֲm^[YZ[\]][3ZYXWVSSRQOOMKKJIGGEDCBB@><<:986544200.,,*)(('&%$#""!  ۱o`^[][4ZZYWWTSRQOOMKKJIHGFFDBB@><<:9876543110-,+*)('&&%##"!!  ċnea_]\\^_^]\[4ZYWWTSRQONKKJIIGGFFDCA@><<::886544100.,,**)('&&%##"!!  C ¢reca_^]\[-ZYWVTSSRPNKJJIIGGFFDCA?><<;:985544100/.,+*))('&#! nʢiecb`a`__^][+ZYWVUSSRQNKJJIIGFEDDB@?><<;;986543120/.,,**)(&$#"!  9 Դugdcabba_^\[ZXWVVSPOKIIGFEDCB@@><<;;:8764200/.,,**))(('&%#""!! 'ٴxlfdb-``a``__^][[YXWVVSRPNMLKJIGFEDDB@@?>><<:97654210.-,**))(&&$#"!!  سvmgedca`_%][[ZXWVUSSPONMLKJHGEDCCBA@?><<:98764210.-,+*))('&&%##!  L܁ճvigedca__``aa__\[[ZXWVVSRPNNMMLJHGEDDCB?><<:9886441100//-,+)(&%#!!  (s زvjgffeda`_`a__\[[YXWWUSRPOONMLJHGEEDCBA=<;:9876542110/0/-+*('&%#"!  ? ඍumhggfeecb`a__\[ZXWUSRONMLJHGFFD BA=<:998875422100,*(''&$#"!  . Ôsnljhg fedccabba__][ZWWVSRPOONMLJHGFFED CA=<:99887642 1100-+)(('&$#"! 'pḖzlkjhgffddccbb`_^\[[YYWVSRPOONMLJIGFFD BA><:99887654210.+*)('&%##"! > ymkllkjiihg ffedcb`__][YXVSRPOONMLJHGEEDCA?<:99876422100/,+*(''& %#"!  " %Xܺxolkjigfecba__^][[YXWSRPOMMJHGEEDA?<<:9876432110/-,+)(('&%$"!"!  $lӭyronmlklkkjjigfcba__^\[XWSRQOMLJHGEEDB?<<:9876542110 ..,,*)((''&%$$# #! D⺒{qponmmlkjiigdc`_^][[XWSRQPOOMMJHGEDB?<<:99875421100//.-,+*)(''&% "!  ,bү{spqoonmnnmmlkjiihggeca_^][[XUSRQPOONMKHGFFEDBA=<<:9876431100//.--,+)((''&&% &$"   %l{rnoppxuononmlkjjihgfcaa__^\[[XVSRQPOMKIGFFDBA=<<:98665421100//.-,,*)(''& %%$=xtrnmoosrqonoppo nlkjjiggcaa_^\[XVSRQPPOOMKIGEEDBA?<<;:98866542110 //.-,+)(('& %%$"  F}wtomonoqpoopr poonmlkjhfcaa_^][XVSRQPPOOMKHGEDCA?=<<:987643110//.,,*((&%$#! :X_qpnoprqpqrsts roonmlkhfdcba_^[XVSRQPPOOMLHGEDCA?=<<:88776643110//.-,+)('& $#"! 4SWhqrrsttu"ttsrponmkhfdcbba`_^[XVSRQPPOOMLIGFFDCB@<:8754210.-,,*(('&&$"!!>PP]qstuvx%wwvuutsrpomkigfdcbb`_^[XVSRQPPOOMKIGEEDCB@=<<:99887654310..-,+)(''&#!  .EHE^tuuvwwy{#ywwvusrponligfeccbb`_[XWTSQQPOOMKJGEDCB@>=<<988765420. --,*(('&%$!  .=>Dbruvx{}#|zwwutsqookiggfdcbb`_[XWTSRQPOOMKHGEDCB@>=<<98654300/.-,,*((%# 0*$FH_w}}~~~}{ywvutspomjhgfdcaa__[XWTSRQPOOMLHGEDCB@?=<<98654300/. --,*('# "?Eg|$~}|zxwwvtronkiggdcaa_^[WUSSRQQOONLHGED CCBB@=<<::8654300/..--+(($!-"@Afv~~}||{|zzwvtpomjhgfdc`_][WTSSRQQPONLHGEDCBB?<<:99865430/ -,+(&##"?D?it}}|}~y}|ywuqolkhggfca_]XVSSRRQONLHGEEDBB@?<;8766540/0,,*'%=B>?h}~s}{xtronkjiggdc_]YWTSRQQONLJGEDBB@?<;9887665420/.()!+5,>ABfo~|wtpnmkjiigfc`\XWTSSRRQQOOLJGFFEDBB@@><:9876653100..,-,/@C>?io~zwsoomkkjiggda\XWUSRQQOOLJGED CBB@@=<::987665420.-*,!3<.@B7<\[`wtpmlggfc`\WUUSSRQQOOMKJHGFDDCBAA@?<:8 7667786+ (-$9715?XWV_okgea\WVUSSRRQOMMLKIGFFDDBABA@><:864696)! :59677226COR^ke]VTSRSRQONMMKKIGFEDBBA@?@><<:844/$ "30$!3054654?JGDMWUUTSSRPNMKIGFEDDBCB@@>>9*  (%9752/-.4;: ALNMLIIHFFC6*)(''%'! $31/*$%%$%&&$)1310.,)(&% &" (&'&&$'($#!!  $&#                                  "!  # $'&'&%%##!   !'++*('%"   ").//-++*)'%#!  %.1//.,++)'&$"! #%.04543210//.+*)'%#! %&.14687766321/.+*)'%#! %.25789775331/-+)'%"  !/3789;<;:877541/-+)'%#  '378<=?>=;;:87642.-+)&$#  #.7:<>@??<;;7652.,*(&#! " ,3:<@@ACDCB@?>=:8620.+)'%"  "5;=@ADDEFEECB@=;852.-*(%#   %:=@CDDEGHIIJJHGC>:621.+)'$!  $=@DDEEHKLPTTSSPJC?:620-+'%# #>CDFH KLPSY`edc]SJD>842.,)'%  *%@DEGHILLQV[dnwwrm`SIA:62/,*'%! *$@DGHILNPSZco}}k]ND=852.+(%"  *#GHJLOPTY`l|pcUG@;72/-+'%" ,$6DHHLMPTUY`ltwspdZNE?:62/-+'%" . #=GHJLPPQSV\agebWQJD=962/-+(&# 3. 9EHHLLNLOPSVXWSNJE@<863/-+(%!  38EEHIJJKLMNOKGDB>:852/,)'#!  U  ,=CGHIJLKIIGEC@>;8642/+)%#    +:CDFHGGFCC@=;97641.+'$!    ,%4=DEEFGEEDC@><:86420-)&#      ,$2=@ADDECCA@>;86420.+)%#      *  )05<@ABBA@?>;8640.,)'$"   "      $'+39<>?><:8520,*(%#    "!    ) !#$&).17<=>;:8640.+)'$!    "!  0  "$%&&(.5::95220-,*'%#     !!     !"$$%$%),-,++,+*)'%$! !   !! !"!! "%&'&&%#"  !   ! " "#"!  "  !"!      $!!  !"!   $#  "#"!  $!  #""!    !##%%$#"!!    !#$%#"!    $$%#"!     "#$$%$%#""!    !%%&&%$%#!    $%%&%##!"!      #$&%&%#"!!      $&'&'&$#"!"!    !$&'&%#"!     "%'(())'&&$#""   #%'(())('&&$#!     %'(()(()('&&$#"!  &'()*))*)''&&%$#!     &)(**+*+* )(''&&$$##"!    &+ **)''&&%%$##"  !&*,++**''&%%$#"   (),-,+)''&%%#"   %*,-.--,+)''&$#"  $+-./.--,+*''&#"    ",/.//./.-,+*(''&#"    !./010/.-+*)'&#"   3213210/023211/-++)'&#"   $7734234 33221//-,+*('&#"  %464434565 44320/.,++*('&&#"  )6554456676 5431/.-++*)('&#"  )75676 430.-,++**'&#"   *4567689:976630/.-,++**('%#" +7:;<;::987763//.-,,++*('%#!  !1=?=>==;:87641//.-,,++('%#!  "19@A@??>><;:87642//..-,++)'%#!  "3;BCA??<=;:76420//.--,+*'&#"!  !4DCD?=?<;765321//.-,+*'&#"!!  39DBB?=;865431/.-++'&#""!  &37CA?<8765321//.-+*'$#""!  &35B<9765421//.-+*'$#""!  1,?9764321/ ,+'#""!!  +'*875310//,+'$#"!!  '#&,431.,)&##"!!  #$+32*&%$#""!!    #!!'&%$#!    !                                     "%''&''%$!    &-.,.//*)'&$"   #-014320/-*'%!  $17>:8731/-*(&#   %2=FCB=;::987421.,)&#    !!2?HHGFEDC@@?98641/-)'" "!-=JLMLKHGFECA?>;851/-)&""+<863/+(%!(+:HJOQSTSQPOMKIFDA@=852/*'"  %';KLOSVXXWVTRROMJHEBA=962/*&!  0HLQWXZXWUSSQNJIFB><:61.)$  )@ORX[\]^\[YWTSQNJHDA=9741,'#  3DRX\_`aa`_\[WWTRNJFC?<962.*&!  ""@LX^`bdcc`^[ZWTQMIFB>;74/*'#  *GV_adhggee`_ZWSOJFDB>940,'%! /M_dehjkklmnhh`ZWQMJFCA=71.)'# +/Rfhhklmppruuxzywskd[TOKIFB@:2.*'#  +.Thhllnpsvx|wnbYQNJFDA<62.)%! ,1\hilpptvz|wm_UOLHEA=72/*'! -/Zhkppstx{qeXRNJFB>940+'#  .-Rgmprtuy~ǵxj]SPKGC@;62-(#  4+Mgmprtwy}ƪoaTPLHD@;62-(#  4";hmqtvxz}ЮpcVPLHEA;61-(# (*fmqtvxy}ʬqcXQLHEA<51-)$  ) \mquwxy|ʹ}maWQLHEA=71.)$  *!,3Vkptuxy|}xg\UQLIEA>82.)$  %+*Mfqtvwxy|~qd\UQLHEA>83/)$  '. 5\knsvwwxx|~uib\UQMIEB>950*$  3 *Whiqtuvxy|{yspid_ZUPMIEA>:40*$  3/'Pfipssttuvvusqlgc`\XSPLHEA<72.($  U '9Tcnqsrttsromheb^\XTROKGD>94/+($   ' 7Qbhjmqsqnkgec^\XURPNJFC;51-)'"   % 2KXaillmkhgda]ZVTQNLIDA:3/-)&"   . .HY`bbhgfec`]YVRPLIEB>830,)&!    ) $5DKTYaeccba^YVRNJFB?;642,'#  "  * $(,2@OU]baa`]YUQKGD@<752/-&   "   - "##$,:ER]`_\XVTNIFB>:630-)"    "   !""$)5CORQOLMKHFDA=950+&!      "$'-2213>BBABA?;71("      $!  "6:99<9752)!  !   ')''+*% !  #!!     '$!     )&     ( ! !!        !"! !!      "#"!     ""#"!       ""##"!!     "##"##""!"!!     ""#"##""     #$$#""#""!!   !$%$%$$#""!!    "$%$%$#"!      $%&%%$%%##""!      %&%##"!     !%&'&#"!    !&'&$##"!!     !(''()('&&$#"   !(*)*))('&%#"   !(*+**))''&%$#"     #*+, ++**)('&%$#!     &*+,+*('&&%$$#"   #,-,+*('&&%$#"!   $-,-,-.//..-,+)'&&%%$##!  &-./ ..--,,(''&%%$##    0/001/.-,,*''&&%%$$##    %320/11210/.-,+(''&%$##   "-321223343 2210//-,+*('&%$##   &2334566554433220/.,+*(''&%$#    '4234456 554330/.,++*('&&$#  )2236476 5432/.-++**('&$#!   (579::7665430/-,++**('&&$#! ,:=<<;9766530/.,,++*)''&#" 18=?<;;87641/.-,,++*('&$"  28@?> ::87652//.-,+('&#"  2A@C=<<:76530/.-,,++*'&#"!  07B@D<;86531//.-,+(%"!  46A?=86532//.-,,++)$  15@975421//.-,++(%!   /+<7531//.-,++'#!  *()6430/.-++($#"   %$$)2/.+)'#"" !  #!)/,)%#" !  "# !%$$##"!                t8mk@YfeeeeeeeeeeeefY DsnnnkknnnsD  <~uփu~< 1~ʉ~1Ý**ٟ  ~~ || @@;; 44 ..++ ++//rq21'' ## ''++ 00ll00ii gg >>ee hh jj ll oo rr  tt  ww  xx  zz  {{ pprryy~~yyrpprllll%bYhhYb%+XPccPX+ .NKKKGeeGKKKN.  ;CBBBBBBBBBBBBC; bumprace-1.5.4/macosx/English.lproj/0000777000175000017500000000000011217461066014340 500000000000000bumprace-1.5.4/macosx/English.lproj/InfoPlist.strings0000755000175000017500000000104211217461066017576 00000000000000/* Localized versions of Info.plist keys */ CFBundleName = "bumprace"; CFBundleShortVersionString = "bumprace version 0.1"; CFBundleGetInfoString = "bumprace version 0.1, Copyright 2004 __MyCompanyName__."; NSHumanReadableCopyright = "Copyright 2004 __MyCompanyName__."; bumprace-1.5.4/macosx/icon.png0000644000175000017500000003271711217461066013206 00000000000000PNG  IHDRu;<bKGD pHYs  tIME '*tEXtCommentMade with GIMP~e IDATxَ%Ǚ_d^nҌ4Ȱg_~ ڰþa`.lxX#)Qd/nuΖ""2##㜪HJXɓo\lv]lv]lv]lv]lv]lv]lvUĘ=9Hw:"/j˶kUT䏦aMYHOC ~_JwKYk7 q;m"a5kDj.#HDU).,~NJDW^diN"{(vVAX8UAU xQEQ U"HX-Eݲ,;|806***= G&E7 _(o[!]WC- ᦺ 1薦|L !0#?aR" ŕtg:'mWVRlMU`"[?eDTE$Yʚ$ՒP*C£QeNU,â<6[j t*Rp)!=yo-*IsޘP+49 _偢|kZyѫNMb*W#ļV\8$}/X?ݡEwD28 !<Vhۤo(p@ٟ'bد`E'BKg>/W"7bKr!_! "\>N&̌a:D)nF]\ AD/&p_TVp:PfAFɡ\=ЯξJ o Q  t)N; $,-.)dX'_Z]Ρw}:[2GTU\A%jcPPf3DUMn*1&C 1[qTO)X-1(m`9܁O2v /RZ+#`Jzy ^NPPX!Pbԩs/FrrXCv Dăn-5+KۥFxOKf Y۞vTb߲ZA[oF#c囤RX=5N/?2 7&oP8ol[er`㶊7/-$x* gTw>H/T\ 1%IXAhŰ,{ngAZ6`$.ϹNNu~dz-˶lcGr$e([2B0<>Ĩ?ûTNFִ '@$N{zPV֗Q6Z} 5^^i&!Z3Q-} < c*C˫wL>O~]@|[WXKѺQJ1 h╙sR]b=ނY`pՁ6&YփCiC|͂@oe\3y[h|c[eFI*0 w&ގOA#c$qWaHTF> =CV ]l5F4,Vx#9$|m¿'1?[(0P;dsT!->^bvۑ%l^ >'aNyQWJ[XU$Ɣ ceI&#v wt(^us( Φl.}MpAMU%CXb" \(0F %*U% xf ƮsQKqQB$ET?QZ>PuKưBQOW2giN96n.Ph=E#4JDu  DC} |F$\Y#iNiaQZXZ=h`%Q ^S^P'nO|$C)I-lBy #3mt zVޖВ Jj`S@"Q'3SpҢs̓$l7, ۡ@]1E%J셏I-l2$Dxp$uTFZf l$6 DB= koZ,9bC $gOJ7(]GRJZrvIP_FFV*)$1[ÚGƒ:떤E!)"LEojU[\=!vQ`#16;hj\v0c0a:f`o}.0:g׺\H}kQCq 476gH 9.yKFl07&L LbEOɏfW?_%VB SamD0Hp9){&B 2ȬReZ`p0fdBQNY/2+l]#ڠj*HJ%*0 8 RB_C% d32V҈rAgIx]vEƨm[߈CRV.)\hVjˆ zEHGVLPVc1?2f0rMޜ&sP5Y<j8BB%4RbM$JDr{JUIjddL1@::|pL3:CHZԩ-wcH*I#R,oDz&T&| /҃` bssx>7oOXc XU4N254Y9 &r2/6J%nBFL7-T"#[:: w{Uy\ ҿew0 H51/7(q`gPAdz^]#٤[Lz(yq;pHb³ ywKvx?ZRS-v$ b*u]RظF^KzEE3a$2$Wwjp iuKnk&;&"! >ǵ!+Џw3 $ lDFeH$@W eSwfҥlˇȼ\9$# g/݊bO7wCб\Y):WӰZQNU[QS_[*l\bC-\n ;.Qɸ^2-"t3-FQ8c=1 \|!b cjK5tJ :8|)^H%R3: ǨOcY7]p|ʬW 8ڍeq򐵵EryBk֣f)Sy8vBz{Cۭ*D$I,$2]db:0[>(Er(ڪnHPFzwNoٓ߅S^B a0Pdo}xv9D9#lB&) j'|}l,O.Op]'\NMvQRlzCkdx dm ywwDPAZlꦊ>4шTtQt5M6MTjj"Tqon|Cqٻ9BVsOIkA8',ۗL7.Q 'so2.*NB\Uh7T1`l2h11D5EKfLi m%MekP GaWgKӄ4=ETK鄌t\Tv՞ 0I 16ۻᩎք\AU83Q^|eŜ$IHCpe{V*솪iAEA >'/Mx5'iFZ%|p//`h5OԐL0ށegU.~ІͨH%];` Mg5N+0gI^; y{TmNy3^JvS!Em G+ցG;+.U1Θ3gںN^X$.Gڠ!KRBQiohEZ;dj׿g1 )CYe_-Ucn.{ !(b7\}jzS;{K{ ש.(l (-aOLf60]fTiٵ`w*+LHbm=Oթ4+8˲x \.cjACPM71olۧTk2u*3+5ù'XKǟ^Onc ir Ǡ] M^륆 Ԩn3b^Sž1ٟRO]CZ%Oqwؔ*1 G<<ĝ.YZJxuYVBXj; ЊqfZ0kh[/[n)ToP%l]Ss .?}×W8{ȇ`6UG}OЮi$&TGQkB+Ԥ 3$tFyWBDŽ4JzD<FQҤA=wLSjǼZ}C yARRG쇻;oxsqĵWNydG`T}K̭坓X1{û|j N7!Ջ5qLK~Cb?ұ(v yyXHe#f } n@RTmHs3:f%I eGm|XϠðS&{)Faf-ɜg9҆˫PXpm8rJ|?JpᅩyzLJGZ%FrKNO ?u0_EW-le"=b+@5x* %4K) +*Xen*޾Ux*PN|Srh(];܅Ձ/IYj'I\ bA)QǛ͒ 8^pwil[AЁjϢu-x&_3|0?ՊJoD9ꄇOlﶧŇ5q>Ny .;SO8nô+^=a<$p}* IG j#ErAPbLjq#%2uAj;r' 6'CVNZּZpcm`Jr:D[ xj*ܜ TL00q&F̏xD;Tkd6{4"֗x ]]Q+j,{Ռ kf"|m*h6ɣȉit4Bf!GQ.4ޑPbM\ #ƥk8rqx]qc2331[z/p6 E8\I@T9p%6BZQVy`6Hm8Bٖ`DJ'5Tc[8dro$}.v({+GtTyhKg hs?9A8IZF;m[U$,|/tbdіlV8q\kZ-WvӆjSҩ`ClQ5!:U0H悎Pj|Y xhxǩmyIˊ NX%4ϙSq_J׼%CUNR9 dm*>p-k}7j3 v,_YG۸cXK$R0_ݤuxՒ7lL &%BEPɿM+Q`FLxxf *?2"U]7>2vJv[ Vل:gmҚץe^wҮQQMsyϳ `$  %IbOKB%G+#Kfcje;3!|z86m$ Ƶu̵jYsU6\[-x6!\|[ `Ď(%2>1Sݽzĥ Se\&ߡ"5NΩ pIOiVa4&U*lhyl#UĈ}F'ˀZ.10dÈl Udx_ ޭLXj͞n(Lܚ_Fn,7qRbKVM\''J2C [OXhl,)-nhkURZ">DD#eY&$i:2JԌfquGVklԀ4rʷ_8*=c^2 Tm s (~K?W.IDATʔ_G"TjKqQvs &U@H!nTJJ.Ih0Nͻ;$CȢSIFa%~6HNj{7NNْKˁ]w*E X) GwHcXqɱ3oq`Ҙ䌤!Osxg$L"25)yɨƩ=0d{ܫ1) 4헯jŷV3hݣ ;TH"KdeBAjԱw0{,J3^6%@!,(חh7d;'tJy9xV8x$c Q~?>/[DlI5loHhtf}>Rѕ,dq:LOOt&UI_i8?:2u:hV䭎ypGyRy݀;Ҵ;1#ʻ$z^c)Cl97J܍]~6#h8a,Ō~~i_Mx%JJ*U 4֍B:4R&t0$*B~ODBjvLU 7M@> u6P~c?"LW>? p9Hed7@rIv+&zSBJ*O${hb h,qA]2Bӟ R/P87~j6⒅Oy]@ K5q5TXN$H E#.;K^ˈE#`%L.` C#pVseO6.t(| k\R gIғIexiU!W4$wZbCJj$4>yM.u<ߺpSߕ& /[RH<XRD"eF%wXn G)a=es@N{?5%rX&I!.P*l :ntqD#,Qgp3<#`}Cv#͒ӆזm#k±!%icCEPYe>29biL7"2wϼAyŔ Fj_T'n1d@ V?78-&S2˒{%1{\nJ[ocնӲ53acj>8m[!&jW4͐LMn=n"ݚ<Qz*9Jf:|Ģ }deњ'`d|2l軧I[IYMVDFw^Y}e"Cc~Wo蹌늃tZNv$ԩ-CT[q6dlx ~y4h(4&huҦ٠f@U_bd0|C.OCْ,ٗ:u8#U9NS%,e>4&L٩;(lWpL  7xq Ծ$_6aSbrIitz ӭ+U7hؑ/IܰoZ$^$\/AaiXX=G(}TTc>ޛGe$9'b]OyqoτeuS؍I0?2Sy.g&td0qQJleQ- uHa~:M̋z+Bdngw㑂89ʇt [P_c*>q9 8-M'2IK!SrT)ƒvߜR'ba mTT/yQm6ź[|<ݣyCJFmFS%z;j dm{"t4xȟآĕs S9&RϰR2EhD=8t4jb^+b9|V't[͆<~?O&]d᩼JF,_">\%?!&ȀԝDAÄBS>H j#nIqi?g:?`u v*-`X [;@vlTR9WW{ NqaE]O޴oUV37:_j? srmMHyտܿ!O90U=[&W4RL).6nz;e Z%V;T6BuJsK:9Gc*l4\9Ty*C~gecd–P#04~_11 vOyJ^ !&猸>br'㤜(3Q#k|Xqy{nֆ.;*ʿ} O |)g9< 8AȹlppGq0+vK-a{lYIEvFd˩4ͰდںZzP#=UӁ*kU/5'<:yFU6Ki\31AJd2C` |8bFΊ3@ƷDAR}B:@gquUePwKmA/ANvU"@eө S,꣥ 暦SG[讬+N|K!:VJ;;;RKs?nLF=@A/e2+LX{|0Lx{`&Q&h_~hr%{R P'}1aЁǿ)uןT:Qcˆjx!&38̨FR7v  )nkCRH$%{os6w% c~7E @;^bUaq~Am8NnP%Bw&8kWqtY.3Γ;T,+F?Xr*c|]H]7 {~VSlEcRWh_`=/\;{? DcbI ipN߱H%bd$F>y|&-Eȫs{i@?=I/©EUxc~nU3(y"IVnEHR5vk+Z-bKW 1㱤ŗ}"QD2ɻPF | uk-YsOuA ªbҶum4{#S4R&C@u}w$U9u'*l‘W&^ScbĈ70?|mj\$,Tq~4AmNJD]dassƆ DgLUɞh Ҧ [niI0 ?QV+8o}pT 6~n>NQb:AilDRL3suzgmq؏{ S5W5ǜe:Ayb$1Π̐F?}:"G f;|=UVYq-mkifC"$ڻEPtBz:2دž\qOvՏQN3"]_I ;.7_}ڍ˝҈op(6իM߁au#ʒB 8'Ue8v<õBBnChcQ _=(vM>cXPbSj ׶JYǻw"-Hm^%tu ҿ㡵<qTFm6Ա]M×U_cN$ynWu=OgJʢ3G3y1~3^㽧ٸ3cA}piiI$ 6E)hzkP᥼&߻wk6Lgs^-Lu `a[U%ZOkm{dy MOW\kY&!R0di2^b,9:EtYHH nd,Ť2!ڈsٳ!VlRK$,ov@0IѤj'1Fp@|=%HF55d2h$ UO7T}n\ݪ' ZPkynVdo[ CPMz7 *, 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA # 02110-1301, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi run=: sed_output='s/.* --output[ =]\([^ ]*\).*/\1/p' sed_minuso='s/.* -o \([^ ]*\).*/\1/p' # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.ac; then configure_ac=configure.ac else configure_ac=configure.in fi msg="missing on your system" case $1 in --run) # Try to run requested program, and just exit if it succeeds. run= shift "$@" && exit 0 # Exit code 63 means version mismatch. This often happens # when the user try to use an ancient version of a tool on # a file that requires a minimum version. In this case we # we should proceed has if the program had been absent, or # if --run hadn't been passed. if test $? = 63; then run=: msg="probably too old" fi ;; -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit --run try to run the given command, and emulate it if it fails Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' autom4te touch the output file, or create a stub one automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c help2man touch the output file lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file tar try tar, gnutar, gtar, then tar without non-portable flags yacc create \`y.tab.[ch]', if possible, from existing .[ch] Send bug reports to ." exit $? ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing $scriptversion (GNU Automake)" exit $? ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; esac # Now exit if we have it, but it failed. Also exit now if we # don't have it and --version was passed (most likely to detect # the program). case $1 in lex|yacc) # Not GNU programs, they don't have --version. ;; tar) if test -n "$run"; then echo 1>&2 "ERROR: \`tar' requires --run" exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then exit 1 fi ;; *) if test -z "$run" && ($1 --version) > /dev/null 2>&1; then # We have it, but it failed. exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then # Could not run --version or --help. This is probably someone # running `$TOOL --version' or `$TOOL --help' to check whether # $TOOL exists and not knowing $TOOL uses missing. exit 1 fi ;; esac # If it does not exist, or fails to run (possibly an outdated version), # try to emulate it. case $1 in aclocal*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acconfig.h' or \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}` test -z "$files" && files="config.h" touch_files= for f in $files; do case $f in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; autom4te) echo 1>&2 "\ WARNING: \`$1' is needed, but is $msg. You might have modified some files without having the proper tools for further handling them. You can get \`$1' as part of \`Autoconf' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo "#! /bin/sh" echo "# Created by GNU Automake missing as a replacement of" echo "# $ $@" echo "exit 0" chmod +x $file exit 1 fi ;; bison|yacc) echo 1>&2 "\ WARNING: \`$1' $msg. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if test $# -ne 1; then eval LASTARG="\${$#}" case $LASTARG in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.h fi ;; esac fi if test ! -f y.tab.h; then echo >y.tab.h fi if test ! -f y.tab.c; then echo 'main() { return 0; }' >y.tab.c fi ;; lex|flex) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if test $# -ne 1; then eval LASTARG="\${$#}" case $LASTARG in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if test ! -f lex.yy.c; then echo 'main() { return 0; }' >lex.yy.c fi ;; help2man) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a dependency of a manual page. You may need the \`Help2man' package in order for those modifications to take effect. You can get \`Help2man' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo ".ab help2man is required to generate this page" exit 1 fi ;; makeinfo) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." # The file to touch is that specified with -o ... file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -z "$file"; then # ... or it is the one specified with @setfilename ... infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n ' /^@setfilename/{ s/.* \([^ ]*\) *$/\1/ p q }' $infile` # ... or it is derived from the source name (dir/f.texi becomes f.info) test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info fi # If the file does not exist, the user really needs makeinfo; # let's fail without touching anything. test -f $file || exit 1 touch $file ;; tar) shift # We have already tried tar in the generic part. # Look for gnutar/gtar before invocation to avoid ugly error # messages. if (gnutar --version > /dev/null 2>&1); then gnutar "$@" && exit 0 fi if (gtar --version > /dev/null 2>&1); then gtar "$@" && exit 0 fi firstarg="$1" if shift; then case $firstarg in *o*) firstarg=`echo "$firstarg" | sed s/o//` tar "$firstarg" "$@" && exit 0 ;; esac case $firstarg in *h*) firstarg=`echo "$firstarg" | sed s/h//` tar "$firstarg" "$@" && exit 0 ;; esac fi echo 1>&2 "\ WARNING: I can't seem to be able to run \`tar' with the given arguments. You may want to install GNU tar or Free paxutils, or check the command line arguments." exit 1 ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and is $msg. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequisites for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-end: "$" # End: bumprace-1.5.4/config.guess0000755000175000017500000012626011217461066012573 00000000000000#! /bin/sh # Attempt to guess a canonical system name. # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, # 2000, 2001, 2002, 2003, 2004, 2005, 2006 Free Software Foundation, # Inc. timestamp='2006-07-02' # This file is free software; you can redistribute it and/or modify it # under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA # 02110-1301, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Originally written by Per Bothner . # Please send patches to . Submit a context # diff and a properly formatted ChangeLog entry. # # This script attempts to guess a canonical system name similar to # config.sub. If it succeeds, it prints the system name on stdout, and # exits with 0. Otherwise, it exits with 1. # # The plan is that this can be called by configure scripts if you # don't specify an explicit build system type. me=`echo "$0" | sed -e 's,.*/,,'` usage="\ Usage: $0 [OPTION] Output the configuration name of the system \`$me' is run on. Operation modes: -h, --help print this help, then exit -t, --time-stamp print date of last modification, then exit -v, --version print version number, then exit Report bugs and patches to ." version="\ GNU config.guess ($timestamp) Originally written by Per Bothner. Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." help=" Try \`$me --help' for more information." # Parse command line while test $# -gt 0 ; do case $1 in --time-stamp | --time* | -t ) echo "$timestamp" ; exit ;; --version | -v ) echo "$version" ; exit ;; --help | --h* | -h ) echo "$usage"; exit ;; -- ) # Stop option processing shift; break ;; - ) # Use stdin as input. break ;; -* ) echo "$me: invalid option $1$help" >&2 exit 1 ;; * ) break ;; esac done if test $# != 0; then echo "$me: too many arguments$help" >&2 exit 1 fi trap 'exit 1' 1 2 15 # CC_FOR_BUILD -- compiler used by this script. Note that the use of a # compiler to aid in system detection is discouraged as it requires # temporary files to be created and, as you can see below, it is a # headache to deal with in a portable fashion. # Historically, `CC_FOR_BUILD' used to be named `HOST_CC'. We still # use `HOST_CC' if defined, but it is deprecated. # Portable tmp directory creation inspired by the Autoconf team. set_cc_for_build=' trap "exitcode=\$?; (rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null) && exit \$exitcode" 0 ; trap "rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null; exit 1" 1 2 13 15 ; : ${TMPDIR=/tmp} ; { tmp=`(umask 077 && mktemp -d "$TMPDIR/cgXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" ; } || { test -n "$RANDOM" && tmp=$TMPDIR/cg$$-$RANDOM && (umask 077 && mkdir $tmp) ; } || { tmp=$TMPDIR/cg-$$ && (umask 077 && mkdir $tmp) && echo "Warning: creating insecure temp directory" >&2 ; } || { echo "$me: cannot create a temporary directory in $TMPDIR" >&2 ; exit 1 ; } ; dummy=$tmp/dummy ; tmpfiles="$dummy.c $dummy.o $dummy.rel $dummy" ; case $CC_FOR_BUILD,$HOST_CC,$CC in ,,) echo "int x;" > $dummy.c ; for c in cc gcc c89 c99 ; do if ($c -c -o $dummy.o $dummy.c) >/dev/null 2>&1 ; then CC_FOR_BUILD="$c"; break ; fi ; done ; if test x"$CC_FOR_BUILD" = x ; then CC_FOR_BUILD=no_compiler_found ; fi ;; ,,*) CC_FOR_BUILD=$CC ;; ,*,*) CC_FOR_BUILD=$HOST_CC ;; esac ; set_cc_for_build= ;' # This is needed to find uname on a Pyramid OSx when run in the BSD universe. # (ghazi@noc.rutgers.edu 1994-08-24) if (test -f /.attbin/uname) >/dev/null 2>&1 ; then PATH=$PATH:/.attbin ; export PATH fi UNAME_MACHINE=`(uname -m) 2>/dev/null` || UNAME_MACHINE=unknown UNAME_RELEASE=`(uname -r) 2>/dev/null` || UNAME_RELEASE=unknown UNAME_SYSTEM=`(uname -s) 2>/dev/null` || UNAME_SYSTEM=unknown UNAME_VERSION=`(uname -v) 2>/dev/null` || UNAME_VERSION=unknown # Note: order is significant - the case branches are not exclusive. case "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" in *:NetBSD:*:*) # NetBSD (nbsd) targets should (where applicable) match one or # more of the tupples: *-*-netbsdelf*, *-*-netbsdaout*, # *-*-netbsdecoff* and *-*-netbsd*. For targets that recently # switched to ELF, *-*-netbsd* would select the old # object file format. This provides both forward # compatibility and a consistent mechanism for selecting the # object file format. # # Note: NetBSD doesn't particularly care about the vendor # portion of the name. We always set it to "unknown". sysctl="sysctl -n hw.machine_arch" UNAME_MACHINE_ARCH=`(/sbin/$sysctl 2>/dev/null || \ /usr/sbin/$sysctl 2>/dev/null || echo unknown)` case "${UNAME_MACHINE_ARCH}" in armeb) machine=armeb-unknown ;; arm*) machine=arm-unknown ;; sh3el) machine=shl-unknown ;; sh3eb) machine=sh-unknown ;; *) machine=${UNAME_MACHINE_ARCH}-unknown ;; esac # The Operating System including object format, if it has switched # to ELF recently, or will in the future. case "${UNAME_MACHINE_ARCH}" in arm*|i386|m68k|ns32k|sh3*|sparc|vax) eval $set_cc_for_build if echo __ELF__ | $CC_FOR_BUILD -E - 2>/dev/null \ | grep __ELF__ >/dev/null then # Once all utilities can be ECOFF (netbsdecoff) or a.out (netbsdaout). # Return netbsd for either. FIX? os=netbsd else os=netbsdelf fi ;; *) os=netbsd ;; esac # The OS release # Debian GNU/NetBSD machines have a different userland, and # thus, need a distinct triplet. However, they do not need # kernel version information, so it can be replaced with a # suitable tag, in the style of linux-gnu. case "${UNAME_VERSION}" in Debian*) release='-gnu' ;; *) release=`echo ${UNAME_RELEASE}|sed -e 's/[-_].*/\./'` ;; esac # Since CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM: # contains redundant information, the shorter form: # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used. echo "${machine}-${os}${release}" exit ;; *:OpenBSD:*:*) UNAME_MACHINE_ARCH=`arch | sed 's/OpenBSD.//'` echo ${UNAME_MACHINE_ARCH}-unknown-openbsd${UNAME_RELEASE} exit ;; *:ekkoBSD:*:*) echo ${UNAME_MACHINE}-unknown-ekkobsd${UNAME_RELEASE} exit ;; *:SolidBSD:*:*) echo ${UNAME_MACHINE}-unknown-solidbsd${UNAME_RELEASE} exit ;; macppc:MirBSD:*:*) echo powerpc-unknown-mirbsd${UNAME_RELEASE} exit ;; *:MirBSD:*:*) echo ${UNAME_MACHINE}-unknown-mirbsd${UNAME_RELEASE} exit ;; alpha:OSF1:*:*) case $UNAME_RELEASE in *4.0) UNAME_RELEASE=`/usr/sbin/sizer -v | awk '{print $3}'` ;; *5.*) UNAME_RELEASE=`/usr/sbin/sizer -v | awk '{print $4}'` ;; esac # According to Compaq, /usr/sbin/psrinfo has been available on # OSF/1 and Tru64 systems produced since 1995. I hope that # covers most systems running today. This code pipes the CPU # types through head -n 1, so we only detect the type of CPU 0. ALPHA_CPU_TYPE=`/usr/sbin/psrinfo -v | sed -n -e 's/^ The alpha \(.*\) processor.*$/\1/p' | head -n 1` case "$ALPHA_CPU_TYPE" in "EV4 (21064)") UNAME_MACHINE="alpha" ;; "EV4.5 (21064)") UNAME_MACHINE="alpha" ;; "LCA4 (21066/21068)") UNAME_MACHINE="alpha" ;; "EV5 (21164)") UNAME_MACHINE="alphaev5" ;; "EV5.6 (21164A)") UNAME_MACHINE="alphaev56" ;; "EV5.6 (21164PC)") UNAME_MACHINE="alphapca56" ;; "EV5.7 (21164PC)") UNAME_MACHINE="alphapca57" ;; "EV6 (21264)") UNAME_MACHINE="alphaev6" ;; "EV6.7 (21264A)") UNAME_MACHINE="alphaev67" ;; "EV6.8CB (21264C)") UNAME_MACHINE="alphaev68" ;; "EV6.8AL (21264B)") UNAME_MACHINE="alphaev68" ;; "EV6.8CX (21264D)") UNAME_MACHINE="alphaev68" ;; "EV6.9A (21264/EV69A)") UNAME_MACHINE="alphaev69" ;; "EV7 (21364)") UNAME_MACHINE="alphaev7" ;; "EV7.9 (21364A)") UNAME_MACHINE="alphaev79" ;; esac # A Pn.n version is a patched version. # A Vn.n version is a released version. # A Tn.n version is a released field test version. # A Xn.n version is an unreleased experimental baselevel. # 1.2 uses "1.2" for uname -r. echo ${UNAME_MACHINE}-dec-osf`echo ${UNAME_RELEASE} | sed -e 's/^[PVTX]//' | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'` exit ;; Alpha\ *:Windows_NT*:*) # How do we know it's Interix rather than the generic POSIX subsystem? # Should we change UNAME_MACHINE based on the output of uname instead # of the specific Alpha model? echo alpha-pc-interix exit ;; 21064:Windows_NT:50:3) echo alpha-dec-winnt3.5 exit ;; Amiga*:UNIX_System_V:4.0:*) echo m68k-unknown-sysv4 exit ;; *:[Aa]miga[Oo][Ss]:*:*) echo ${UNAME_MACHINE}-unknown-amigaos exit ;; *:[Mm]orph[Oo][Ss]:*:*) echo ${UNAME_MACHINE}-unknown-morphos exit ;; *:OS/390:*:*) echo i370-ibm-openedition exit ;; *:z/VM:*:*) echo s390-ibm-zvmoe exit ;; *:OS400:*:*) echo powerpc-ibm-os400 exit ;; arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*) echo arm-acorn-riscix${UNAME_RELEASE} exit ;; arm:riscos:*:*|arm:RISCOS:*:*) echo arm-unknown-riscos exit ;; SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*) echo hppa1.1-hitachi-hiuxmpp exit ;; Pyramid*:OSx*:*:* | MIS*:OSx*:*:* | MIS*:SMP_DC-OSx*:*:*) # akee@wpdis03.wpafb.af.mil (Earle F. Ake) contributed MIS and NILE. if test "`(/bin/universe) 2>/dev/null`" = att ; then echo pyramid-pyramid-sysv3 else echo pyramid-pyramid-bsd fi exit ;; NILE*:*:*:dcosx) echo pyramid-pyramid-svr4 exit ;; DRS?6000:unix:4.0:6*) echo sparc-icl-nx6 exit ;; DRS?6000:UNIX_SV:4.2*:7* | DRS?6000:isis:4.2*:7*) case `/usr/bin/uname -p` in sparc) echo sparc-icl-nx7; exit ;; esac ;; sun4H:SunOS:5.*:*) echo sparc-hal-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit ;; sun4*:SunOS:5.*:* | tadpole*:SunOS:5.*:*) echo sparc-sun-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit ;; i86pc:SunOS:5.*:*) echo i386-pc-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit ;; sun4*:SunOS:6*:*) # According to config.sub, this is the proper way to canonicalize # SunOS6. Hard to guess exactly what SunOS6 will be like, but # it's likely to be more like Solaris than SunOS4. echo sparc-sun-solaris3`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit ;; sun4*:SunOS:*:*) case "`/usr/bin/arch -k`" in Series*|S4*) UNAME_RELEASE=`uname -v` ;; esac # Japanese Language versions have a version number like `4.1.3-JL'. echo sparc-sun-sunos`echo ${UNAME_RELEASE}|sed -e 's/-/_/'` exit ;; sun3*:SunOS:*:*) echo m68k-sun-sunos${UNAME_RELEASE} exit ;; sun*:*:4.2BSD:*) UNAME_RELEASE=`(sed 1q /etc/motd | awk '{print substr($5,1,3)}') 2>/dev/null` test "x${UNAME_RELEASE}" = "x" && UNAME_RELEASE=3 case "`/bin/arch`" in sun3) echo m68k-sun-sunos${UNAME_RELEASE} ;; sun4) echo sparc-sun-sunos${UNAME_RELEASE} ;; esac exit ;; aushp:SunOS:*:*) echo sparc-auspex-sunos${UNAME_RELEASE} exit ;; # The situation for MiNT is a little confusing. The machine name # can be virtually everything (everything which is not # "atarist" or "atariste" at least should have a processor # > m68000). The system name ranges from "MiNT" over "FreeMiNT" # to the lowercase version "mint" (or "freemint"). Finally # the system name "TOS" denotes a system which is actually not # MiNT. But MiNT is downward compatible to TOS, so this should # be no problem. atarist[e]:*MiNT:*:* | atarist[e]:*mint:*:* | atarist[e]:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit ;; atari*:*MiNT:*:* | atari*:*mint:*:* | atarist[e]:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit ;; *falcon*:*MiNT:*:* | *falcon*:*mint:*:* | *falcon*:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit ;; milan*:*MiNT:*:* | milan*:*mint:*:* | *milan*:*TOS:*:*) echo m68k-milan-mint${UNAME_RELEASE} exit ;; hades*:*MiNT:*:* | hades*:*mint:*:* | *hades*:*TOS:*:*) echo m68k-hades-mint${UNAME_RELEASE} exit ;; *:*MiNT:*:* | *:*mint:*:* | *:*TOS:*:*) echo m68k-unknown-mint${UNAME_RELEASE} exit ;; m68k:machten:*:*) echo m68k-apple-machten${UNAME_RELEASE} exit ;; powerpc:machten:*:*) echo powerpc-apple-machten${UNAME_RELEASE} exit ;; RISC*:Mach:*:*) echo mips-dec-mach_bsd4.3 exit ;; RISC*:ULTRIX:*:*) echo mips-dec-ultrix${UNAME_RELEASE} exit ;; VAX*:ULTRIX*:*:*) echo vax-dec-ultrix${UNAME_RELEASE} exit ;; 2020:CLIX:*:* | 2430:CLIX:*:*) echo clipper-intergraph-clix${UNAME_RELEASE} exit ;; mips:*:*:UMIPS | mips:*:*:RISCos) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #ifdef __cplusplus #include /* for printf() prototype */ int main (int argc, char *argv[]) { #else int main (argc, argv) int argc; char *argv[]; { #endif #if defined (host_mips) && defined (MIPSEB) #if defined (SYSTYPE_SYSV) printf ("mips-mips-riscos%ssysv\n", argv[1]); exit (0); #endif #if defined (SYSTYPE_SVR4) printf ("mips-mips-riscos%ssvr4\n", argv[1]); exit (0); #endif #if defined (SYSTYPE_BSD43) || defined(SYSTYPE_BSD) printf ("mips-mips-riscos%sbsd\n", argv[1]); exit (0); #endif #endif exit (-1); } EOF $CC_FOR_BUILD -o $dummy $dummy.c && dummyarg=`echo "${UNAME_RELEASE}" | sed -n 's/\([0-9]*\).*/\1/p'` && SYSTEM_NAME=`$dummy $dummyarg` && { echo "$SYSTEM_NAME"; exit; } echo mips-mips-riscos${UNAME_RELEASE} exit ;; Motorola:PowerMAX_OS:*:*) echo powerpc-motorola-powermax exit ;; Motorola:*:4.3:PL8-*) echo powerpc-harris-powermax exit ;; Night_Hawk:*:*:PowerMAX_OS | Synergy:PowerMAX_OS:*:*) echo powerpc-harris-powermax exit ;; Night_Hawk:Power_UNIX:*:*) echo powerpc-harris-powerunix exit ;; m88k:CX/UX:7*:*) echo m88k-harris-cxux7 exit ;; m88k:*:4*:R4*) echo m88k-motorola-sysv4 exit ;; m88k:*:3*:R3*) echo m88k-motorola-sysv3 exit ;; AViiON:dgux:*:*) # DG/UX returns AViiON for all architectures UNAME_PROCESSOR=`/usr/bin/uname -p` if [ $UNAME_PROCESSOR = mc88100 ] || [ $UNAME_PROCESSOR = mc88110 ] then if [ ${TARGET_BINARY_INTERFACE}x = m88kdguxelfx ] || \ [ ${TARGET_BINARY_INTERFACE}x = x ] then echo m88k-dg-dgux${UNAME_RELEASE} else echo m88k-dg-dguxbcs${UNAME_RELEASE} fi else echo i586-dg-dgux${UNAME_RELEASE} fi exit ;; M88*:DolphinOS:*:*) # DolphinOS (SVR3) echo m88k-dolphin-sysv3 exit ;; M88*:*:R3*:*) # Delta 88k system running SVR3 echo m88k-motorola-sysv3 exit ;; XD88*:*:*:*) # Tektronix XD88 system running UTekV (SVR3) echo m88k-tektronix-sysv3 exit ;; Tek43[0-9][0-9]:UTek:*:*) # Tektronix 4300 system running UTek (BSD) echo m68k-tektronix-bsd exit ;; *:IRIX*:*:*) echo mips-sgi-irix`echo ${UNAME_RELEASE}|sed -e 's/-/_/g'` exit ;; ????????:AIX?:[12].1:2) # AIX 2.2.1 or AIX 2.1.1 is RT/PC AIX. echo romp-ibm-aix # uname -m gives an 8 hex-code CPU id exit ;; # Note that: echo "'`uname -s`'" gives 'AIX ' i*86:AIX:*:*) echo i386-ibm-aix exit ;; ia64:AIX:*:*) if [ -x /usr/bin/oslevel ] ; then IBM_REV=`/usr/bin/oslevel` else IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE} fi echo ${UNAME_MACHINE}-ibm-aix${IBM_REV} exit ;; *:AIX:2:3) if grep bos325 /usr/include/stdio.h >/dev/null 2>&1; then eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include main() { if (!__power_pc()) exit(1); puts("powerpc-ibm-aix3.2.5"); exit(0); } EOF if $CC_FOR_BUILD -o $dummy $dummy.c && SYSTEM_NAME=`$dummy` then echo "$SYSTEM_NAME" else echo rs6000-ibm-aix3.2.5 fi elif grep bos324 /usr/include/stdio.h >/dev/null 2>&1; then echo rs6000-ibm-aix3.2.4 else echo rs6000-ibm-aix3.2 fi exit ;; *:AIX:*:[45]) IBM_CPU_ID=`/usr/sbin/lsdev -C -c processor -S available | sed 1q | awk '{ print $1 }'` if /usr/sbin/lsattr -El ${IBM_CPU_ID} | grep ' POWER' >/dev/null 2>&1; then IBM_ARCH=rs6000 else IBM_ARCH=powerpc fi if [ -x /usr/bin/oslevel ] ; then IBM_REV=`/usr/bin/oslevel` else IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE} fi echo ${IBM_ARCH}-ibm-aix${IBM_REV} exit ;; *:AIX:*:*) echo rs6000-ibm-aix exit ;; ibmrt:4.4BSD:*|romp-ibm:BSD:*) echo romp-ibm-bsd4.4 exit ;; ibmrt:*BSD:*|romp-ibm:BSD:*) # covers RT/PC BSD and echo romp-ibm-bsd${UNAME_RELEASE} # 4.3 with uname added to exit ;; # report: romp-ibm BSD 4.3 *:BOSX:*:*) echo rs6000-bull-bosx exit ;; DPX/2?00:B.O.S.:*:*) echo m68k-bull-sysv3 exit ;; 9000/[34]??:4.3bsd:1.*:*) echo m68k-hp-bsd exit ;; hp300:4.4BSD:*:* | 9000/[34]??:4.3bsd:2.*:*) echo m68k-hp-bsd4.4 exit ;; 9000/[34678]??:HP-UX:*:*) HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'` case "${UNAME_MACHINE}" in 9000/31? ) HP_ARCH=m68000 ;; 9000/[34]?? ) HP_ARCH=m68k ;; 9000/[678][0-9][0-9]) if [ -x /usr/bin/getconf ]; then sc_cpu_version=`/usr/bin/getconf SC_CPU_VERSION 2>/dev/null` sc_kernel_bits=`/usr/bin/getconf SC_KERNEL_BITS 2>/dev/null` case "${sc_cpu_version}" in 523) HP_ARCH="hppa1.0" ;; # CPU_PA_RISC1_0 528) HP_ARCH="hppa1.1" ;; # CPU_PA_RISC1_1 532) # CPU_PA_RISC2_0 case "${sc_kernel_bits}" in 32) HP_ARCH="hppa2.0n" ;; 64) HP_ARCH="hppa2.0w" ;; '') HP_ARCH="hppa2.0" ;; # HP-UX 10.20 esac ;; esac fi if [ "${HP_ARCH}" = "" ]; then eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #define _HPUX_SOURCE #include #include int main () { #if defined(_SC_KERNEL_BITS) long bits = sysconf(_SC_KERNEL_BITS); #endif long cpu = sysconf (_SC_CPU_VERSION); switch (cpu) { case CPU_PA_RISC1_0: puts ("hppa1.0"); break; case CPU_PA_RISC1_1: puts ("hppa1.1"); break; case CPU_PA_RISC2_0: #if defined(_SC_KERNEL_BITS) switch (bits) { case 64: puts ("hppa2.0w"); break; case 32: puts ("hppa2.0n"); break; default: puts ("hppa2.0"); break; } break; #else /* !defined(_SC_KERNEL_BITS) */ puts ("hppa2.0"); break; #endif default: puts ("hppa1.0"); break; } exit (0); } EOF (CCOPTS= $CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null) && HP_ARCH=`$dummy` test -z "$HP_ARCH" && HP_ARCH=hppa fi ;; esac if [ ${HP_ARCH} = "hppa2.0w" ] then eval $set_cc_for_build # hppa2.0w-hp-hpux* has a 64-bit kernel and a compiler generating # 32-bit code. hppa64-hp-hpux* has the same kernel and a compiler # generating 64-bit code. GNU and HP use different nomenclature: # # $ CC_FOR_BUILD=cc ./config.guess # => hppa2.0w-hp-hpux11.23 # $ CC_FOR_BUILD="cc +DA2.0w" ./config.guess # => hppa64-hp-hpux11.23 if echo __LP64__ | (CCOPTS= $CC_FOR_BUILD -E - 2>/dev/null) | grep __LP64__ >/dev/null then HP_ARCH="hppa2.0w" else HP_ARCH="hppa64" fi fi echo ${HP_ARCH}-hp-hpux${HPUX_REV} exit ;; ia64:HP-UX:*:*) HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'` echo ia64-hp-hpux${HPUX_REV} exit ;; 3050*:HI-UX:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include int main () { long cpu = sysconf (_SC_CPU_VERSION); /* The order matters, because CPU_IS_HP_MC68K erroneously returns true for CPU_PA_RISC1_0. CPU_IS_PA_RISC returns correct results, however. */ if (CPU_IS_PA_RISC (cpu)) { switch (cpu) { case CPU_PA_RISC1_0: puts ("hppa1.0-hitachi-hiuxwe2"); break; case CPU_PA_RISC1_1: puts ("hppa1.1-hitachi-hiuxwe2"); break; case CPU_PA_RISC2_0: puts ("hppa2.0-hitachi-hiuxwe2"); break; default: puts ("hppa-hitachi-hiuxwe2"); break; } } else if (CPU_IS_HP_MC68K (cpu)) puts ("m68k-hitachi-hiuxwe2"); else puts ("unknown-hitachi-hiuxwe2"); exit (0); } EOF $CC_FOR_BUILD -o $dummy $dummy.c && SYSTEM_NAME=`$dummy` && { echo "$SYSTEM_NAME"; exit; } echo unknown-hitachi-hiuxwe2 exit ;; 9000/7??:4.3bsd:*:* | 9000/8?[79]:4.3bsd:*:* ) echo hppa1.1-hp-bsd exit ;; 9000/8??:4.3bsd:*:*) echo hppa1.0-hp-bsd exit ;; *9??*:MPE/iX:*:* | *3000*:MPE/iX:*:*) echo hppa1.0-hp-mpeix exit ;; hp7??:OSF1:*:* | hp8?[79]:OSF1:*:* ) echo hppa1.1-hp-osf exit ;; hp8??:OSF1:*:*) echo hppa1.0-hp-osf exit ;; i*86:OSF1:*:*) if [ -x /usr/sbin/sysversion ] ; then echo ${UNAME_MACHINE}-unknown-osf1mk else echo ${UNAME_MACHINE}-unknown-osf1 fi exit ;; parisc*:Lites*:*:*) echo hppa1.1-hp-lites exit ;; C1*:ConvexOS:*:* | convex:ConvexOS:C1*:*) echo c1-convex-bsd exit ;; C2*:ConvexOS:*:* | convex:ConvexOS:C2*:*) if getsysinfo -f scalar_acc then echo c32-convex-bsd else echo c2-convex-bsd fi exit ;; C34*:ConvexOS:*:* | convex:ConvexOS:C34*:*) echo c34-convex-bsd exit ;; C38*:ConvexOS:*:* | convex:ConvexOS:C38*:*) echo c38-convex-bsd exit ;; C4*:ConvexOS:*:* | convex:ConvexOS:C4*:*) echo c4-convex-bsd exit ;; CRAY*Y-MP:*:*:*) echo ymp-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit ;; CRAY*[A-Z]90:*:*:*) echo ${UNAME_MACHINE}-cray-unicos${UNAME_RELEASE} \ | sed -e 's/CRAY.*\([A-Z]90\)/\1/' \ -e y/ABCDEFGHIJKLMNOPQRSTUVWXYZ/abcdefghijklmnopqrstuvwxyz/ \ -e 's/\.[^.]*$/.X/' exit ;; CRAY*TS:*:*:*) echo t90-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit ;; CRAY*T3E:*:*:*) echo alphaev5-cray-unicosmk${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit ;; CRAY*SV1:*:*:*) echo sv1-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit ;; *:UNICOS/mp:*:*) echo craynv-cray-unicosmp${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit ;; F30[01]:UNIX_System_V:*:* | F700:UNIX_System_V:*:*) FUJITSU_PROC=`uname -m | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'` FUJITSU_SYS=`uname -p | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/\///'` FUJITSU_REL=`echo ${UNAME_RELEASE} | sed -e 's/ /_/'` echo "${FUJITSU_PROC}-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}" exit ;; 5000:UNIX_System_V:4.*:*) FUJITSU_SYS=`uname -p | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/\///'` FUJITSU_REL=`echo ${UNAME_RELEASE} | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/ /_/'` echo "sparc-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}" exit ;; i*86:BSD/386:*:* | i*86:BSD/OS:*:* | *:Ascend\ Embedded/OS:*:*) echo ${UNAME_MACHINE}-pc-bsdi${UNAME_RELEASE} exit ;; sparc*:BSD/OS:*:*) echo sparc-unknown-bsdi${UNAME_RELEASE} exit ;; *:BSD/OS:*:*) echo ${UNAME_MACHINE}-unknown-bsdi${UNAME_RELEASE} exit ;; *:FreeBSD:*:*) case ${UNAME_MACHINE} in pc98) echo i386-unknown-freebsd`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'` ;; amd64) echo x86_64-unknown-freebsd`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'` ;; *) echo ${UNAME_MACHINE}-unknown-freebsd`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'` ;; esac exit ;; i*:CYGWIN*:*) echo ${UNAME_MACHINE}-pc-cygwin exit ;; i*:MINGW*:*) echo ${UNAME_MACHINE}-pc-mingw32 exit ;; i*:windows32*:*) # uname -m includes "-pc" on this system. echo ${UNAME_MACHINE}-mingw32 exit ;; i*:PW*:*) echo ${UNAME_MACHINE}-pc-pw32 exit ;; x86:Interix*:[3456]*) echo i586-pc-interix${UNAME_RELEASE} exit ;; EM64T:Interix*:[3456]*) echo x86_64-unknown-interix${UNAME_RELEASE} exit ;; [345]86:Windows_95:* | [345]86:Windows_98:* | [345]86:Windows_NT:*) echo i${UNAME_MACHINE}-pc-mks exit ;; i*:Windows_NT*:* | Pentium*:Windows_NT*:*) # How do we know it's Interix rather than the generic POSIX subsystem? # It also conflicts with pre-2.0 versions of AT&T UWIN. Should we # UNAME_MACHINE based on the output of uname instead of i386? echo i586-pc-interix exit ;; i*:UWIN*:*) echo ${UNAME_MACHINE}-pc-uwin exit ;; amd64:CYGWIN*:*:* | x86_64:CYGWIN*:*:*) echo x86_64-unknown-cygwin exit ;; p*:CYGWIN*:*) echo powerpcle-unknown-cygwin exit ;; prep*:SunOS:5.*:*) echo powerpcle-unknown-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit ;; *:GNU:*:*) # the GNU system echo `echo ${UNAME_MACHINE}|sed -e 's,[-/].*$,,'`-unknown-gnu`echo ${UNAME_RELEASE}|sed -e 's,/.*$,,'` exit ;; *:GNU/*:*:*) # other systems with GNU libc and userland echo ${UNAME_MACHINE}-unknown-`echo ${UNAME_SYSTEM} | sed 's,^[^/]*/,,' | tr '[A-Z]' '[a-z]'``echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`-gnu exit ;; i*86:Minix:*:*) echo ${UNAME_MACHINE}-pc-minix exit ;; arm*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; avr32*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; cris:Linux:*:*) echo cris-axis-linux-gnu exit ;; crisv32:Linux:*:*) echo crisv32-axis-linux-gnu exit ;; frv:Linux:*:*) echo frv-unknown-linux-gnu exit ;; ia64:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; m32r*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; m68*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; mips:Linux:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #undef CPU #undef mips #undef mipsel #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL) CPU=mipsel #else #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB) CPU=mips #else CPU= #endif #endif EOF eval "`$CC_FOR_BUILD -E $dummy.c 2>/dev/null | sed -n ' /^CPU/{ s: ::g p }'`" test x"${CPU}" != x && { echo "${CPU}-unknown-linux-gnu"; exit; } ;; mips64:Linux:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #undef CPU #undef mips64 #undef mips64el #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL) CPU=mips64el #else #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB) CPU=mips64 #else CPU= #endif #endif EOF eval "`$CC_FOR_BUILD -E $dummy.c 2>/dev/null | sed -n ' /^CPU/{ s: ::g p }'`" test x"${CPU}" != x && { echo "${CPU}-unknown-linux-gnu"; exit; } ;; or32:Linux:*:*) echo or32-unknown-linux-gnu exit ;; ppc:Linux:*:*) echo powerpc-unknown-linux-gnu exit ;; ppc64:Linux:*:*) echo powerpc64-unknown-linux-gnu exit ;; alpha:Linux:*:*) case `sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' < /proc/cpuinfo` in EV5) UNAME_MACHINE=alphaev5 ;; EV56) UNAME_MACHINE=alphaev56 ;; PCA56) UNAME_MACHINE=alphapca56 ;; PCA57) UNAME_MACHINE=alphapca56 ;; EV6) UNAME_MACHINE=alphaev6 ;; EV67) UNAME_MACHINE=alphaev67 ;; EV68*) UNAME_MACHINE=alphaev68 ;; esac objdump --private-headers /bin/sh | grep ld.so.1 >/dev/null if test "$?" = 0 ; then LIBC="libc1" ; else LIBC="" ; fi echo ${UNAME_MACHINE}-unknown-linux-gnu${LIBC} exit ;; parisc:Linux:*:* | hppa:Linux:*:*) # Look for CPU level case `grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2` in PA7*) echo hppa1.1-unknown-linux-gnu ;; PA8*) echo hppa2.0-unknown-linux-gnu ;; *) echo hppa-unknown-linux-gnu ;; esac exit ;; parisc64:Linux:*:* | hppa64:Linux:*:*) echo hppa64-unknown-linux-gnu exit ;; s390:Linux:*:* | s390x:Linux:*:*) echo ${UNAME_MACHINE}-ibm-linux exit ;; sh64*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; sh*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; sparc:Linux:*:* | sparc64:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit ;; vax:Linux:*:*) echo ${UNAME_MACHINE}-dec-linux-gnu exit ;; x86_64:Linux:*:*) echo x86_64-unknown-linux-gnu exit ;; i*86:Linux:*:*) # The BFD linker knows what the default object file format is, so # first see if it will tell us. cd to the root directory to prevent # problems with other programs or directories called `ld' in the path. # Set LC_ALL=C to ensure ld outputs messages in English. ld_supported_targets=`cd /; LC_ALL=C ld --help 2>&1 \ | sed -ne '/supported targets:/!d s/[ ][ ]*/ /g s/.*supported targets: *// s/ .*// p'` case "$ld_supported_targets" in elf32-i386) TENTATIVE="${UNAME_MACHINE}-pc-linux-gnu" ;; a.out-i386-linux) echo "${UNAME_MACHINE}-pc-linux-gnuaout" exit ;; coff-i386) echo "${UNAME_MACHINE}-pc-linux-gnucoff" exit ;; "") # Either a pre-BFD a.out linker (linux-gnuoldld) or # one that does not give us useful --help. echo "${UNAME_MACHINE}-pc-linux-gnuoldld" exit ;; esac # Determine whether the default compiler is a.out or elf eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include #ifdef __ELF__ # ifdef __GLIBC__ # if __GLIBC__ >= 2 LIBC=gnu # else LIBC=gnulibc1 # endif # else LIBC=gnulibc1 # endif #else #if defined(__INTEL_COMPILER) || defined(__PGI) || defined(__SUNPRO_C) || defined(__SUNPRO_CC) LIBC=gnu #else LIBC=gnuaout #endif #endif #ifdef __dietlibc__ LIBC=dietlibc #endif EOF eval "`$CC_FOR_BUILD -E $dummy.c 2>/dev/null | sed -n ' /^LIBC/{ s: ::g p }'`" test x"${LIBC}" != x && { echo "${UNAME_MACHINE}-pc-linux-${LIBC}" exit } test x"${TENTATIVE}" != x && { echo "${TENTATIVE}"; exit; } ;; i*86:DYNIX/ptx:4*:*) # ptx 4.0 does uname -s correctly, with DYNIX/ptx in there. # earlier versions are messed up and put the nodename in both # sysname and nodename. echo i386-sequent-sysv4 exit ;; i*86:UNIX_SV:4.2MP:2.*) # Unixware is an offshoot of SVR4, but it has its own version # number series starting with 2... # I am not positive that other SVR4 systems won't match this, # I just have to hope. -- rms. # Use sysv4.2uw... so that sysv4* matches it. echo ${UNAME_MACHINE}-pc-sysv4.2uw${UNAME_VERSION} exit ;; i*86:OS/2:*:*) # If we were able to find `uname', then EMX Unix compatibility # is probably installed. echo ${UNAME_MACHINE}-pc-os2-emx exit ;; i*86:XTS-300:*:STOP) echo ${UNAME_MACHINE}-unknown-stop exit ;; i*86:atheos:*:*) echo ${UNAME_MACHINE}-unknown-atheos exit ;; i*86:syllable:*:*) echo ${UNAME_MACHINE}-pc-syllable exit ;; i*86:LynxOS:2.*:* | i*86:LynxOS:3.[01]*:* | i*86:LynxOS:4.0*:*) echo i386-unknown-lynxos${UNAME_RELEASE} exit ;; i*86:*DOS:*:*) echo ${UNAME_MACHINE}-pc-msdosdjgpp exit ;; i*86:*:4.*:* | i*86:SYSTEM_V:4.*:*) UNAME_REL=`echo ${UNAME_RELEASE} | sed 's/\/MP$//'` if grep Novell /usr/include/link.h >/dev/null 2>/dev/null; then echo ${UNAME_MACHINE}-univel-sysv${UNAME_REL} else echo ${UNAME_MACHINE}-pc-sysv${UNAME_REL} fi exit ;; i*86:*:5:[678]*) # UnixWare 7.x, OpenUNIX and OpenServer 6. case `/bin/uname -X | grep "^Machine"` in *486*) UNAME_MACHINE=i486 ;; *Pentium) UNAME_MACHINE=i586 ;; *Pent*|*Celeron) UNAME_MACHINE=i686 ;; esac echo ${UNAME_MACHINE}-unknown-sysv${UNAME_RELEASE}${UNAME_SYSTEM}${UNAME_VERSION} exit ;; i*86:*:3.2:*) if test -f /usr/options/cb.name; then UNAME_REL=`sed -n 's/.*Version //p' /dev/null >/dev/null ; then UNAME_REL=`(/bin/uname -X|grep Release|sed -e 's/.*= //')` (/bin/uname -X|grep i80486 >/dev/null) && UNAME_MACHINE=i486 (/bin/uname -X|grep '^Machine.*Pentium' >/dev/null) \ && UNAME_MACHINE=i586 (/bin/uname -X|grep '^Machine.*Pent *II' >/dev/null) \ && UNAME_MACHINE=i686 (/bin/uname -X|grep '^Machine.*Pentium Pro' >/dev/null) \ && UNAME_MACHINE=i686 echo ${UNAME_MACHINE}-pc-sco$UNAME_REL else echo ${UNAME_MACHINE}-pc-sysv32 fi exit ;; pc:*:*:*) # Left here for compatibility: # uname -m prints for DJGPP always 'pc', but it prints nothing about # the processor, so we play safe by assuming i386. echo i386-pc-msdosdjgpp exit ;; Intel:Mach:3*:*) echo i386-pc-mach3 exit ;; paragon:*:*:*) echo i860-intel-osf1 exit ;; i860:*:4.*:*) # i860-SVR4 if grep Stardent /usr/include/sys/uadmin.h >/dev/null 2>&1 ; then echo i860-stardent-sysv${UNAME_RELEASE} # Stardent Vistra i860-SVR4 else # Add other i860-SVR4 vendors below as they are discovered. echo i860-unknown-sysv${UNAME_RELEASE} # Unknown i860-SVR4 fi exit ;; mini*:CTIX:SYS*5:*) # "miniframe" echo m68010-convergent-sysv exit ;; mc68k:UNIX:SYSTEM5:3.51m) echo m68k-convergent-sysv exit ;; M680?0:D-NIX:5.3:*) echo m68k-diab-dnix exit ;; M68*:*:R3V[5678]*:*) test -r /sysV68 && { echo 'm68k-motorola-sysv'; exit; } ;; 3[345]??:*:4.0:3.0 | 3[34]??A:*:4.0:3.0 | 3[34]??,*:*:4.0:3.0 | 3[34]??/*:*:4.0:3.0 | 4400:*:4.0:3.0 | 4850:*:4.0:3.0 | SKA40:*:4.0:3.0 | SDS2:*:4.0:3.0 | SHG2:*:4.0:3.0 | S7501*:*:4.0:3.0) OS_REL='' test -r /etc/.relid \ && OS_REL=.`sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid` /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ && { echo i486-ncr-sysv4.3${OS_REL}; exit; } /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \ && { echo i586-ncr-sysv4.3${OS_REL}; exit; } ;; 3[34]??:*:4.0:* | 3[34]??,*:*:4.0:*) /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ && { echo i486-ncr-sysv4; exit; } ;; m68*:LynxOS:2.*:* | m68*:LynxOS:3.0*:*) echo m68k-unknown-lynxos${UNAME_RELEASE} exit ;; mc68030:UNIX_System_V:4.*:*) echo m68k-atari-sysv4 exit ;; TSUNAMI:LynxOS:2.*:*) echo sparc-unknown-lynxos${UNAME_RELEASE} exit ;; rs6000:LynxOS:2.*:*) echo rs6000-unknown-lynxos${UNAME_RELEASE} exit ;; PowerPC:LynxOS:2.*:* | PowerPC:LynxOS:3.[01]*:* | PowerPC:LynxOS:4.0*:*) echo powerpc-unknown-lynxos${UNAME_RELEASE} exit ;; SM[BE]S:UNIX_SV:*:*) echo mips-dde-sysv${UNAME_RELEASE} exit ;; RM*:ReliantUNIX-*:*:*) echo mips-sni-sysv4 exit ;; RM*:SINIX-*:*:*) echo mips-sni-sysv4 exit ;; *:SINIX-*:*:*) if uname -p 2>/dev/null >/dev/null ; then UNAME_MACHINE=`(uname -p) 2>/dev/null` echo ${UNAME_MACHINE}-sni-sysv4 else echo ns32k-sni-sysv fi exit ;; PENTIUM:*:4.0*:*) # Unisys `ClearPath HMP IX 4000' SVR4/MP effort # says echo i586-unisys-sysv4 exit ;; *:UNIX_System_V:4*:FTX*) # From Gerald Hewes . # How about differentiating between stratus architectures? -djm echo hppa1.1-stratus-sysv4 exit ;; *:*:*:FTX*) # From seanf@swdc.stratus.com. echo i860-stratus-sysv4 exit ;; i*86:VOS:*:*) # From Paul.Green@stratus.com. echo ${UNAME_MACHINE}-stratus-vos exit ;; *:VOS:*:*) # From Paul.Green@stratus.com. echo hppa1.1-stratus-vos exit ;; mc68*:A/UX:*:*) echo m68k-apple-aux${UNAME_RELEASE} exit ;; news*:NEWS-OS:6*:*) echo mips-sony-newsos6 exit ;; R[34]000:*System_V*:*:* | R4000:UNIX_SYSV:*:* | R*000:UNIX_SV:*:*) if [ -d /usr/nec ]; then echo mips-nec-sysv${UNAME_RELEASE} else echo mips-unknown-sysv${UNAME_RELEASE} fi exit ;; BeBox:BeOS:*:*) # BeOS running on hardware made by Be, PPC only. echo powerpc-be-beos exit ;; BeMac:BeOS:*:*) # BeOS running on Mac or Mac clone, PPC only. echo powerpc-apple-beos exit ;; BePC:BeOS:*:*) # BeOS running on Intel PC compatible. echo i586-pc-beos exit ;; SX-4:SUPER-UX:*:*) echo sx4-nec-superux${UNAME_RELEASE} exit ;; SX-5:SUPER-UX:*:*) echo sx5-nec-superux${UNAME_RELEASE} exit ;; SX-6:SUPER-UX:*:*) echo sx6-nec-superux${UNAME_RELEASE} exit ;; Power*:Rhapsody:*:*) echo powerpc-apple-rhapsody${UNAME_RELEASE} exit ;; *:Rhapsody:*:*) echo ${UNAME_MACHINE}-apple-rhapsody${UNAME_RELEASE} exit ;; *:Darwin:*:*) UNAME_PROCESSOR=`uname -p` || UNAME_PROCESSOR=unknown case $UNAME_PROCESSOR in unknown) UNAME_PROCESSOR=powerpc ;; esac echo ${UNAME_PROCESSOR}-apple-darwin${UNAME_RELEASE} exit ;; *:procnto*:*:* | *:QNX:[0123456789]*:*) UNAME_PROCESSOR=`uname -p` if test "$UNAME_PROCESSOR" = "x86"; then UNAME_PROCESSOR=i386 UNAME_MACHINE=pc fi echo ${UNAME_PROCESSOR}-${UNAME_MACHINE}-nto-qnx${UNAME_RELEASE} exit ;; *:QNX:*:4*) echo i386-pc-qnx exit ;; NSE-?:NONSTOP_KERNEL:*:*) echo nse-tandem-nsk${UNAME_RELEASE} exit ;; NSR-?:NONSTOP_KERNEL:*:*) echo nsr-tandem-nsk${UNAME_RELEASE} exit ;; *:NonStop-UX:*:*) echo mips-compaq-nonstopux exit ;; BS2000:POSIX*:*:*) echo bs2000-siemens-sysv exit ;; DS/*:UNIX_System_V:*:*) echo ${UNAME_MACHINE}-${UNAME_SYSTEM}-${UNAME_RELEASE} exit ;; *:Plan9:*:*) # "uname -m" is not consistent, so use $cputype instead. 386 # is converted to i386 for consistency with other x86 # operating systems. if test "$cputype" = "386"; then UNAME_MACHINE=i386 else UNAME_MACHINE="$cputype" fi echo ${UNAME_MACHINE}-unknown-plan9 exit ;; *:TOPS-10:*:*) echo pdp10-unknown-tops10 exit ;; *:TENEX:*:*) echo pdp10-unknown-tenex exit ;; KS10:TOPS-20:*:* | KL10:TOPS-20:*:* | TYPE4:TOPS-20:*:*) echo pdp10-dec-tops20 exit ;; XKL-1:TOPS-20:*:* | TYPE5:TOPS-20:*:*) echo pdp10-xkl-tops20 exit ;; *:TOPS-20:*:*) echo pdp10-unknown-tops20 exit ;; *:ITS:*:*) echo pdp10-unknown-its exit ;; SEI:*:*:SEIUX) echo mips-sei-seiux${UNAME_RELEASE} exit ;; *:DragonFly:*:*) echo ${UNAME_MACHINE}-unknown-dragonfly`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'` exit ;; *:*VMS:*:*) UNAME_MACHINE=`(uname -p) 2>/dev/null` case "${UNAME_MACHINE}" in A*) echo alpha-dec-vms ; exit ;; I*) echo ia64-dec-vms ; exit ;; V*) echo vax-dec-vms ; exit ;; esac ;; *:XENIX:*:SysV) echo i386-pc-xenix exit ;; i*86:skyos:*:*) echo ${UNAME_MACHINE}-pc-skyos`echo ${UNAME_RELEASE}` | sed -e 's/ .*$//' exit ;; i*86:rdos:*:*) echo ${UNAME_MACHINE}-pc-rdos exit ;; esac #echo '(No uname command or uname output not recognized.)' 1>&2 #echo "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" 1>&2 eval $set_cc_for_build cat >$dummy.c < # include #endif main () { #if defined (sony) #if defined (MIPSEB) /* BFD wants "bsd" instead of "newsos". Perhaps BFD should be changed, I don't know.... */ printf ("mips-sony-bsd\n"); exit (0); #else #include printf ("m68k-sony-newsos%s\n", #ifdef NEWSOS4 "4" #else "" #endif ); exit (0); #endif #endif #if defined (__arm) && defined (__acorn) && defined (__unix) printf ("arm-acorn-riscix\n"); exit (0); #endif #if defined (hp300) && !defined (hpux) printf ("m68k-hp-bsd\n"); exit (0); #endif #if defined (NeXT) #if !defined (__ARCHITECTURE__) #define __ARCHITECTURE__ "m68k" #endif int version; version=`(hostinfo | sed -n 's/.*NeXT Mach \([0-9]*\).*/\1/p') 2>/dev/null`; if (version < 4) printf ("%s-next-nextstep%d\n", __ARCHITECTURE__, version); else printf ("%s-next-openstep%d\n", __ARCHITECTURE__, version); exit (0); #endif #if defined (MULTIMAX) || defined (n16) #if defined (UMAXV) printf ("ns32k-encore-sysv\n"); exit (0); #else #if defined (CMU) printf ("ns32k-encore-mach\n"); exit (0); #else printf ("ns32k-encore-bsd\n"); exit (0); #endif #endif #endif #if defined (__386BSD__) printf ("i386-pc-bsd\n"); exit (0); #endif #if defined (sequent) #if defined (i386) printf ("i386-sequent-dynix\n"); exit (0); #endif #if defined (ns32000) printf ("ns32k-sequent-dynix\n"); exit (0); #endif #endif #if defined (_SEQUENT_) struct utsname un; uname(&un); if (strncmp(un.version, "V2", 2) == 0) { printf ("i386-sequent-ptx2\n"); exit (0); } if (strncmp(un.version, "V1", 2) == 0) { /* XXX is V1 correct? */ printf ("i386-sequent-ptx1\n"); exit (0); } printf ("i386-sequent-ptx\n"); exit (0); #endif #if defined (vax) # if !defined (ultrix) # include # if defined (BSD) # if BSD == 43 printf ("vax-dec-bsd4.3\n"); exit (0); # else # if BSD == 199006 printf ("vax-dec-bsd4.3reno\n"); exit (0); # else printf ("vax-dec-bsd\n"); exit (0); # endif # endif # else printf ("vax-dec-bsd\n"); exit (0); # endif # else printf ("vax-dec-ultrix\n"); exit (0); # endif #endif #if defined (alliant) && defined (i860) printf ("i860-alliant-bsd\n"); exit (0); #endif exit (1); } EOF $CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null && SYSTEM_NAME=`$dummy` && { echo "$SYSTEM_NAME"; exit; } # Apollos put the system type in the environment. test -d /usr/apollo && { echo ${ISP}-apollo-${SYSTYPE}; exit; } # Convex versions that predate uname can use getsysinfo(1) if [ -x /usr/convex/getsysinfo ] then case `getsysinfo -f cpu_type` in c1*) echo c1-convex-bsd exit ;; c2*) if getsysinfo -f scalar_acc then echo c32-convex-bsd else echo c2-convex-bsd fi exit ;; c34*) echo c34-convex-bsd exit ;; c38*) echo c38-convex-bsd exit ;; c4*) echo c4-convex-bsd exit ;; esac fi cat >&2 < in order to provide the needed information to handle your system. config.guess timestamp = $timestamp uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null` /bin/uname -X = `(/bin/uname -X) 2>/dev/null` hostinfo = `(hostinfo) 2>/dev/null` /bin/universe = `(/bin/universe) 2>/dev/null` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null` /bin/arch = `(/bin/arch) 2>/dev/null` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null` UNAME_MACHINE = ${UNAME_MACHINE} UNAME_RELEASE = ${UNAME_RELEASE} UNAME_SYSTEM = ${UNAME_SYSTEM} UNAME_VERSION = ${UNAME_VERSION} EOF exit 1 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "timestamp='" # time-stamp-format: "%:y-%02m-%02d" # time-stamp-end: "'" # End: