vor-0.5.5/0000755000175100017510000000000011310013613013112 5ustar jasonwoofjasonwoofvor-0.5.5/config.h.in0000644000175100017510000000672411310013233015144 0ustar jasonwoofjasonwoof/* config.h.in. Generated from configure.in by autoheader. */ /* Define to 1 if you have the `atexit' function. */ #undef HAVE_ATEXIT /* Define to 1 if you have the header file. */ #undef HAVE_INTTYPES_H /* Define to 1 if you have the `SDL_image' library (-lSDL_image). */ #undef HAVE_LIBSDL_IMAGE /* Define to 1 if you have the `SDL_mixer' library (-lSDL_mixer). */ #undef HAVE_LIBSDL_MIXER /* Define to 1 if your system has a GNU libc compatible `malloc' function, and to 0 otherwise. */ #undef HAVE_MALLOC /* Define to 1 if you have the header file. */ #undef HAVE_MEMORY_H /* Define to 1 if you have the `memset' function. */ #undef HAVE_MEMSET /* Define to 1 if you have the `sqrt' function. */ #undef HAVE_SQRT /* Define to 1 if stdbool.h conforms to C99. */ #undef HAVE_STDBOOL_H /* Define to 1 if you have the header file. */ #undef HAVE_STDDEF_H /* Define to 1 if you have the header file. */ #undef HAVE_STDINT_H /* Define to 1 if you have the header file. */ #undef HAVE_STDLIB_H /* Define to 1 if you have the `strdup' function. */ #undef HAVE_STRDUP /* Define to 1 if you have the header file. */ #undef HAVE_STRINGS_H /* Define to 1 if you have the header file. */ #undef HAVE_STRING_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_STAT_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_TYPES_H /* Define to 1 if you have the header file. */ #undef HAVE_UNISTD_H /* Define to 1 if the system has the type `_Bool'. */ #undef HAVE__BOOL /* Define to the address where bug reports for this package should be sent. */ #undef PACKAGE_BUGREPORT /* Define to the full name of this package. */ #undef PACKAGE_NAME /* Define to the full name and version of this package. */ #undef PACKAGE_STRING /* Define to the one symbol short name of this package. */ #undef PACKAGE_TARNAME /* Define to the version of this package. */ #undef PACKAGE_VERSION /* Define to 1 if you have the ANSI C header files. */ #undef STDC_HEADERS /* Define for Solaris 2.5.1 so the uint32_t typedef from , , or is not used. If the typedef were allowed, the #define below would cause a syntax error. */ #undef _UINT32_T /* Define for Solaris 2.5.1 so the uint8_t typedef from , , or is not used. If the typedef were allowed, the #define below would cause a syntax error. */ #undef _UINT8_T /* Define to `__inline__' or `__inline' if that's what the C compiler calls it, or to nothing if 'inline' is not supported under any name. */ #ifndef __cplusplus #undef inline #endif /* Define to the type of a signed integer type of width exactly 8 bits if such a type exists and the standard includes do not define it. */ #undef int8_t /* Define to rpl_malloc if the replacement function should be used. */ #undef malloc /* Define to `unsigned int' if does not define. */ #undef size_t /* Define to the type of an unsigned integer type of width exactly 16 bits if such a type exists and the standard includes do not define it. */ #undef uint16_t /* Define to the type of an unsigned integer type of width exactly 32 bits if such a type exists and the standard includes do not define it. */ #undef uint32_t /* Define to the type of an unsigned integer type of width exactly 8 bits if such a type exists and the standard includes do not define it. */ #undef uint8_t vor-0.5.5/file.h0000644000175100017510000000174511310013233014207 0ustar jasonwoofjasonwoof/* Variations on RockDodger * Copyright (C) 2004 Joshua Grams * * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #ifndef VOR_FILE_H #define VOR_FILE_H #include #include char *add_data_path(char *filename); bool find_files(void); FILE *open_score_file(char *mode); #endif // VOR_FILE_H vor-0.5.5/install-sh0000755000175100017510000003246411310013233015125 0ustar jasonwoofjasonwoof#!/bin/sh # install - install a program, script, or datafile scriptversion=2006-12-25.00 # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit=${DOITPROG-} if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. chgrpprog=${CHGRPPROG-chgrp} chmodprog=${CHMODPROG-chmod} chownprog=${CHOWNPROG-chown} cmpprog=${CMPPROG-cmp} cpprog=${CPPROG-cp} mkdirprog=${MKDIRPROG-mkdir} mvprog=${MVPROG-mv} rmprog=${RMPROG-rm} stripprog=${STRIPPROG-strip} posix_glob='?' initialize_posix_glob=' test "$posix_glob" != "?" || { if (set -f) 2>/dev/null; then posix_glob= else posix_glob=: fi } ' posix_mkdir= # Desired mode of installed file. mode=0755 chgrpcmd= chmodcmd=$chmodprog chowncmd= mvcmd=$mvprog rmcmd="$rmprog -f" stripcmd= src= dst= dir_arg= dst_arg= copy_on_change=false no_target_directory= usage="\ Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: --help display this help and exit. --version display version info and exit. -c (ignored) -C install only if different (preserve the last data modification time) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) ;; -C) copy_on_change=true;; -d) dir_arg=true;; -g) chgrpcmd="$chgrpprog $2" shift;; --help) echo "$usage"; exit $?;; -m) mode=$2 case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac shift;; -o) chowncmd="$chownprog $2" shift;; -s) stripcmd=$stripprog;; -t) dst_arg=$2 shift;; -T) no_target_directory=true;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac shift done if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dst_arg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dst_arg" shift # fnord fi shift # arg dst_arg=$arg done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call `install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then trap '(exit $?); exit' 1 2 13 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names starting with `-'. case $src in -*) src=./$src;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dst_arg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dst_arg # Protect names starting with `-'. case $dst in -*) dst=./$dst;; esac # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dst_arg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writeable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix='/';; -*) prefix='./';; *) prefix='';; esac eval "$initialize_posix_glob" oIFS=$IFS IFS=/ $posix_glob set -f set fnord $dstdir shift $posix_glob set +f IFS=$oIFS prefixes= for d do test -z "$d" && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # If -C, don't bother to copy if it wouldn't change the file. if $copy_on_change && old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && eval "$initialize_posix_glob" && $posix_glob set -f && set X $old && old=:$2:$4:$5:$6 && set X $new && new=:$2:$4:$5:$6 && $posix_glob set +f && test "$old" = "$new" && $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 then rm -f "$dsttmp" else # Rename the file to the real destination. $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. { # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { test ! -f "$dst" || $doit $rmcmd -f "$dst" 2>/dev/null || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; } } || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } fi || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-end: "$" # End: vor-0.5.5/COPYING0000644000175100017510000004311011310013233014142 0ustar jasonwoofjasonwoof GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) year name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. vor-0.5.5/dust.c0000644000175100017510000000202511310013233014232 0ustar jasonwoofjasonwoof#include #include #include "vorconfig.h" #include "globals.h" #include "dust.h" #include "float.h" #include "mt.h" struct dust_mote { float x,y,z; Uint16 color; }; struct dust_mote motes[N_DUST_MOTES]; void init_dust(void) { int i, b; for(i=0; iformat, b, b, b); } } void move_dust(void) { int i; float xscroll = screendx * t_frame; float yscroll = screendy * t_frame; for(i=0; ipixels; for(i=0; ipitch/2*(int)motes[i].y + (int)motes[i].x] = motes[i].color; } } vor-0.5.5/INSTALL0000644000175100017510000000437211310013233014147 0ustar jasonwoofjasonwoofREQUIREMENTS vor requires the following libraries to build/run: sdl http://www.libsdl.org/download-1.2.php sdl_mixer http://www.libsdl.org/projects/SDL_mixer/ sdl_image http://www.libsdl.org/projects/SDL_image/ If you are building from git, (or editing the graphics) you will also need: povray http://www.povray.org/ netpbm http://netpbm.sourceforge.net/ autoconf version 2.63 or greater BUILDING A RELEASE (see BUILDING FROM GIT if you don't have a release tarball) change to the source directory and run this: ./configure && make Unless there are errors, you should be able to run the game from the source directory like this: ./vor BUILDING FROM GIT 1) Make sure you have the extra dependencies first. If you want to avoid installing povray and/or netpbm, you can simply the data/ directory from a recent release. Run "autoconf". Continue as normal with the BUILDING A RELEASE section above. BUILDING FOR WINDOWS Using mingw32 packages, you can use Linux to cross-compile a binary for Windows. Below is the recommended way to achieve this: 1) Install Fedora 11, and get up to date with "yum upgrade" 2) run as root: yum install mingw32-SDL_mixer mingw32-SDL_image 3) change to the VoR source directory 4) If you need to build the graphics (eg if you edited them, or if you're not using a release tarball) then run: ./configure && make graphics 5) run: mingw32-configure && make 6) make a directory with vor.exe, data/ and the following files from /usr/i686-pc-mingw32/sys-root/mingw/bin/: SDL.dll SDL_image.dll SDL_mixer.dll libjpeg-62.dll libpng12-0.dll zlib1.dll 7) (optional) change to that directory, and test like so: wine ./vor.exe 8) zip up that new directory and try it out on a Windows install. RUNNING "./vor" After building you should have an executable called "vor" in the current (source) directory. You can run this here, "./vor" INSTALLING You can run "make install" to install vor. If you're installing system-wide (for example, to the default install location of /usr/local) you'll need to run this as root. You can specify an alternative install location with the --prefix= argument to ./configure. See the output of: ./configure --help for more information. vor-0.5.5/font_template.txt0000644000175100017510000007607711310013233016533 0ustar jasonwoofjasonwoof....##................##..##....................................##.....................................###..................##....................##..............##............................................................................................................................................##..................##.................####................####....................#.............########..............####..............########..............####................####............................................................#..................................#....................####................####.................##...............#####.................####..............######..............########............########..............####..............##....##............########...............######...........##....##............##..................##....##............##....##..............####..............######................####..............######................####..............########............##....##............##....##............##....##............##....##............##....##............########.............######..................................######................##.....................................##....................................##............................................##...................................####.................................##..........................................................##...................####...........................................................................................................................................................................................................................................................................................................####...............##...............####.................###..##. ....##................##..##................##.##.............######..............###..##.............##.##.................##...................##................##..........................................................................................................................##..............####................###................##..##..............##..##..................##.............##...................##..##...................##.............##..##..............##..##..........................................................##..................................##..................##..##..............##..##...............####..............##..##...............##..##.............##...##.............##..................##...................##..##.............##....##...............##....................##.............##....##............##..................##....##............###...##.............##..##.............##...##..............##..##.............##...##..............##..##................##...............##....##............##....##............##....##............##....##............##....##..................##.............##..................##......................##...............####.....................................##...................................##............................................##..................................##..##................................##....................###....................###............##.....................##..........................................................................................................................................................................................................................................................................................................##..................##..................##...............##.##.##. ....##................##..##................##.##............##.##.##............##.##.##.............##.##.................##..................##..................##.........................................................................................................................##.............##..##..............####...............##....##............##....##................###.............##..................##....#...................##............##....##............##....##........................................................##....................................##................##....##............##....##.............##..##.............##...##.............##....##............##....##............##..................##..................##....##............##....##...............##....................##.............##...##.............##..................###..###............###...##............##....##............##....##............##....##............##....##............##....##...............##...............##....##............##....##............##....##.............##..##..............##..##...................##.............##..................##......................##..............##..##.....................................##..................................##............................................##..................................##..##................................##....................###....................###............##.....................##.............................................................................................................................................................##...........................................................................................................................................##..................##..................##...............##..###.. ....##.................#..#.................##.##............##.##...............##.####..............##.##.................##..................##..................##................##..##................##................................................................................##..............##..##.............##.##...............##....##............##....##...............####.............##..................##.......................##.............##....##............##....##.......................................................##......................................##...............##....##............##..####.............##..##.............##...##.............##..................##....##............##..................##..................##..................##....##...............##....................##.............##...##.............##..................###..###............####..##............##....##............##....##............##....##............##....##............##.....................##...............##....##............##....##............##....##.............##..##..............##..##..................##..............##...................##.....................##.............##....##........................................................................##............................................##..................................##....................................##..........................................................##.....................##.............................................................................................................................................................##...........................................................................................................................................##..................##..................##........................ ....##....................................########...........##.##................###.##..............####..................#..................##....................##...............##..##................##................................................................................##.............##....##...............##.....................##..................##..............##.##.............##..................##.......................##.............##....##............##....##......................................................##................########................##..............##....##............##.#####............##....##............##...##.............##..................##....##............##..................##..................##..................##....##...............##....................##.............##..##..............##..................########............####..##............##....##............##....##............##....##............##....##............##.....................##...............##....##.............##..##.............##....##..............####................####..................##...............##...................##.....................##.............................................................................................##............................................##..................................##....................................##..........................................................##.....................##.............................................................................................................................................................##...........................................................................................................................................##..................##..................##........................ ....##.....................................##.##.............##.##...................##................##......................................##....................##................####.................##...............................................................................##..............##....##...............##.....................##.................##..............##..##.............##.###..............##.###..................##...............##..##.............##....##...............###.................###...............##..........................................##..................##.............##.##.##............##....##............##..##..............##..................##....##............##..................##..................##..................##....##...............##....................##.............##..##..............##..................##.##.##............##.##.##............##....##............##....##............##....##............##....##.............##....................##...............##....##.............##..##.............##.##.##..............####................####..................##...............##....................##....................##...........................................................................#####.............##.###................#####...............###.##..............####..............######...............#####.#............##.###................#.#....................#.#............##...##................##...............#.##.##.............##.###................####..............##.###................###.##............##.####..............######.............######..............##....##............##....##............##....##............##....##............##....##.............#######...............##..................##..................##........................ ....##.....................................##.##..............######.................##...............###......................................##....................##..............########............########................................########....................................##..............##....##...............##....................##................###..............##...##.............###..##.............###..##.................##................####...............##..###...............###.................###..............##............................................##................##..............##.##.##............##....##............######..............##..................##....##............######..............######..............##..####............########...............##....................##.............#####...............##..................##.##.##............##.##.##............##....##............##...##.............##....##............##...##...............####.................##...............##....##.............##..##.............##.##.##...............##..................##..................##................##....................##....................##..........................................................................##...##............###..##..............##...##.............##..###.............##..##...............##................##...###............###..##................##.....................##............##..##.................##...............########............###..##..............##..##.............###..##..............##..###.............###..##............##....##..............##................##....##............##....##............##....##.............##..##.............##....##..................##............####...................##...................####..................... ....##.....................................##.##................##.##...............##...............##.##.....................................##....................##................####.................##..............................................................................##...............##....##...............##..................###...................##.............##...##...................##............##....##...............##................##..##...............###.##.....................................................##..........................................##................##...............##.##.##............########............##...##.............##..................##....##............##..................##..................##....##............##....##...............##....................##.............##..##..............##..................##.##.##............##..####............##....##............######..............##....##............######...................##................##...............##....##..............####..............##.##.##..............####.................##.................##.................##.....................##...................##...............................................................................##............##....##............##..................##....##............##....##..............##................##...##.............##....##...............##.....................##............##.##..................##...............##.##.##............##....##............##....##............##....##............##....##.............##.................##....................##................##....##.............##..##.............##....##..............####..............##....##.................##................##..................##..................##........................ ....##...................................########...............##.##...............##...............##..##.##.................................##....................##...............##..##................##..............................................................................##...............##....##...............##.................##......................##............########..................##............##....##...............##...............##....##..................##......................................................##........................................##.................##...............##.####.............##....##............##....##............##..................##....##............##..................##..................##....##............##....##...............##....................##.............##..##..............##..................##.##.##............##..####............##....##............##..................##....##............##..##....................##...............##...............##....##..............####..............##.##.##..............####.................##.................##.................##.....................##...................##..........................................................................#######............##....##............##..................##....##............########..............##................##...##.............##....##...............##.....................##............####...................##...............##.##.##............##....##............##....##............##....##............##....##.............##..................######...............##................##....##.............##..##.............##.##.##...............##...............##....##................##.................##..................##..................##........................ ..........................................##.##.................##.##..............##.###............##...###...................................##..................##................##..##................##.............................................................................##.................##..##................##................##.................##....##.................##...................##............##....##..............##................##....##..................##.......................................................##...............########...............##..................##...............##..##..............##....##............##....##............##..................##....##............##..................##..................##....##............##....##...............##...............##...##.............##...##.............##..................##....##............##...###............##....##............##..................##.##.##............##...##...................##...............##...............##....##..............####..............###..###.............##..##................##................##..................##......................##..................##.........................................................................##....##............##....##............##..................##....##............##....................##................##...##.............##....##...............##.....................##............#####..................##...............##.##.##............##....##............##....##............##....##............##....##.............##.......................##..............##................##....##..............####..............##.##.##...............##...............##....##...............##..................##..................##..................##........................ ..........................................##.##..............##.##.##..............####.##...........##...##....................................##..................##..................................................................................................###................##.................##..##................##...............##..................##....##.................##.............##....##............##....##..............##................##....##.............#....##........................................................##....................................##....................................##..................##....##............##....##............##....##............##....##............##..................##..................##....##............##....##...............##...............##...##.............##...##.............##..................##....##............##...###............##....##............##..................##..####............##...##.............##....##...............##...............##....##...............##...............###..###.............##..##................##...............##...................##......................##..................##.........................................................................##....##............##....##............##..................##....##............##....................##.................#####..............##....##...............##.....................##............##..##.................##...............##.##.##............##....##............##....##............##....##............##....##.............##.......................##..............##................##....##..............####..............##.##.##..............####..............##....##..............##...................##..................##..................##........................ ....##....................................##.##...............######..............##.##.##...........###.####....................................##................##...........................................................###.....................................###...............##...................####.................##...............##...................##..##..................##..............##..##..............##..##..............##..................##..##..............##..##................###.................###...................##..................................##....................##................##...##............##....##............##...##..............##..##.............##...##.............##..................##...................##..###............##....##...............##................##.##..............##....##............##..................##....##............##....##.............##..##.............##...................##..##.............##....##.............##..##................##................##..##................##...............##....##............##....##...............##...............##...................##.......................##.................##.........................................................................##....##............###..##..............##...##.............##..###.............##...##..............##................##..................##....##...............##.....................##............##...##................##...............##.##.##............##....##.............##..##.............###..##..............##..###.............##.................##....##..............##..##.............##..###...............##...............########.............##..##..............##..###.............##....................##..................##..................##........................ ....##..........................................................##................##..###.............####..##....................................##..............##............................................................###.....................................###...............##....................##...............########............########..............####...................##...............####................####...............##...................####................####.................###.................###....................#..................................#.....................##.................#####.............##....##............######................####..............######..............########............##....................####.#............##....##............########..............###...............##....##............########............##....##............##....##..............####..............##....................#####.............##....##..............####.................##.................####.................##...............##....##............##....##...............##...............########.............######...................##.............######..........................................................................#####.#............##.###................#####...............###.##..............#####...............##.................######.............##....##............########..................##............##....##............########............##.##.##............##....##..............####..............##.###................###.##.............##..................######................####...............###.##...............##................##..##.............##....##..............###.##.............#######................####...............##...............####......................... ...............................................................................................................................................................................................................................###.........................................................................................................................................................................................................................................................................................................###.........................................................................................................................................................................................................................................................................................................................................................................................................................................................##................................................................................................................................................................................................................................................................................#########.......................................................................................................................................................##....##.....................................................##...##................................................................................................................##........................##..............................................................................................................................................................##..................................................................................................... .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................##....##.....................................................##...##................................................................................................................##........................##........................................................................................................................................................##....##..................................................................................................... .........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................##....##.....................................................##...##................................................................................................................##........................##.........................................................................................................................................................##..##...................................................................................................... ..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................######.......................................................#####.................................................................................................................##........................##..........................................................................................................................................................####....................................................................................................... vor-0.5.5/rocks.c0000644000175100017510000001102011310013233014367 0ustar jasonwoofjasonwoof#include #include #include #include #include "common.h" #include "vorconfig.h" #include "file.h" #include "globals.h" #include "mt.h" #include "rocks.h" #include "sprite.h" static struct rock rocks[MAXROCKS]; static struct rock prototypes[NROCKS]; // timers for rock generation. static float rtimers[4]; uint32_t nrocks = NORMAL_I_ROCKS; uint32_t initial_rocks = NORMAL_I_ROCKS; uint32_t final_rocks = NORMAL_F_ROCKS; float nrocks_timer = 0; float nrocks_inc_ticks = 2*60*20/(NORMAL_F_ROCKS-NORMAL_I_ROCKS); // constants for rock generation. #define KH (32*20) // 32 s for a speed=1 rock to cross the screen horizontally. #define KV (24*20) // 24 s for a speed=1 rock to cross the screen vertically. #define RDX 2.5 // range for rock dx values (+/-) #define RDY 2.5 // range for rock dy values (+/-) void reset_rocks(void) { nrocks = initial_rocks; nrocks_inc_ticks = 2*60*20/(final_rocks-initial_rocks); nrocks_timer = 0; } #define ROCK_LEN sizeof("rockXX.png") void load_rocks(void) { int i; char a[ROCK_LEN]; for(i=0; i= nrocks_inc_ticks) { nrocks_timer -= nrocks_inc_ticks; nrocks++; } } rock_sides(ti, rmin, rmax); // increment timers for(i=0; i<4; i++) rtimers[i] += ti[i]*t_frame; // generate rocks for(i=0; i<4; i++) { while(rtimers[i] >= 1) { rtimers[i] -= 1; if(!free_sprites[ROCK]) return; // sorry, we ran out of rocks! r = (struct rock *) remove_sprite(&free_sprites[ROCK]); type = urnd() % NROCKS; *r = prototypes[type]; r->type = type; switch(i) { case RIGHT: r->x = XSIZE; r->y = frnd()*(YSIZE + r->image->h); r->dx = -weighted_rnd_range(rmin[i], rmax[i]) + screendx; r->dy = RDY*crnd(); break; case LEFT: r->x = -r->image->w; r->y = frnd()*(YSIZE + r->image->h); r->dx = weighted_rnd_range(rmin[i], rmax[i]) + screendx; r->dy = RDY*crnd(); break; case BOTTOM: r->x = (frnd()*(XSIZE + r->image->w)) - r->image->w; r->y = YSIZE; r->dx = RDX*crnd(); r->dy = -weighted_rnd_range(rmin[i], rmax[i]) + screendy; break; case TOP: r->x = (frnd() * (XSIZE + r->image->w)) - r->image->w; r->y = -r->image->h; r->dx = RDX*crnd(); r->dy = weighted_rnd_range(rmin[i], rmax[i]) + screendy; break; } add_sprite(SPRITE(r)); } } } void draw_rocks(void) { int i; for(i=0; i * * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #include #include #include #include #include #include "font.h" #include "common.h" #include "vorconfig.h" #include "file.h" #include "globals.h" #include "score.h" // High score table // below are the defaults (when there's no high score file) in miliseconds struct highscore g_scores[2][N_SCORES] = { { {120000,"-"}, {105000,"-"}, { 90000,"-"}, { 75000,"-"}, { 60000,"-"}, { 50000,"-"}, { 40000,"-"}, { 30000,"-"} }, { {120000,"-"}, {105000,"-"}, { 90000,"-"}, { 75000,"-"}, { 60000,"-"}, { 50000,"-"}, { 40000,"-"}, { 30000,"-"} } }; static char *titles[2] = { "Normal\n", "Easy\n" }; int g_easy = 0; int cur_score = -1; // which score we're currently entering. void read_high_score_table() { FILE *f; int i, j; f = open_score_file("r"); if(f) { // If the file exists, read from it for(j=0; j<2; j++) { fscanf(f, titles[j]); for(i = 0; i g_scores[g_easy][i].score) return i; } return -1; } int new_high_score(int score) { cur_score = -1; // assume not a new high score if(score <= g_scores[g_easy][LOW_SCORE].score) return false; read_high_score_table(); cur_score = score_rank(score); return cur_score >= 0; } int insert_score(int score) { int i; // Move all lower scores down a notch, losing lowest score forever. if(strcmp(g_scores[g_easy][cur_score].name, "-") != 0) for(i=LOW_SCORE; i>cur_score; i--) g_scores[g_easy][i] = g_scores[g_easy][i-1]; // initialize new score entry. g_scores[g_easy][cur_score].score = score; for(i=0; i<32; i++) g_scores[g_easy][cur_score].name[i] = 0; return true; } int snprintscore(char *s, size_t n, int score) { int min = score/60000; int sec = score/1000%60; int tenths = score%1000/100; if(min) { return snprintf(s, n, "%2d:%.2d.%d", min, sec, tenths); } else { return snprintf(s, n, " %2d.%d", sec, tenths); } } void show_score(void) { char s[16]; int r = snprintf(s, 16, "Time: "); snprintscore(s+r, 16-r, score); font_write(XSIZE-250, 0, s); } void display_scores(uint32_t x, uint32_t y) { char t[1024]; int i,h = font_height(); int display_cursor = (SDL_GetTicks() / CURSOR_BLINK_TIME) % 2; font_write(x+30, y, "High scores"); y += h; if(g_easy) font_write(x+75,y,"(easy)"); else font_write(x+60,y,"(normal)"); for(i = 0; isym == SDLK_BACKSPACE) { if(n > 0) name[--n]=0; } else { if(key->sym == SDLK_RETURN || key->sym == SDLK_KP_ENTER) { SDL_EnableUNICODE(0); cur_score = -1; if(n == 0) { name[0] = '-'; } return false; } else if(n < 12) { if(key->unicode >= 32 && key->unicode <= 126) { name[n++] = key->unicode; } } // else drop it } return true; } vor-0.5.5/sprite.c0000644000175100017510000002401111310013233014560 0ustar jasonwoofjasonwoof#include #include #include #include "vorconfig.h" #include "common.h" #include "globals.h" #include "sprite.h" #include "rocks.h" SDL_Surface *load_image(char *filename); void load_ship(void); // 2 sets of sprites, sorted by position static Sprite **sprites[2] = { NULL, NULL }; // which set are we using? static int set = 0; // size of squares into which sprites are sorted. static int grid_size = 0; // screen size in grid squares. static int gw = 0, gh = 0; // lists of free sprites, by type. Sprite *free_sprites[N_TYPES]; static void get_shape(Sprite *s) { int x, y; uint16_t *px, transp; uint32_t bits = 0, bit, *p; s->area = 0; if(s->image->format->BytesPerPixel != 2) { fprintf(stderr, "get_shape(): not a 16-bit image!\n"); exit(1); } s->w = s->image->w; s->h = s->image->h; grid_size = max(grid_size, max(s->w, s->h)); s->mask_w = ((s->w+31)>>5); s->mask = malloc(s->mask_w*s->h*sizeof(uint32_t)); if(!s->mask) { fprintf(stderr, "get_shape(): can't allocate bitmask.\n"); exit(1); } if(SDL_MUSTLOCK(s->image)) { SDL_LockSurface(s->image); } px = s->image->pixels; transp = s->image->format->colorkey; p = s->mask; for(y=0; yimage->h; y++) { bit = 0; for(x=0; ximage->w; x++) { if(!bit) { bits = 0; bit = 0x80000000; } if(*px++ != transp) { bits |= bit; s->area++; } bit >>= 1; if(!bit || x == s->image->w - 1) { *(p++) = bits; } } px = (uint16_t *) ((uint8_t *) px + s->image->pitch - 2*s->image->w); } if(SDL_MUSTLOCK(s->image)) { SDL_UnlockSurface(s->image); } } void load_sprite(Sprite *s, char *filename) { s->image = load_image(filename); if(s->image) get_shape(s); } static void load_sprites(void) { load_ship(); load_rocks(); } void init_sprites(void) { load_sprites(); grid_size = grid_size * 3 / 2; gw = (XSIZE + 2*grid_size) / grid_size; // -grid-size to XSIZE inclusive (so sprites can be just off either edge) gh = (YSIZE + 2*grid_size) / grid_size; sprites[0] = malloc(2 * gw * gh * sizeof(Sprite *)); sprites[1] = (void *)sprites[0] + gw * gh * sizeof(Sprite *); if(!sprites[0]) { fprintf(stderr, "init_sprites(): can't allocate grid squares.\n"); exit(1); } memset(sprites[0], 0, 2 * gw * gh * sizeof(Sprite *)); set = 0; } static inline Sprite ** square(int x, int y, int set) { int b = (x+grid_size)/grid_size + gw*((y+grid_size)/grid_size); if(b >= gw*gh || b < 0) { fprintf(stderr, "square(%i, %i, %i) = %i\n", x, y, set, b); ((int*)0)[0] = 0; } return &sprites[set][b]; } void add_sprite(Sprite *s) { insert_sprite(square(s->x, s->y, set), s); } void reset_sprites(void) { int i; for(i=0; itype], s); s->flags = 0; } } void move_sprite(Sprite *s) { if(s->flags & MOVE) { s->x += (s->dx - screendx)*t_frame; s->y += (s->dy - screendy)*t_frame; } } void sort_sprite(Sprite *s) { // clip it, or sort it into the other set of sprites. if(s->x + s->w < 0 || s->x >= XSIZE || s->y + s->h < 0 || s->y >= YSIZE) { insert_sprite(&free_sprites[s->type], s); s->flags = 0; } else insert_sprite(square(s->x, s->y, 1-set), s); } void move_sprites(void) { int sq; Sprite **head; // Move all the sprites for(sq=0; sq> 5; uint32_t abits; for(i=0; i> (32-bit); if(abits & *bmask++) return true; } abits = *amask << bit; if(abits & *bmask) return true; return false; } // xov: number of bits/pixels of horizontal overlap // yov: number of bits/pixels of vertical overlap static int mask_collide(int xov, int yov, Sprite *a, Sprite *b) { int y; int xoffset = a->w - xov; int word = xoffset >> 5, bit = xoffset & 31; uint32_t *amask = a->mask, *bmask = b->mask; if(yov > 0) { amask = a->mask + ((a->h - yov) * a->mask_w) + word; bmask = b->mask; } else { yov = -yov; amask = a->mask + word; bmask = b->mask + ((b->h - yov) * b->mask_w); } for(y=0; ymask_w; bmask += b->mask_w; } return 0; } int collide(Sprite *a, Sprite *b) { int dx, dy, xov, yov; if(!COLLIDES(a) || !COLLIDES(b)) return false; if(b->x < a->x) { Sprite *tmp = a; a = b; b = tmp; } dx = b->x - a->x; dy = b->y - a->y; xov = max(min(a->w - dx, b->w), 0); if(dy >= 0) yov = max(min(a->h - dy, b->h), 0); else yov = -max(min(b->h - -dy, a->h), 0); if(xov == 0 || yov == 0) return false; else return mask_collide(xov, yov, a, b); } void collide_with_list(Sprite *s, Sprite *list) { for(; list; list=list->next) if(collide(s, list)) do_collision(s, list); } void collisions(void) { int i, end = gw*gh; Sprite *s; for(i=0; inext) { collide_with_list(s, s->next); if(i+1 < end) collide_with_list(s, sprites[set][i+1]); if(i+gw < end) collide_with_list(s, sprites[set][i+gw]); if(i+gw+1 < end) collide_with_list(s, sprites[set][i+gw+1]); } } } int pixel_collide(Sprite *s, int x, int y) { uint32_t pmask; if(!COLLIDES(s)) return false; if(x < s->x || y < s->y || x >= s->x + s->w || y >= s->y + s->h) return 0; x -= s->x; y -= s->y; pmask = 0x80000000 >> (x&0x1f); return s->mask[(y*s->mask_w) + (x>>5)] & pmask; } Sprite * pixel_hit_in_square(Sprite *r, float x, float y) { for(; r; r=r->next) { if(COLLIDES(r) && pixel_collide(r, x, y)) return r; } return 0; } Sprite * pixel_collides(float x, float y) { int l, t; Sprite **sq; Sprite *ret; l = (x + grid_size) / grid_size; t = (y + grid_size) / grid_size; sq = &sprites[set][l + t*gw]; if((ret = pixel_hit_in_square(*sq, x, y))) return ret; if(l > 0 && (ret = pixel_hit_in_square(*(sq-1), x, y))) return ret; if(t > 0 && (ret = pixel_hit_in_square(*(sq-gw), x, y))) return ret; if(l > 0 && t > 0 && (ret = pixel_hit_in_square(*(sq-1-gw), x, y))) return ret; return 0; } float sprite_mass(Sprite *s) { if(s->type == SHIP) return s->area; else if(s->type == ROCK) return 3 * s->area; else return 0; } /* * BOUNCE THEORY * * ****************** In 1 Dimension ***************** * * For now we will imagine bouncing A and B off each other in 1 dimension (along * a line). We can safely save the other dimension for later. * * A and B are the same weight, and are both traveling 1m/sec, to collide right * at the origin. With perfect bounciness, their full momentum is reversed. * * If we cut the weight of A down by half, then the center of our colision will * drift towards A (the speeds of A and B are not simply reversed as in our last * example.) However, there is always a place between A and B on the line (I'll * call it x) such that the speeds of A and B relative to x, are simply * reversed. Thus we can find the new speed for A like so: * * new A = x -(A - x) * * new B = x -(B - x) * * or, simply: * * new A = 2x - A * * new B = 2x - B * * * this point x is the sort of center of momentum. If, instead of bouncing, A * and B just globbed together, x would be center of the new glob. * * x is the point where there's an equal amount of force coming in from both * sides. ie the weighted average of the speeds of A and B. * * average force = (A force + B force) / total mass * * x.speed = (a.speed * a.mass + b.speed * b.mass) / (a.mass + b.mas) * * then we apply the formula above for calculating the new A and B. * * * * * ****************** In 2 Dimensions ***************** * * OK, that's how we do it in 1D. Now we need to deal with 2D. * * Imagine (or draw) the two balls just as they are bouncing off each other. * Imagine drawing a line through the centers of the balls. The balls are * exerting force on each other only along this axis. So if we rotate * everything, we can do our earlier 1D math along this line. * * It doesn't matter what direction the balls are going in, they only exert * force on each other along this line. What we will do is to compute the part * of the balls' momentum that is going along this line, and bounce it according * to our math above. The other part is unaffected by the bounce, and we can * just leave it alone. * * To get this component of the balls' momentum, we can use the dot product. * * dot(U, V) = length(U) * length(V) * cos(angle between U and V) * * If U is a length 1 vector, then dot(U, V) is the length of the component of V * in the direction of U. So the components of V are: * * U * dot(U, V) parallel to U * * V - U * dot(U, V) perpendicular to U * * To do the actual bounce, we compute the unit vector between the center of the * two balls, compute the components of the balls' speeds along this vector (A * and B), and then bounce them according to the math above: * * new A = 2x - A * * new B = 2x - B * * But we rewrite it in relative terms: * * new A = A + 2(x-A) * * new B = B + 2(x-B) */ void bounce(Sprite *a, Sprite *b) { float x, y, n; // (x, y) is unit vector from a to b. float va, vb; // va, vb are balls' speeds along (x, y) float ma, mb; // ma, mb are the balls' masses. float vc; // vc is the "center of momentum" // (x, y) is unit vector pointing from A's center to B's center. x = (b->x + b->w / 2) - (a->x + a->w / 2); y = (b->y + b->h / 2) - (a->y + a->h / 2); n = sqrt(x*x + y*y); x /= n; y /= n; // velocities along (x, y) va = x*a->dx + y*a->dy; vb = x*b->dx + y*b->dy; if(vb-va > 0) return; // don't bounce if we're already moving away. // get masses and compute "center" speed ma = sprite_mass(a); mb = sprite_mass(b); vc = (va*ma + vb*mb) / (ma+mb); // bounce off the center speed. a->dx += 2*x*(vc-va); a->dy += 2*y*(vc-va); b->dx += 2*x*(vc-vb); b->dy += 2*y*(vc-vb); } vor-0.5.5/file.c0000644000175100017510000000537411310013233014204 0ustar jasonwoofjasonwoof/* Variations on RockDodger * Copyright (C) 2004 Joshua Grams * * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #include #include #include #ifndef WIN32 # include #endif #include #include #include "common.h" #include "vorconfig.h" #include "file.h" #ifdef WIN32 #define DATA_DIR "data\\" char * add_data_path(char *filename) { char *s; if(!filename) return filename; s = malloc(sizeof(DATA_DIR)+strlen(filename)); if(s) { strcpy(s, DATA_DIR); strcpy(s+sizeof(DATA_DIR)-1, filename); } return s; } bool find_files(void) { return true; } FILE *open_score_file(char *mode) { return fopen("scores", mode); } #else /* !WIN32 */ char *g_data_dir; char *g_score_file; static char * add_path(char *path, char *file) { char *s; size_t plen, flen; if(!path || !file) return NULL; plen = strlen(path); flen = strlen(file); s = malloc(2+plen+flen); if(!s) return NULL; memcpy(s, path, plen); s[plen] = '/'; memcpy(s+plen+1, file, flen+1); return s; } char * add_data_path(char *filename) { return add_path(g_data_dir, filename); } static bool is_dir(char *dirname) { struct stat buf; stat(dirname, &buf); return S_ISDIR(buf.st_mode); } static bool find_data_dir(void) { int i; char *data_options[3] = { getenv("VOR_DATA"), "data", DATA_PREFIX }; for(i=0; i<3; i++) { if(!data_options[i]) continue; g_data_dir = strdup(data_options[i]); if(is_dir(g_data_dir)) return true; } fprintf(stderr, "Can't find VoR data! Tried:\n"); for(i=0; i<3; i++) { if(data_options[i]) fprintf(stderr, "\t%s\n", data_options[i]); } return false; } static bool find_score_file(void) { char *dir, *s; /* in case we get called twice */ if(g_score_file) return true; dir = getenv("HOME"); if(!dir) return false; s = add_path(dir, ".vor-scores"); if(s) { g_score_file = s; return true; } else return false; } bool find_files(void) { return find_data_dir() && find_score_file(); } FILE * open_score_file(char *mode) { if(!g_score_file) return NULL; return fopen(g_score_file, mode); } #endif /* !WIN32 */ vor-0.5.5/score.h0000644000175100017510000000252011310013233014373 0ustar jasonwoofjasonwoof/* Variations on RockDodger * Copyright (C) 2004 Joshua Grams * * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #ifndef VOR_SCORE_H #define VOR_SCORE_H #include #include #include #define N_SCORES 8 #define LOW_SCORE (N_SCORES-1) struct highscore { int score; char name[32]; }; extern struct highscore g_scores[2][N_SCORES]; void read_high_score_table(void); void write_high_score_table(void); int snprintscore(char *s, size_t n, int score); void show_score(void); void display_scores(uint32_t x, uint32_t y); int new_high_score(int score); int insert_score(int score); int process_score_input(SDL_keysym *key); #endif // VOR_SCORE_H vor-0.5.5/ship.pov0000644000175100017510000000224011310013233014577 0ustar jasonwoofjasonwoof#include "colors.inc" #include "metals.inc" #ifndef(xr) #declare xr = 0; #end #ifndef(yr) #declare yr = 0; #end #declare r = 2.0; #declare r2 = 2.01; #declare cr = 1/16; camera { up <0, 1, 0> right <1, 0, 0> location <0, 0, -r/sin(radians(15))> angle 30 look_at <0, 0, 0> } light_source { <-500, 500, -700> White } #declare xring = intersection { difference { sphere { 0, r } sphere { 0, r-cr } } box { <-0.25, -r2, -r2>, <0.25, r2, r2> } } #declare yring = intersection { difference { sphere { 0, r } sphere { 0, r-cr } } box { <-r2, -0.25, -r2>, } } #declare zring = intersection { difference { sphere { 0, r } sphere { 0, r-cr } } box { <-r2, -r2, -0.25>, } } union { sphere { 0, r-0.1 } intersection { sphere { 0, r-0.09 } box { <0, 0, -r2>, } pigment { rgbf < 0.5, 0.75, 0.5, 0.6 > } } object { xring } object { yring } texture { pigment { rgb < 0.75, 0.75, 1.0 > } finish { ambient 0.35 brilliance 2 diffuse 0.3 metallic specular 0.6 roughness 1/60 reflection 0.25 } normal { bumps 0.1 scale 0.25 } } rotate rotate <0, yr*360/32, 0> } vor-0.5.5/Makefile.in0000644000175100017510000001174211310013233015162 0ustar jasonwoofjasonwoof# Variations on Rockdodger # Copyright (C) 2004 Joshua Grams # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA SHELL = /bin/sh VPATH = @srcdir@ srcdir = @srcdir@ prefix = @prefix@ exec_prefix = @exec_prefix@ datarootdir = @datarootdir@ datadir = @datadir@ pkgdatadir = $(datadir)/@PACKAGE_TARNAME@ bindir = @bindir@ CC = @CC@ CPPFLAGS = @CPPFLAGS@ CFLAGS = $(CPPFLAGS) @CFLAGS@ LDFLAGS = @LDFLAGS@ LIBS = @LIBS@ INSTALL = @INSTALL@ exe_name = @PACKAGE_TARNAME@@EXEEXT@ paths := -DDATA_PREFIX=\"$(pkgdatadir)\" SDL_CFLAGS := @SDL_CFLAGS@ SDL_LIBS := @SDL_LIBS@ ldflags := $(SDL_LIBS) -lSDL_image -lSDL_mixer $(LDFLAGS) cflags := -I. $(SDL_CFLAGS) $(paths) $(CFLAGS) my_objects := args.@OBJEXT@ dust.@OBJEXT@ file.@OBJEXT@ mt.@OBJEXT@ rocks.@OBJEXT@ score.@OBJEXT@ sprite.@OBJEXT@ sound.@OBJEXT@ autopilot.@OBJEXT@ my_objects += main.@OBJEXT@ libs := font.@OBJEXT@ objects := $(libs) $(my_objects) rocks := 00 01 02 03 04 05 06 07 08 09 rocks += 10 11 12 13 14 15 16 17 18 19 rocks += 20 21 22 23 24 25 26 27 28 29 rocks += 30 31 32 33 34 35 36 37 38 39 rocks += 40 41 42 43 44 45 46 47 48 49 rocks := $(rocks:%=data/rock%.png) graphics := data/ship.png data/icon.png data/life.png data/font.png $(rocks) INSTALL := install INSTALL_PROGRAM := $(INSTALL) INSTALL_DATA := $(INSTALL) -m 644 .PHONY: all clean maintainer-clean install uninstall .PHONY: mkinstalldirs rminstalldirs .PHONY: program program-clean install-program uninstall-program .PHONY: data data-clean install-data uninstall-data .PHONY: build-dir-data-link .INTERMEDIATE: font_guts font_guts.pov all: program data data: $(graphics) build-dir-data-link # symbolic link to data dir so you can run the game from the build dir: build-dir-data-link: test -e data || ln -s $(srcdir)/data program: $(exe_name) @PACKAGE_TARNAME@.desktop %.@OBJEXT@: %.c $(CC) $(cflags) -c -o $@ $< $(my_objects): vorconfig.h font.@OBJEXT@: font.h args.@OBJEXT@: args.h config.h dust.@OBJEXT@: globals.h dust.h float.h mt.h file.@OBJEXT@: file.h common.h main.@OBJEXT@: args.h common.h config.h dust.h file.h float.h globals.h mt.h rocks.h score.h sprite.h sound.h autopilot.h mt.@OBJEXT@: mt.h rocks.@OBJEXT@: rocks.h common.h file.h globals.h mt.h sprite.h score.@OBJEXT@: score.h common.h file.h sound.@OBJEXT@: sound.h args.h common.h sprite.@OBJEXT@: sprite.h common.h @PACKAGE_TARNAME@.desktop: @PACKAGE_TARNAME@.desktop.in sed -e "s|EXE_NAME|$(exe_name)|g" -e "s|DISPLAY_NAME|@PACKAGE_NAME@|g" -e "s|ICON_PATH|$(pkgdatadir)|g" $< > $@ || sh -c "rm $@; false" $(exe_name): $(objects) $(CC) $^ $(ldflags) -o $@ include $(srcdir)/gfx.mk tags: *.c *.h exuberant-ctags *.c *.h /usr/include/SDL/* clean: program-clean rm -f tags distclean: clean rm -f Makefile config.h config.log config.status maintainer-clean: distclean @echo 'This command is intended for maintainers to use; it' @echo 'deletes files that may need special tools to rebuild.' rm -f $(graphics) font_guts font_guts.pov program-clean: rm -f *.@OBJEXT@ $(exe_name) @PACKAGE_TARNAME@.desktop mkinstalldirs: if [ ! -d $(DESTDIR)$(pkgdatadir) ]; then mkdir -p $(DESTDIR)$(pkgdatadir); fi if [ ! -d $(DESTDIR)$(bindir) ]; then mkdir -p $(DESTDIR)$(bindir); fi rminstalldirs: uninstall-data if [ -d $(DESTDIR)$(pkgdatadir) ]; then rmdir $(DESTDIR)$(pkgdatadir); fi install-desktop-file-note: @PACKAGE_TARNAME@.desktop install-files @echo @echo "If you've installed system wide, you may want to run: make install-desktop-file" @echo '(as root) to install a menu entry for @PACKAGE_NAME@' install-desktop-file: @PACKAGE_TARNAME@.desktop desktop-file-install @PACKAGE_TARNAME@.desktop install-files: all mkinstalldirs install-program install-data install: install-files install-desktop-file-note install-program: program $(INSTALL_PROGRAM) ./$(exe_name) $(DESTDIR)$(bindir)/ install-data: data mkinstalldirs $(INSTALL_DATA) $(srcdir)/data/*.png $(DESTDIR)$(pkgdatadir)/ $(INSTALL_DATA) $(srcdir)/data/*.wav $(DESTDIR)$(pkgdatadir)/ $(INSTALL_DATA) $(srcdir)/data/*.xm $(DESTDIR)$(pkgdatadir)/ @echo @echo "$(pkgdatadir)/icon.png (48x48) or ship.png (32x32) make good icons." @echo uninstall: uninstall-program uninstall-data rminstalldirs uninstall-program: rm -f $(DESTDIR)$(bindir)/$(exe_name) uninstall-data: rm -f $(DESTDIR)$(pkgdatadir)/*.png rm -f $(DESTDIR)$(pkgdatadir)/*.wav rm -f $(DESTDIR)$(pkgdatadir)/*.xm vor-0.5.5/rocks.h0000644000175100017510000000024511310013233014403 0ustar jasonwoofjasonwoof#include "sprite.h" void load_rocks(void); void reset_rocks(void); void new_rocks(void); void draw_rocks(void); void blast_rocks(float x, float y, float radius); vor-0.5.5/gfx.mk0000644000175100017510000000133211310013233014224 0ustar jasonwoofjasonwoof gfx-deps := gfx.mk povimg.sh data/icon.png: ship.pov $(gfx-deps) ./povimg.sh +W48 +H48 $< > $@ || sh -c "rm $@; false" data/macicon.png: ship.pov $(gfx-deps) ./povimg.sh +W128 +H128 $< > $@ || sh -c "rm $@; false" data/ship.png: ship.pov $(gfx-deps) ./povimg.sh +W32 +H32 $< > $@ || sh -c "rm $@; false" data/life.png: ship.pov $(gfx-deps) ./povimg.sh +W17 +H17 $< > $@ || sh -c "rm $@; false" data/rock%.png: rocks.pov $(gfx-deps) ./povimg.sh +H52 +W52 +K$* $< > $@ || sh -c "rm $@; false" font_guts: font_guts.c font_guts.pov: font_guts font_template.txt ./font_guts < font_template.txt > $@ || sh -c "rm $@ && false" data/font.png: font.pov font_guts.pov ./povimg.sh +W3000 +H40 $< > $@ || sh -c "rm $@; false" vor-0.5.5/autopilot.h0000644000175100017510000000156211310013233015305 0ustar jasonwoofjasonwoof// Copyright (C) 2007 Jason Woofenden // // This file is part of VoR. // // VoR is free software; you can redistribute it and/or modify it // under the terms of the GNU General Public License as published by // the Free Software Foundation; either version 2, or (at your option) // any later version. // // VoR is distributed in the hope that it will be useful, but // WITHOUT ANY WARRANTY; without even the implied warranty of // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU // General Public License for more details. // // You should have received a copy of the GNU General Public License // along with VoR; see the file COPYING. If not, write to the // Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, // MA 02111-1307, USA. void autopilot_init(); int autopilot(float ticks); void autopilot_fix_keystates(Uint8* table); vor-0.5.5/mt.c0000644000175100017510000001035311310013233013676 0ustar jasonwoofjasonwoof/* mt.c - A C program for MT199937, with initialization improved 2002-02-10. ----- 2006-01-14 - Switched include from stdint.h to inttypes.h, fixed a warning from gcc -Wall. --Josh ----- 2003-07-01 - Stripped out stuff I didn't need, converted to stdint.h types, changed source formatting a bit. --Josh ----- A C-program for MT19937, with initialization improved 2002-02-10. Coded by Takuji Nishimura and Makoto Matsumoto. This is a faster version by taking Shawn Cokus's optimization, Matthe Bellew's simplification, Isaku Wada's real version. Before using, initialize the state by using init_genrand(seed) or init_by_array(init_key, key_length). Copyright (C) 1997 - 2002, Makoto Matsumoto and Takuji Nishimura, All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. 3. The names of its contributors may not be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. Any feedback is very welcome. http://www.math.sci.hiroshima-u.ac.jp/~m-mat/MT/emt.html email: m-mat@math.sci.hiroshima-u.ac.jp */ #include "mt.h" /* Period parameters */ #define N 624 #define M 397 #define MATRIX_A 0x9908b0dfUL /* constant vector a */ #define UMASK 0x80000000UL /* most significant w-r bits */ #define LMASK 0x7fffffffUL /* least significant r bits */ #define MIXBITS(u,v) ( ((u) & UMASK) | ((v) & LMASK) ) #define TWIST(u,v) ((MIXBITS(u,v) >> 1) ^ ((v)&1UL ? MATRIX_A : 0UL)) static uint32_t state[N]; /* The array for the state vector */ static int left = 1; static int initf = 0; static uint32_t *next; /* Initializes state[N] with a seed. */ void init_mt(uint32_t s) { int j; state[0]= s & 0xffffffffUL; for (j=1; j> 30)) + j); /* See Knuth TAOCP Vol2. 3rd Ed. P.106 for multiplier. */ /* In the previous versions, MSBs of the seed affect */ /* only MSBs of the array state[]. */ /* 2002/01/09 modified by Makoto Matsumoto */ state[j] &= 0xffffffffUL; /* for >32 bit machines */ } left = 1; initf = 1; } static void next_state(void) { uint32_t *p=state; int j; /* If mt_init() has not been called, a default initial seed is used. */ if (initf==0) init_mt(5489UL); left = N; next = state; for (j=N-M+1; --j; p++) *p = p[M] ^ TWIST(p[0], p[1]); for (j=M; --j; p++) *p = p[M-N] ^ TWIST(p[0], p[1]); *p = p[M-N] ^ TWIST(p[0], state[0]); } /* Generates a random number in [0,0xffffffff] */ uint32_t urnd(void) { uint32_t y; if (--left == 0) next_state(); y = *next++; /* Tempering */ y ^= (y >> 11); y ^= (y << 7) & 0x9d2c5680UL; y ^= (y << 15) & 0xefc60000UL; y ^= (y >> 18); return y; } float frnd(void) { return urnd()/(1.0 + UINT32_MAX); } float crnd(void) { return (urnd()-INT32_MIN)/(1.0 + UINT32_MAX); } vor-0.5.5/main.c0000644000175100017510000004766011310013233014215 0ustar jasonwoofjasonwoof/* Variations on RockDodger * Space Rocks copyright (C) 2001 Paul Holt * * Project fork 2004, Jason Woofenden and Joshua Grams. * (a whole bunch of modifications and project rename) * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #include #include #include #include #include #include #include #include #include "font.h" #include "args.h" #include "common.h" #include #include "vorconfig.h" #include "dust.h" #include "file.h" #include "float.h" #include "globals.h" #include "mt.h" #include "rocks.h" #include "score.h" #include "sprite.h" #include "sound.h" #include "autopilot.h" // ************************************* VARS // SDL_Surface global variables SDL_Surface *surf_screen, // Screen *surf_b_variations, // "variations" banner *surf_b_on, // "on" banner *surf_b_rockdodger, // "rockdodger" banner *surf_b_game, // Title element "game" *surf_b_over, // Title element "over" *surf_life, // Indicator of number of ships remaining *surf_rock[NROCKS], // THE ROCKS *surf_font_big; // The big font font *g_font; struct dot { int active; float x, y; float dx, dy; float mass; // in DOT_MASS_UNITs float decay; // rate at which to reduce mass. int heat; // heat multiplier (color). }; void draw(void); struct dot edot[MAXENGINEDOTS], *dotptr = edot; struct dot bdot[MAXBANGDOTS]; // Other global variables char topline[1024]; char *initerror = ""; int screenshot_number = 0; struct ship ship = { SHIP, 0, NULL, XSIZE/2, YSIZE/2, BARRIER_SPEED, 0.0 }; float screendx = BARRIER_SPEED, screendy = 0.0; float dist_ahead; // all movement is based on t_frame. unsigned long frames, start, end; float t_frame; // length of this frame (in ticks = 1/20th second) adjusted for gamespeed int ms_frame; // length of this frame (milliseconds) int ms_end; // end of this frame (milliseconds) float gamespeed = 1.00; int score; float fadetimer = 0; int paused = 0; // bangdot start (bd1) and end (bd2) position: int bd1 = 0, bd2 = 0; enum states { TITLE_PAGE, GAMEPLAY, DEAD_PAUSE, GAME_OVER, HIGH_SCORE_ENTRY, HIGH_SCORE_DISPLAY }; enum states state = TITLE_PAGE; float state_timeout = 600.0; #define NSEQUENCE 3 char *msgs[2][3] = { { "Press SPACE for normal game", "Press '1' for easy game", "http://jasonwoof.org/vor" }, { "Press SPACE for easy game", "Press '2' for normal game", "http://jasonwoof.org/vor" } }; int bangdotlife, nbangdots; Uint16 heatcolor[W*3]; char *data_dir; extern char *optarg; extern int optind, opterr, optopt; #define TO_TICKS(seconds) ((seconds)*20*gamespeed) // ************************************* FUNCS #ifdef nanosleep void tiny_sleep() { struct timespec t; t.tv_sec = 0; t.tv_nsec = 1; nanosleep(&t, 0); } #else #define tiny_sleep() #endif void init_engine_dots() { int i; for(i = 0; iw / 2; hy = ship.image->h / 2; for(dir=0; dir<4; dir++) { if(!(ship.jets & 1<active == 0) { a = frnd()*M_PI + (dir-1)*M_PI_2; r = sin(frnd()*M_PI); dx = r * cos(a); dy = r * -sin(a); // screen y is "backwards". dotptr->decay = 3; dotptr->heat = 6; // dot was created at a random time during the time span time = frnd() * t_frame; // this is how long ago // calculate how fast the ship was going when this engine dot was // created (as if it had a smooth acceleration). This is used in // determining the velocity of the dots, but not their starting // location. accelh = ((ship.jets >> 2) & 1) - (ship.jets & 1); accelh *= THRUSTER_STRENGTH * time; past_ship_dx = ship.dx - accelh; accelv = ((ship.jets >> 1) & 1) - ((ship.jets >> 3) & 1); accelv *= THRUSTER_STRENGTH * time; past_ship_dy = ship.dy - accelv; // the starting position (not speed) of the dot is calculated as // though the ship were traveling at a constant speed for this // t_frame. dotptr->x = (ship.x - (ship.dx - screendx) * time) + s[dir]*hx; dotptr->y = (ship.y - (ship.dy - screendy) * time) + s[(dir+1)&3]*hy; if(dir&1) { dotptr->dx = past_ship_dx + 2*dx; dotptr->dy = past_ship_dy + 20*dy; dotptr->mass = 60 * fabs(dy); } else { dotptr->dx = past_ship_dx + 20*dx; dotptr->dy = past_ship_dy + 2*dy; dotptr->mass = 60 * fabs(dx); } // move the dot as though it were created in the past dotptr->x += (dotptr->dx - screendx) * time; dotptr->y += (dotptr->dy - screendy) * time; if(!fclip(dotptr->x, XSIZE) && !fclip(dotptr->y, YSIZE)) { dotptr->active = 1; if(dotptr - edot < MAXENGINEDOTS-1) { dotptr++; } else { dotptr = edot; } } } } } } void new_bang_dots(struct sprite *s) { int i, n, x, y; uint16_t *pixel, c; uint32_t colorkey; int row_inc; double theta, r; SDL_Surface *img = s->image; n = 20; pixel = img->pixels; row_inc = img->pitch/sizeof(uint16_t) - img->w; colorkey = img->format->colorkey; if(SDL_MUSTLOCK(img)) { SDL_LockSurface(img); } for(i=0; ipixels; for(y=0; yh; y++) { for(x = 0; xw; x++) { c = *pixel++; if(c && c != colorkey) { theta = frnd()*M_PI*2; r = frnd(); r = 1 - r*r; bdot[bd2].dx = 45*r*cos(theta) + s->dx; bdot[bd2].dy = 45*r*sin(theta) + s->dy; bdot[bd2].x = x + s->x; bdot[bd2].y = y + s->y; bdot[bd2].mass = frnd() * 99; bdot[bd2].decay = frnd()*1.5 + 0.5; bdot[bd2].heat = 3; bdot[bd2].active = 1; bd2 = (bd2+1) % MAXBANGDOTS; } pixel += row_inc; } } } if(SDL_MUSTLOCK(img)) { SDL_UnlockSurface(img); } } void move_dot(struct dot *d) { Sprite *hit; float mass; if(d->active) { d->x += (d->dx - screendx) * t_frame; d->y += (d->dy - screendy) * t_frame; d->mass -= t_frame * d->decay; if(d->mass < 0 || fclip(d->x, XSIZE) || fclip(d->y, YSIZE)) d->active = 0; else { hit = pixel_collides(d->x, d->y); if(hit) if(hit->type != SHIP) { d->active = 0; mass = sprite_mass(hit); hit->dx += DOT_MASS_UNIT * d->mass * (d->dx - hit->dx) / mass; hit->dy += DOT_MASS_UNIT * d->mass * (d->dy - hit->dy) / mass; } } } } void move_dots(void) { int i; for(i=0; iactive) { pixels = (uint16_t *) surf_screen->pixels; row_inc = surf_screen->pitch / sizeof(uint16_t); pixel = pixels + (int)d->y * row_inc + (int)d->x; *pixel = heatcolor[min(3*W-1, (int)(d->mass * d->heat))]; } } void draw_dots(void) { int i; if(SDL_MUSTLOCK(surf_screen)) { SDL_LockSurface(surf_screen); } draw_dust(); for(i=0; iformat, (iw + 10); dest.y = 20; SDL_BlitSurface(surf_life, NULL, surf_screen, &dest); } } void draw_game_over(void) { int x; char *text0, *text1; SDL_Rect dest; fadetimer += t_frame; dest.x = (XSIZE-surf_b_game->w)/2; dest.y = (YSIZE-surf_b_game->h)/2-40; SDL_BlitSurface(surf_b_game,NULL,surf_screen,&dest); dest.x = (XSIZE-surf_b_over->w)/2; dest.y = (YSIZE-surf_b_over->h)/2 + 40; SDL_BlitSurface(surf_b_over,NULL,surf_screen,&dest); if(new_high_score(score)) { text0 = "New High Score!"; text1 = "Press SPACE to continue"; } else { text0 = msgs[g_easy][0]; text1 = msgs[g_easy][1]; } x = (XSIZE-font_width(text0))/2 + cos(fadetimer/9)*10; font_write(x,YSIZE-100 + cos(fadetimer/6)*5,text0); x = (XSIZE-font_width(text1))/2 + sin(fadetimer/9)*10; font_write(x,YSIZE-50 + sin(fadetimer/4)*5,text1); } void draw_title_page(void) { int x; char *text; SDL_Rect dest; fadetimer += t_frame/2.0; dest.x = (XSIZE-surf_b_variations->w)/2 + cos(fadetimer/6.5)*10; dest.y = (YSIZE/2-surf_b_variations->h)/2 + sin(fadetimer/5.0)*10; SDL_BlitSurface(surf_b_variations,NULL,surf_screen,&dest); dest.x = (XSIZE-surf_b_on->w)/2 + cos((fadetimer + 1.0)/6.5)*10; dest.y = (YSIZE/2-surf_b_on->h)/2 + surf_b_variations->h + 20 + sin((fadetimer + 1.0)/5.0)*10; SDL_BlitSurface(surf_b_on,NULL,surf_screen,&dest); dest.x = (XSIZE-surf_b_rockdodger->w)/2 + cos((fadetimer + 2.0)/6.5)*10; dest.y = (YSIZE/2-surf_b_rockdodger->h)/2 + surf_b_variations->h + surf_b_on->h + 40 + sin((fadetimer + 2.0)/5)*10; SDL_BlitSurface(surf_b_rockdodger,NULL,surf_screen,&dest); text = msgs[g_easy][(int)(fadetimer/35)%NSEQUENCE]; x = (XSIZE-font_width(text))/2 + cos(fadetimer/4.5)*10; font_write(x,YSIZE-100 + cos(fadetimer/3)*5,text); text = "Version " PACKAGE_VERSION; x = (XSIZE-font_width(text))/2 + sin(fadetimer/4.5)*10; font_write(x,YSIZE-50 + sin(fadetimer/2)*5,text); } void draw(void) { SDL_FillRect(surf_screen,NULL,0); // black background draw_dots(); // background dots draw_sprite(SPRITE(&ship)); draw_rocks(); show_lives(); show_score(); switch (state) { case GAME_OVER: draw_game_over(); break; case TITLE_PAGE: draw_title_page(); break; case HIGH_SCORE_ENTRY: case HIGH_SCORE_DISPLAY: display_scores(150,50); break; case GAMEPLAY: case DEAD_PAUSE: ; // no action necessary } // Update the surface SDL_Flip(surf_screen); } static inline void kill_ship(struct ship *ship) { play_sound(SOUND_BANG); new_bang_dots(SPRITE(ship)); if(--ship->lives) { state = DEAD_PAUSE; state_timeout = DEAD_PAUSE_LENGTH; // want ship to be invisible, but keep drifting at sqrt(speed) // to leave it in the middle of the space from the explosion. ship->flags = MOVE; ship->dx = (ship->dx < 0) ? -sqrt(-ship->dx) : sqrt(ship->dx); ship->dy = (ship->dy < 0) ? -sqrt(-ship->dy) : sqrt(ship->dy); if(ship->dx < BARRIER_SPEED) ship->dx = BARRIER_SPEED; } else { state = GAME_OVER; play_tune(TUNE_TITLE_PAGE); state_timeout = 200.0; fadetimer = 0.0; ship->flags = 0; // scrolling is based on the ship speed, so we need to reset it. ship->dx = BARRIER_SPEED; ship->dy = 0; } } void do_collision(Sprite *a, Sprite *b) { if(a->type == SHIP) kill_ship((struct ship *)a); else if(b->type == SHIP) kill_ship((struct ship *)b); else bounce(a, b); } void init_score_entry(void) { SDL_Event e; state = HIGH_SCORE_ENTRY; state_timeout = 5.0e6; SDL_EnableUNICODE(1); while(SDL_PollEvent(&e)) ; insert_score(score); } // Count down the state timer, and change state when it gets to zero or less; void update_state(void) { state_timeout -= t_frame*3; if(state_timeout > 0) return; switch(state) { case GAMEPLAY: break; // no action necessary case DEAD_PAUSE: // Restore the ship and continue playing ship.flags = DRAW|MOVE|COLLIDE; state = GAMEPLAY; break; case GAME_OVER: if(new_high_score(score)) init_score_entry(); else { state = HIGH_SCORE_DISPLAY; state_timeout = 400; } break; case HIGH_SCORE_DISPLAY: state = TITLE_PAGE; state_timeout = 600.0; fadetimer = 0.0; break; case HIGH_SCORE_ENTRY: break; case TITLE_PAGE: state = HIGH_SCORE_DISPLAY; state_timeout = 200.0; break; } } void gameloop() { SDL_Event e; Uint8 *keystate; float tmp; for(;;) { ms_frame = SDL_GetTicks() - ms_end; ms_end += ms_frame; if(ms_frame > 50) { ms_frame = 50; } t_frame = gamespeed * ms_frame / 50; frames++; if(opt_autopilot) { autopilot(t_frame); } while(paused ? SDL_WaitEvent(&e) : SDL_PollEvent(&e)) { switch(e.type) { case SDL_QUIT: return; case SDL_KEYDOWN: // even during high-score entry if(e.key.keysym.sym == SDLK_ESCAPE) { return; } if(state == HIGH_SCORE_ENTRY) { if(!process_score_input(&e.key.keysym)) { // Write the high score table to the file write_high_score_table(); // continue to display the scores briefly state = HIGH_SCORE_DISPLAY; state_timeout = 200; } } else { switch(e.key.keysym.sym) { case SDLK_q: return; case SDLK_3: case SDLK_PRINT: { FILE *screenshot_fp; char tmp[30]; char *screenshot_filename = &(tmp[0]); for(;;) { snprintf(screenshot_filename, 30, "vor-screenshot-%02i.bmp", screenshot_number++); screenshot_fp = fopen(screenshot_filename, "r"); if(screenshot_fp) { fclose(screenshot_fp); } else { break; } } SDL_SaveBMP(surf_screen, screenshot_filename); } break; case SDLK_p: case SDLK_PAUSE: paused = !paused; if(paused) { pause_tune(); } else { resume_tune(); ms_end = SDL_GetTicks(); } break; case SDLK_f: case SDLK_F11: toggle_fullscreen(); break; default: // other keys are handled by checking keystate each frame break; } } break; } } keystate = SDL_GetKeyState(NULL); if(opt_autopilot) { autopilot_fix_keystates(keystate); } if(state == GAMEPLAY) { if(!paused) { score += ms_frame; if(keystate[SDLK_LEFT] || keystate[SDLK_KP4]) { ship.dx -= THRUSTER_STRENGTH*t_frame; ship.jets |= 1<<0; } if(keystate[SDLK_DOWN] || keystate[SDLK_KP5] || keystate[SDLK_KP2]) { ship.dy += THRUSTER_STRENGTH*t_frame; ship.jets |= 1<<1; } if(keystate[SDLK_RIGHT] || keystate[SDLK_KP6]) { ship.dx += THRUSTER_STRENGTH*t_frame; ship.jets |= 1<<2; } if(keystate[SDLK_UP] || keystate[SDLK_KP8]) { ship.dy -= THRUSTER_STRENGTH*t_frame; ship.jets |= 1<<3; } if(ship.jets) { ship.dx = fconstrain2(ship.dx, -50, 50); ship.dy = fconstrain2(ship.dy, -50, 50); } } } if(!paused) { update_state(); // SCROLLING tmp = (ship.y+ship.h/2 + ship.dy*t_frame - YSCROLLTO)/25 + (ship.dy-screendy); screendy += tmp * t_frame/12; tmp = (ship.x+ship.w/2 + ship.dx*t_frame - XSCROLLTO)/25 + (ship.dx-screendx); screendx += tmp * t_frame/12; // taper off so we don't hit the barrier abruptly. // (if we would hit in < 2 seconds, adjust to 2 seconds). if(dist_ahead + (screendx - BARRIER_SPEED)*TO_TICKS(2) < 0) screendx = BARRIER_SPEED - (dist_ahead/TO_TICKS(2)); dist_ahead += (screendx - BARRIER_SPEED)*t_frame; if(MAX_DIST_AHEAD >= 0) dist_ahead = min(dist_ahead, MAX_DIST_AHEAD); move_sprites(); move_dots(); move_dust(); new_rocks(); // BOUNCE off left or right edge of screen if(ship.x < 0 || ship.x+ship.w > XSIZE) { ship.x -= (ship.dx-screendx)*t_frame; ship.dx = screendx - (ship.dx-screendx)*BOUNCINESS; ship.x = fconstrain(ship.x, XSIZE - ship.w); } // BOUNCE off top or bottom of screen if(ship.y < 0 || ship.y+ship.h > YSIZE) { ship.y -= (ship.dy-screendy)*t_frame; ship.dy = screendy - (ship.dy-screendy)*BOUNCINESS; ship.y = fconstrain(ship.y, YSIZE - ship.h); } new_engine_dots(); collisions(); // must happen after ship bouncing because it puts pixels where the ship is (thus the ship must be on the screen) draw(); // new game if((keystate[SDLK_SPACE] || keystate[SDLK_1] || keystate[SDLK_2]) && (state == HIGH_SCORE_DISPLAY || state == TITLE_PAGE || state == GAME_OVER)) { if(state == GAME_OVER && new_high_score(score)) init_score_entry(); else { if((keystate[SDLK_SPACE] && !initial_rocks) || keystate[SDLK_2]) { g_easy = 0; initial_rocks = NORMAL_I_ROCKS; final_rocks = NORMAL_F_ROCKS; if(gamespeed == EASY_GAMESPEED) gamespeed = NORMAL_GAMESPEED; } else if(keystate[SDLK_1]) { g_easy = 1; initial_rocks = EASY_I_ROCKS; final_rocks = EASY_F_ROCKS; gamespeed = EASY_GAMESPEED; } reset_sprites(); reset_rocks(); screendx = BARRIER_SPEED; screendy = 0; ship.x = XSIZE/2.2; ship.y = YSIZE/2 - ship.w/2; ship.dx = screendx; ship.dy = screendy; ship.lives = 4; ship.flags = MOVE|DRAW|COLLIDE; add_sprite(SPRITE(&ship)); score = 0; state = GAMEPLAY; play_tune(TUNE_GAMEPLAY); } } ship.jets = 0; } if(state == TITLE_PAGE && keystate[SDLK_h]) { state = HIGH_SCORE_DISPLAY; state_timeout = 400; } tiny_sleep(); } } int main(int argc, char **argv) { if(!parse_opts(argc, argv)) return 1; if(init()) { printf ("vor: SDL error: '%s'\n",initerror); return 1; } start = SDL_GetTicks(); frames = 0; gameloop(); end = SDL_GetTicks(); // printf("%ld frames in %ld ms, %.2f fps.\n", frames, end-start, frames * 1000.0 / (end-start)); return 0; } vor-0.5.5/font.h0000644000175100017510000000066011310013233014231 0ustar jasonwoofjasonwoof// Copyright (C) 2006 Jason Woofenden PUBLIC DOMAIN #ifndef __font_h__ #define __font_h__ typedef struct { SDL_Surface *pixels; SDL_Rect bounds[94]; int space_width; int letter_spacing; } font; font *font_load(const char* filename); // sets as the current font void font_free(font*); void font_set(font*); void font_write(int x, int y, const char* message); int font_width(const char* message); int font_height(); #endif vor-0.5.5/globals.h0000644000175100017510000000205211310013233014703 0ustar jasonwoofjasonwoof#ifndef VOR_GLOBALS_H #define VOR_GLOBALS_H #include #include #include "font.h" // ************************************* VARS // SDL_Surface global variables extern SDL_Surface *surf_screen, // Screen *surf_b_variations, // "variations" banner *surf_b_on, // "on" banner *surf_b_rockdodger, // "rockdodger" banner *surf_b_game, // Title element "game" *surf_b_over, // Title element "over" *surf_ship, // Spaceship element *surf_life, // Indicator of number of ships remaining *surf_rock[NROCKS], // THE ROCKS *surf_font_big; // The big font extern float t_frame; extern font *g_font; // Other global variables extern char topline[1024]; extern char *initerror; extern float screendx, screendy; extern int score; extern int g_easy; extern float fadetimer, faderate; extern int pausedown, paused; // bangdot start (bd1) and end (bd2) position: extern int bd1, bd2; extern int bangdotlife, nbangdots; extern Uint16 heatcolor[W*3]; extern char *data_dir; extern uint32_t initial_rocks, final_rocks; #endif // VOR_GLOBALS_H vor-0.5.5/common.h0000644000175100017510000000065511310013233014557 0ustar jasonwoofjasonwoof#ifndef VOR_COMMON_H #define VOR_COMMON_H #include #include #define NONE (~0) #ifndef max #define max(a, b) ((a) > (b) ? (a) : (b)) #endif #ifndef min #define min(a, b) ((a) < (b) ? (a) : (b)) #endif #ifndef abs #define abs(a) ((a)<=0 ? -(a) : (a)) #endif #define CONDERROR(a) if((a)) {initerror = strdup(SDL_GetError());return 1;} #define NULLERROR(a) CONDERROR((a) == NULL) #endif // VOR_COMMON_H vor-0.5.5/sound.h0000644000175100017510000000241411310013233014412 0ustar jasonwoofjasonwoof/* Variations on RockDodger * Copyright (C) 2004 Joshua Grams * * This program is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License as published by the * Free Software Foundation; either version 2 of the License, or (at your * option) any later version. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with this program; if not, write to the Free Software * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA */ #ifndef VOR_SOUND_H #define VOR_SOUND_H int init_sound(void); void play_sound(int i); void play_tune(int i); void pause_tune(); void resume_tune(); // Currently there's only one tune (gameplay). Calling play_tune() with the // other tune numbers turns the music off, (and makes it easy to add tunes for // those screens). #define TUNE_GAMEPLAY 0 #define TUNE_TITLE_PAGE 1 #define TUNE_HIGH_SCORE_ENTRY 2 #define NUM_TUNES 1 #define SOUND_BANG 0 #define NUM_SOUNDS 1 #endif // VOR_SOUND_H vor-0.5.5/rocks.pov0000644000175100017510000000433111310013233014760 0ustar jasonwoofjasonwoof// pass in a random seed (integer) to this file with +K #include "colors.inc" #declare RS = seed(clock); #macro rnd() (rand(RS)) #end // rock size. The larger this number, the closer the camera, and the smaller the bumps. #declare rsize = 1 + rnd(); camera { up <0, 1, 0> right <1, 0, 0> location <0, 0, -4 / rsize> angle 30 look_at <0, 0, 0> angle 55 } // same light sorce as ship.pov light_source { <-500, 500, -700> White } blob{ sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } sphere { <0.5 - rnd(), 0.5 - rnd(), 0.5 - rnd()>, .1 + rnd(), 1 } threshold 2 texture{ pigment{ color rgb <53 / 55, 44 / 55, 36 / 55>} } normal { bumps 1 scale (0.16 / rsize) } finish { ambient .1} } vor-0.5.5/mt.h0000644000175100017510000000031611310013233013701 0ustar jasonwoofjasonwoof#ifndef VOR_MT_H #define VOR_MT_H #include void init_mt(uint32_t s); uint32_t urnd(void); // [0, 0xfffffff] float frnd(void); // [0, 1) float crnd(void); // [-0.5, 0.5) #endif // VOR_MT_H vor-0.5.5/Makefile.win_cross0000644000175100017510000000563611310013233016567 0ustar jasonwoofjasonwoof# Variations on Rockdodger # Copyright (C) 2004 Joshua Grams # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA # This makefile is for cross-compiling to a windows binary from a linux host # # It's ugly, in that it's just a copy of Makefile with the ldflags and cflags # hardcoded and the install actions removed. # # With this cross-compiler (mingw package in ubuntu) the order of -l gcc # options matters, so the $(ldflags) was moved to the end of the link script CC=i586-mingw32msvc-gcc LD=i586-mingw32msvc-ld AR=i586-mingw32msvc-ar RC=i586-mingw32msvc-windres # hard coded, must go at the end of the commandline for linking ldflags = -L/usr/i586-mingw32msvc/lib -lmingw32 -lSDL_image -lpng -lz -lSDL_mixer -lSDLmain -lSDL -lwinmm -lgdi32 -mwindows -lm cflags = -Wall -O3 -I/usr/i586-mingw32msvc/include -I/usr/i586-mingw32msvc/include/SDL -D_GNU_SOURCE=1 -Dmain=SDL_main my_objects := args.o dust.o file.o mt.o rocks.o score.o sprite.o sound.o autopilot.o my_objects += main.o libs := font.o objects := $(libs) $(my_objects) rocks := 00 01 02 03 04 05 06 07 08 09 rocks += 10 11 12 13 14 15 16 17 18 19 rocks += 20 21 22 23 24 25 26 27 28 29 rocks += 30 31 32 33 34 35 36 37 38 39 rocks += 40 41 42 43 44 45 46 47 48 49 rocks := $(rocks:%=data/rock%.png) graphics := data/ship.png data/icon.png data/life.png data/font.png $(rocks) .PHONY: all clean maintainer-clean .PHONY: program program-clean .PHONY: data data-clean all: program data data: $(graphics) program: vor.exe %.o: %.c @echo compiling $@ from $< @$(CC) $(cflags) -c -o $@ $< $(my_objects): vorconfig.h font.o: font.h args.o: args.h dust.o: globals.h dust.h float.h mt.h file.o: file.h common.h main.o: args.h common.h dust.h file.h float.h globals.h mt.h rocks.h score.h sprite.h sound.h autopilot.h mt.o: mt.h rocks.o: rocks.h common.h file.h globals.h mt.h sprite.h score.o: score.h common.h file.h sound.o: sound.h args.h common.h sprite.o: sprite.h common.h vor.exe: $(objects) @echo linking $@ from $^ @$(CC) $^ -o $@ $(ldflags) include gfx.mk tags: *.c *.h exuberant-ctags *.c *.h /usr/include/SDL/* clean: program-clean rm -f tags maintainer-clean: program-clean data-clean program-clean: rm -f *.o vor.exe data-clean: rm -f $(graphics) font_guts font_guts.pov vor-0.5.5/sprite.h0000644000175100017510000000343411310013233014573 0ustar jasonwoofjasonwoof#ifndef VOR_SPRITE_H #define VOR_SPRITE_H #include #include typedef struct sprite Sprite; #define SPRITE(x) ((Sprite *) (x)) #define BASE 0 #define SHIP 1 #define ROCK 2 #define N_TYPES 3 struct sprite { int8_t type; int8_t flags; Sprite *next; float x, y; float dx, dy; SDL_Surface *image; int w, h; int mask_w; uint32_t *mask; uint32_t area; }; // flags #define MOVE 1 #define DRAW 2 #define COLLIDE 4 #define COLLIDES(sprite) ((sprite)->flags & COLLIDE) Sprite *free_sprites[N_TYPES]; // lists of free sprites, by type. void do_collision(Sprite *a, Sprite *b); void collisions(void); void init_sprites(void); void reset_sprites(void); void add_sprite(Sprite *s); void move_sprite(Sprite *s); void move_sprites(void); Sprite * pixel_collides(float x, float y); void load_sprite(Sprite *sprite, char *filename); float sprite_mass(Sprite *s); void bounce(Sprite *a, Sprite *b); // extended sprites struct ship { // core sprite fields int8_t sprite_type; int8_t flags; struct ship *next; float x, y; float dx, dy; SDL_Surface *image; int w, h; int mask_w; uint32_t *mask; uint32_t area; // SHIP extras int lives; int jets; }; struct rock { // core sprite fields int8_t sprite_type; int8_t flags; struct rock *next; float x, y; float dx, dy; SDL_Surface *image; int w, h; int mask_w; uint32_t *mask; uint32_t area; // ROCK extras int type; }; static inline void insert_sprite(Sprite **head, Sprite *s) { s->next = *head; *head = s; } static inline Sprite * remove_sprite(Sprite **head) { Sprite *s = *head; *head = s->next; return s; } static inline void draw_sprite(Sprite *s) { SDL_Rect dest; if(s->flags & DRAW) { dest.x = s->x; dest.y = s->y; SDL_BlitSurface(s->image, NULL, surf_screen, &dest); } } #endif // VOR_SPRITE_H vor-0.5.5/vorconfig.h0000644000175100017510000000264311310013233015262 0ustar jasonwoofjasonwoof#ifndef VOR_CONFIG_H #define VOR_CONFIG_H // screen size #define XSIZE 640 #define YSIZE 480 #define XSCROLLTO (XSIZE/3) #define YSCROLLTO (YSIZE/2) #define BARRIER_SPEED 7.5 #define MAX_DIST_AHEAD XSIZE #define BOUNCINESS 0.50 // ----------------------------------------------------------------------- // Rocks // number of rock images #define NROCKS 50 // initial/final counts for rocks-on-screen #define NORMAL_I_ROCKS 20 #define NORMAL_F_ROCKS 35 // after 2 minutes #define NORMAL_GAMESPEED 1.0 #define EASY_I_ROCKS 10 #define EASY_F_ROCKS 25 // after 2 minutes #define EASY_GAMESPEED 0.85 // number of rock structs to allocate #define MAXROCKS 120 #define THRUSTER_STRENGTH 1.5 // how many engine dots come out of each thruster per tic (1/20th of a seccond) #define ENGINE_DOTS_PER_TIC 150 #define MAXENGINEDOTS 10000 #define MAXBANGDOTS 50000 #define W 100 #define M 255 // determines how hard they push the rocks. Set to 0 to disable pushing rocks #define DOT_MASS_UNIT 0.07 // radius^2 (pixels) which will be cleared of rocks when you die #define BLAST_RADIUS 300 // time (in 1/60ths of a seccond) between when you blow up, and when your next // ship appears. Make it at least 20.0 so the explosion has time to push the // rocks away. #define DEAD_PAUSE_LENGTH 40.0 #define MAX_PATH_LEN 1024 // number of milliseconds the blinky cursor stays visible/invisible #define CURSOR_BLINK_TIME 300 #endif // VOR_CONFIG_H vor-0.5.5/float.h0000644000175100017510000000162511310013233014372 0ustar jasonwoofjasonwoof#ifndef VOR_FLOAT_H #define VOR_FLOAT_H #include #define SMIDGE 0.0001 // return true if f is OUTSIDE the range [SMIDGE..(max-SMIDGE)] static inline int fclip(float f, float max) { return f < SMIDGE || f >= (max - SMIDGE); } static inline float fconstrain(float f, float max) { max -= SMIDGE; if(f > max) { return max; } if(f < SMIDGE) { return SMIDGE; } return f; } static inline float fconstrain2(float f, float min, float max) { min += SMIDGE; max -= SMIDGE; if(f > max) { return max; } if(f < min) { return min; } return f; } // wrap f so it's within the range [SMIDGE..(max-SMIDGE)] // assumes f is not outside this range by more than (max - (2 * SMIDGE)) static inline float fwrap(float f, float max) { float upper = max - SMIDGE; float range = upper - SMIDGE; if(f > upper) { f -= range; } if(f < SMIDGE) { f += range; } return f; } #endif // VOR_FLOAT_H vor-0.5.5/README0000644000175100017510000000614211310013233013773 0ustar jasonwoofjasonwoofVariations on Rockdodger 0.5.5 VoR is a quick action game where you drive a space ship and try to avoid crashing into rocks. Current information about vor can be found on the homepage: http://jasonwoof.org/vor Here are the keys: Space: Start playing 1: Switch to easy mode and start playing 2: Switch to normal mode (default) and start playing Arrows: Steer (use short taps, and remember to slow down) Esc: Quit F: Toggle full-screen mode P: Pause/unpause 3: Save a screenshot See INSTALL for instructions on building, running and installing. VoR is released under the GNU GPL -- see file COPYING for details. The audio is public domain. Jason Woofenden and Josh Grams like Rock Dodgers (http://spacerocks.sourceforge.net/) very much: both playing it and hacking on it. VoR is the result. It is currently based on the rockdodger 0.4.2 codebase, with quite a few modifications, both user-visible changes and internal technical improvements. Available for download from http://qualdan.com/vor/ Note: This is a fairly hard game, intended to be a quickie game for when you want to kill a few spare minutes. For reference, my best time [Josh Grams] is about 2 minutes in version 0.3. I'm not generally very good at video games, but I have been playing this one for quite a while now. Changes from Rock Dodgers User-Visible Changes: 0.5.4: * new sound effect and music * F key toggles full-screen mode * 3 key saves a screenshot 0.5.3: * another attempt at fixing the x86 crashes. * made valgrind happy. 0.5.2: * another attempt at fixing the x86 crashes. 0.5.1: * another attempt at fixing the x86 crashes. 0.5: * lots of bug fixes * tweaks to engine and explosion graphics and new font 0.4: * Rocks now bounce off each other, and are pushed by particles. * Now with two difficulties: normal and easy. * Better new ship placement after you die. 0.3: * Scrolls to the right so you can zoom ahead. * Fully random rock generation; rocks no longer wrap vertically. * Rocks' relative speeds are now uniform in all directions (i.e. much more up/down speed variation). Noticeably hard...err...more "interesting". * Command-line option --game-speed. 0.2: * New graphics, generated by POV-Ray. Yeah, okay, the ship is really cheezy. At least the rocks are cool. * Real collision detection; no more "ship is 1 pixel bigger all around than it looks." 0.1: * Moves like a real spacecraft; no more friction! * No more silly shields or lasers; just pure rockdodgin' fun! * Up/down scrolling; gives you more escape options. * Proper time display for score, not just raw milliseconds (bleh). * Ship explodes, blowing rocks away, rather than automagically vanishing them. Internal Technical Changes: * Build system now uses autoconf (as of 0.5.5) * Replaced SFont with Jason's font.c * Started factoring a lot of stuff out of main into their own .c files. * Removed a bunch of unused code. * Function definitions: name at beginning of line (line following the return type) for easy grepping as per GNU coding standards. * Real collision detection (bbox/bitmask). vor-0.5.5/todo0000644000175100017510000000136111310013233014001 0ustar jasonwoofjasonwoof*** Move game logic into a script so we can have "variations". * Then an in-game menu to choose which game: Rock Dodger Free-form/Practice Crazy Taxi * Add networking for multiplayer games: Tag Deathmatch ** Switch all ray-traced graphics (only big green messages left) * Then we can run at the native screen size * fix rock generation code so they are never created overlapping * Deltas on high score display? Comments from HappyPenguin (and solution ideas by Josh) ** Why can't you go left? Blast wave. Fire/explosion graphics? DONE 2006-03-25 *** Too hard. Add easy setting (press 'e' to start easy game). ** What do you do at game over? Need an explanatory message. DONE 2006-03-24 ** Multiple deaths is a problem: sqrt(ship speed). vor-0.5.5/README.font0000644000175100017510000000262511310013233014742 0ustar jasonwoofjasonwoofHow the font is generated, and how to edit it. The font used in VoR is generated from the pixel layout in font_template.txt.gz. You can edit this file easily with vim. Don't unzip it, vim handles this for you. Just open it up and do ":set nowrap". You should now see the font and be able to edit it nicely with replace mode (hit capital "R"). The font is generated from this template by creating a huge blob object in povray. A small diffuse sphere is created at the location of each # in the template file, and the result is rendered where the density of all those combined spheres is high enough. If you create a font that has considerably different dimensions you will have to fiddle with a few numbers in the sources: * update the TEMPLATE_WIDTH and TEMPLATE_HEIGHT constants in font_guts.c * If you've changed the aspect ratio considerably: update the "up" and "right" vectors in font.pov These determine the aspect ratio, and what area of the coordinate space is rendered. Be sure to leave enough space around the edges so the font doesn't get clipped. Don't worry about excess black around the edges, it will be cropped automatically after rendering. The constant OUTPUT_WIDTH in font_guts.c is in povray units. The font template was created from the 10x20 font from the misc-fixed pack. It was tweaked slightly in particular so the dots on the j, i and ! characters don't touch the rest of the character. vor-0.5.5/font_guts.c0000644000175100017510000000120111310013233015256 0ustar jasonwoofjasonwoof#include #define TEMPLATE_WIDTH 1870 #define TEMPLATE_HEIGHT 17 #define OUTPUT_WIDTH 29.0 #define FACTOR (OUTPUT_WIDTH / (float)TEMPLATE_WIDTH) #define XMIN (0 - (TEMPLATE_WIDTH / 2)) #define YMIN (TEMPLATE_HEIGHT / 2) int main(int argc, char** argv) { int bit, x, y; x = XMIN; y = YMIN; while((bit = getc(stdin)) != EOF) { if(bit == '\n') { x = XMIN; --y; continue; } if(bit == '#') { // parameters to sphere (in a blob) are: {, diameter, center-density} printf("sphere { <%f, %f, 0>, %f, 2 }\n", (float)(x * FACTOR), (float)(y * FACTOR), (float)(2.5 * FACTOR)); } ++x; } return 0; } vor-0.5.5/Makefile.win0000644000175100017510000000350511310013233015347 0ustar jasonwoofjasonwoof# Variations on Rockdodger # Copyright (C) 2004 Joshua Grams # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA CC := gcc LDFLAGS := -mwindows -lmingw32 -lSDLmain -lSDL -lSDL_image -lSDL_mixer CFLAGS := -Wall -O3 -ISDL my_objects := args.o dust.o file.o mt.o rocks.o score.o sprite.o sound.o my_objects += main.o libs := font.o objects := $(libs) $(my_objects) rocks := 00 01 02 03 04 05 06 07 08 09 rocks += 10 11 12 13 14 15 16 17 18 19 rocks += 20 21 22 23 24 25 26 27 28 29 rocks += 30 31 32 33 34 35 36 37 38 39 rocks += 40 41 42 43 44 45 46 47 48 49 rocks := $(rocks:%=data\rock%.png) graphics := data\ship.png data\life.png data\font.png $(rocks) .PHONY: all clean all: vor %.o: %.c $(CC) $(CFLAGS) -c -o $@ $< $(my_objects): vorconfig.h font.o: font.h args.o: args.h dust.o: globals.h dust.h mt.h file.o: file.h common.h main.o: args.h common.h dust.h file.h globals.h mt.h rocks.h score.h sprite.h sound.h mt.o: mt.h rocks.o: rocks.h common.h file.h globals.h mt.h sprite.h score.o: score.h common.h file.h sound.o: sound.h args.h common.h sprite.o: sprite.h common.h vor: $(objects) $(CC) $^ $(LDFLAGS) -o $@ clean: del vor del *.o vor-0.5.5/dust.h0000644000175100017510000000054211310013233014241 0ustar jasonwoofjasonwoof#ifndef VOR_DUST_H #define VOR_DUST_H /* * Dust motes are harmless background items. They are created when the * program is initialized, and are simply wrapped whenever they hit the * edge of the screen. */ #define N_DUST_MOTES 2000 #define MAX_DUST_DEPTH 2 void init_dust(void); void move_dust(void); void draw_dust(void); #endif // VOR_DUST_H vor-0.5.5/autopilot.c0000644000175100017510000000474711310013233015310 0ustar jasonwoofjasonwoof// Copyright (C) 2007 Jason Woofenden // // This file is part of VoR. // // VoR is free software; you can redistribute it and/or modify it // under the terms of the GNU General Public License as published by // the Free Software Foundation; either version 2, or (at your option) // any later version. // // VoR is distributed in the hope that it will be useful, but // WITHOUT ANY WARRANTY; without even the implied warranty of // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU // General Public License for more details. // // You should have received a copy of the GNU General Public License // along with VoR; see the file COPYING. If not, write to the // Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, // MA 02111-1307, USA. // This file has code to generate SDL keypress events #include #include #include "mt.h" // SETTINGS // // auto pilot waits a random amount of time between zero and this many 1/20ths of a second #define AUTOPILOT_MAX_DELAY 20.0 #define NUM_KEYS 5 SDLKey keysyms[NUM_KEYS] = { SDLK_SPACE, SDLK_LEFT, SDLK_RIGHT, SDLK_UP, SDLK_DOWN}; int states[NUM_KEYS] = { 0, 0, 0, 0, 0, }; float next_time; float delay; void autopilot_set_timer() { delay = 0; next_time = frnd() * AUTOPILOT_MAX_DELAY; } void autopilot_init() { autopilot_set_timer(); } void autopilot_fix_keystates(Uint8* table) { int i; for(i = 0; i < NUM_KEYS; ++i) { table[keysyms[i]] = states[i]; } } int autopilot_num_down() { int i, num; for(num = 0, i = 0; i < NUM_KEYS; ++i) { if(states[i]) { num++; } } return num; } void autopilot_send_event() { int down = autopilot_num_down(); int nth, i; //SDL_Event event; if(down && frnd() < 0.25 + (down / 4.0)) { //event.type = SDL_KEYUP; //event.key.state = 0; nth = (urnd() % down) + 1; for(i = 0; ; ++i) { if(states[i]) { --nth; } if(nth == 0) { //event.key.keysym.sym = keysyms[i]; states[i] = 0; break; } } } else { //event.type = SDL_KEYDOWN; //event.key.state = 1; nth = (urnd() % (NUM_KEYS - down)) + 1; for(i = 0; ; ++i) { if(!states[i]) { --nth; } if(nth == 0) { //event.key.keysym.sym = keysyms[i]; states[i] = 1; break; } } } //fprintf(stderr, "push event: %i %i\n", event.key.keysym.sym, event.type); //SDL_PushEvent(&event); } void autopilot(float ticks) { delay += ticks; if(delay > next_time) { autopilot_set_timer(); autopilot_send_event(); } } vor-0.5.5/font.pov0000644000175100017510000000146311310013233014610 0ustar jasonwoofjasonwoof// pass in a random seed (integer) to this file with +K #include "colors.inc" #declare RS = seed(clock + 1); #macro rnd() (rand(RS)) #end camera { orthographic // the _length_ of the up and right vectors determine the aspect ratio of the image (and in the case of an orthographic projection, also the _area_ visible (unless angle is defined, in which case the angle determines the visible area)) up <0, 0.40, 0> right <30, 0, 0> location <0, 0, -200> look_at <0, 0, 0> } // same light sorce as ship.pov light_source { <-500, 500, -700> White } blob{ #include "font_guts.pov" threshold 3 texture { pigment { rgb < 0.75, 0.75, 1.0 > } finish { ambient 0.35 brilliance 2 diffuse 0.3 metallic specular 0.6 roughness 1/60 reflection 0.25 } normal { bumps 0.1 scale 0.25 } } } vor-0.5.5/aclocal.m40000644000175100017510000001446411310013233014761 0ustar jasonwoofjasonwoof# Configure paths for SDL # Sam Lantinga 9/21/99 # stolen from Manish Singh # stolen back from Frank Belew # stolen from Manish Singh # Shamelessly stolen from Owen Taylor dnl AM_PATH_SDL([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND]]]) dnl Test for SDL, and define SDL_CFLAGS and SDL_LIBS dnl AC_DEFUN([AM_PATH_SDL], [dnl dnl Get the cflags and libraries from the sdl-config script dnl AC_ARG_WITH(sdl-prefix,[ --with-sdl-prefix=PFX Prefix where SDL is installed (optional)], sdl_prefix="$withval", sdl_prefix="") AC_ARG_WITH(sdl-exec-prefix,[ --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)], sdl_exec_prefix="$withval", sdl_exec_prefix="") AC_ARG_ENABLE(sdltest, [ --disable-sdltest Do not try to compile and run a test SDL program], , enable_sdltest=yes) if test x$sdl_exec_prefix != x ; then sdl_config_args="$sdl_config_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_config_args="$sdl_config_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi if test "x$prefix" != xNONE; then PATH="$prefix/bin:$prefix/usr/bin:$PATH" fi AC_PATH_PROG(SDL_CONFIG, sdl-config, no, [$PATH]) min_sdl_version=ifelse([$1], ,0.11.0,$1) AC_MSG_CHECKING(for SDL - version >= $min_sdl_version) no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdl_config_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdl_config_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_CXXFLAGS="$CXXFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" dnl dnl Now check if the installed SDL is sufficiently new. (Also sanity dnl checks the results of sdl-config to some extent dnl rm -f conf.sdltest AC_TRY_RUN([ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { printf("\n*** 'sdl-config --version' returned %d.%d.%d, but the minimum version\n", $sdl_major_version, $sdl_minor_version, $sdl_micro_version); printf("*** of SDL required is %d.%d.%d. If sdl-config is correct, then it is\n", major, minor, micro); printf("*** best to upgrade to the required version.\n"); printf("*** If sdl-config was wrong, set the environment variable SDL_CONFIG\n"); printf("*** to point to the correct copy of sdl-config, and remove the file\n"); printf("*** config.cache before re-running configure\n"); return 1; } } ],, no_sdl=yes,[echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then AC_MSG_RESULT(yes) ifelse([$2], , :, [$2]) else AC_MSG_RESULT(no) if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_TRY_LINK([ #include #include "SDL.h" int main(int argc, char *argv[]) { return 0; } #undef main #define main K_and_R_C_main ], [ return 0; ], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH"], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" ]) CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(SDL_CFLAGS) AC_SUBST(SDL_LIBS) rm -f conf.sdltest ]) vor-0.5.5/font.c0000644000175100017510000001245611310013233014232 0ustar jasonwoofjasonwoof// Copyright (C) 2006 Jason Woofenden // // This file is part of VoR. // // VoR is free software; you can redistribute it and/or modify it // under the terms of the GNU General Public License as published by // the Free Software Foundation; either version 2, or (at your option) // any later version. // // VoR is distributed in the hope that it will be useful, but // WITHOUT ANY WARRANTY; without even the implied warranty of // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU // General Public License for more details. // // You should have received a copy of the GNU General Public License // along with VoR; see the file COPYING. If not, write to the // Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, // MA 02111-1307, USA. #include #include #include #include "font.h" font *cur_font; extern SDL_Surface *surf_screen; int font_height() { return cur_font->bounds[0].h; } void font_set(font *to) { cur_font = to; } // return true if column of pixels (pix points to the top one) is all black int line_clear(unsigned char* pix, int height, int width) { int i; for(i = 0; i < height; ++i) { if(pix[0] != 0) { return 0; } pix += width; } return 1; } // return the number of consecutive colums of pixels are still clear (or still not clear) int find_change(unsigned char* pix, int height, int width) { int i; int state = line_clear(pix, height, width); pix += 3; for(i = 1; /*forever*/; pix += 3, ++i) { if(line_clear(pix, height, width) != state) { return i; } } } void font_free(font* garbage) { SDL_FreeSurface(garbage->pixels); free(garbage); } font* font_load(const char *filename) { font* new_font; int i; unsigned char* pix; int x = 0; int width; new_font = (font*) malloc(sizeof(font)); if(!new_font) { fprintf(stderr, "couldn't allocate memory for font.\n"); exit(1); } new_font->pixels = (SDL_Surface*)IMG_Load(filename); if(!new_font->pixels) { fprintf(stderr, "couldn't load font file '%s'.\n", filename); exit(1); } //SDL_SetColorKey(new_font->pixels, SDL_SRCCOLORKEY, 0); pix = new_font->pixels->pixels; // set all font rects to be the full height for(i = 0; i < 94; ++i) { new_font->bounds[i].y = 0; new_font->bounds[i].h = new_font->pixels->h; } // find the characters new_font->bounds[0].x = 0; // the first character starts at the begining for(i = 0; i < 93; ) { // find the end of the character width = find_change(pix, new_font->pixels->h, new_font->pixels->pitch); x += width; pix += width * new_font->pixels->format->BytesPerPixel; new_font->bounds[i].w = width; ++i; width = find_change(pix, new_font->pixels->h, new_font->pixels->pitch); x += width; pix += width * new_font->pixels->format->BytesPerPixel; new_font->bounds[i].x = x; } new_font->bounds[93].w = new_font->pixels->w - new_font->bounds[93].x; // the last character ends at the end // There is a common problem where with some fonts there is a column of all // black pixels between the parts of the double-quote, and this code thinks // that it is two seperate characters. This code currently assumes that // there is no such column. To change it so it assumes that the // double-quote character looks like 2, change the loop above to start at // zero, and uncomment the following indented stuff. // // The above has 3 problems: // // // 1) space is missing from the begining // // 2) ! is first instead of seccond // // 3) " is taking 2nd and 3rd position // // // merge pieces of double-quote // width = font_rects[2].x - font_rects[1].x; // font_rects[2].w += width; // font_rects[2].x = font_rects[1].x; // // // move ! // font_rects[1].x = font_rects[0].x; // font_rects[1].w = font_rects[0].w; // the width of the space is set to half the space between the first two characters width = new_font->bounds[1].x - (new_font->bounds[0].x + new_font->bounds[0].w); new_font->space_width = width / 2; new_font->letter_spacing = new_font->space_width / 4 ; if(new_font->space_width < 2) { new_font->space_width = 2; } if(new_font->letter_spacing < 1) { new_font->letter_spacing = 1; } font_set(new_font); return new_font; } void font_write(int x, int y, const char* message) { SDL_Rect dest = {x, y, 0, font_height()}; char c; if(message[0] == 0) { return; } for(c = *message++; c; c = *message++) { if(c > 31 && c < 127) { if(c == 32) { dest.x += cur_font->space_width; } else { c -= 33; dest.w = cur_font->bounds[(int)c].w; SDL_BlitSurface(cur_font->pixels, &(cur_font->bounds[(int)c]), surf_screen, &dest); dest.x += dest.w; } dest.x += cur_font->letter_spacing; } else { fprintf(stderr, "tried to print unknown char: %d (0x%x)\n", c, c); } } } // return the width in pixels of the string int font_width(const char* message) { int width = 0; char c; if(message[0] == 0) { return 0; } for(c = *message++; c; c = *message++) { if(c > 31 && c < 127) { if(c == 32) { width += cur_font->space_width; } else { c -= 33; width += cur_font->bounds[(int)c].w; } width += cur_font->letter_spacing; } else { fprintf(stderr, "tried to print unknown char: %d (0x%x)\n", c, c); } } // don't count spacing after the last char if(width) { width -= cur_font->letter_spacing; } return width; } vor-0.5.5/configure0000755000175100017510000054337011310013310015027 0ustar jasonwoofjasonwoof#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.63 for VoR 0.5.5. # # Report bugs to . # # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, # 2002, 2003, 2004, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi # PATH needs CR # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo if (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 { (exit 1); exit 1; } fi # Work around bugs in pre-3.0 UWIN ksh. for as_var in ENV MAIL MAILPATH do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # CDPATH. $as_unset CDPATH if test "x$CONFIG_SHELL" = x; then if (eval ":") 2>/dev/null; then as_have_required=yes else as_have_required=no fi if test $as_have_required = yes && (eval ": (as_func_return () { (exit \$1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = \"\$1\" ); then : else exitcode=1 echo positional parameters were not saved. fi test \$exitcode = 0) || { (exit 1); exit 1; } ( as_lineno_1=\$LINENO as_lineno_2=\$LINENO test \"x\$as_lineno_1\" != \"x\$as_lineno_2\" && test \"x\`expr \$as_lineno_1 + 1\`\" = \"x\$as_lineno_2\") || { (exit 1); exit 1; } ") 2> /dev/null; then : else as_candidate_shells= as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. case $as_dir in /*) for as_base in sh bash ksh sh5; do as_candidate_shells="$as_candidate_shells $as_dir/$as_base" done;; esac done IFS=$as_save_IFS for as_shell in $as_candidate_shells $SHELL; do # Try only shells that exist, to save several forks. if { test -f "$as_shell" || test -f "$as_shell.exe"; } && { ("$as_shell") 2> /dev/null <<\_ASEOF if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi : _ASEOF }; then CONFIG_SHELL=$as_shell as_have_required=yes if { "$as_shell" 2> /dev/null <<\_ASEOF if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi : (as_func_return () { (exit $1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = "$1" ); then : else exitcode=1 echo positional parameters were not saved. fi test $exitcode = 0) || { (exit 1); exit 1; } ( as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2") || { (exit 1); exit 1; } _ASEOF }; then break fi fi done if test "x$CONFIG_SHELL" != x; then for as_var in BASH_ENV ENV do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done export CONFIG_SHELL exec "$CONFIG_SHELL" "$as_myself" ${1+"$@"} fi if test $as_have_required = no; then echo This script requires a shell more modern than all the echo shells that I found on your system. Please install a echo modern shell, or manually run the script under such a echo shell if you do have one. { (exit 1); exit 1; } fi fi fi (eval "as_func_return () { (exit \$1) } as_func_success () { as_func_return 0 } as_func_failure () { as_func_return 1 } as_func_ret_success () { return 0 } as_func_ret_failure () { return 1 } exitcode=0 if as_func_success; then : else exitcode=1 echo as_func_success failed. fi if as_func_failure; then exitcode=1 echo as_func_failure succeeded. fi if as_func_ret_success; then : else exitcode=1 echo as_func_ret_success failed. fi if as_func_ret_failure; then exitcode=1 echo as_func_ret_failure succeeded. fi if ( set x; as_func_ret_success y && test x = \"\$1\" ); then : else exitcode=1 echo positional parameters were not saved. fi test \$exitcode = 0") || { echo No shell found that supports shell functions. echo Please tell bug-autoconf@gnu.org about your system, echo including any error possibly output before this message. echo This can help us improve future autoconf versions. echo Configuration will now proceed without shell functions. } as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line after each line using $LINENO; the second 'sed' # does the real work. The second script uses 'N' to pair each # line-number line with the line containing $LINENO, and appends # trailing '-' during substitution so that $LINENO is not a special # case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # scripts with optimization help from Paolo Bonzini. Blame Lee # E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in -n*) case `echo 'x\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. *) ECHO_C='\c';; esac;; *) ECHO_N='-n';; esac if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 7<&0 &1 # Name of the host. # hostname on some systems (SVR3.2, Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` # # Initializations. # ac_default_prefix=/usr/local ac_clean_files= ac_config_libobj_dir=. LIBOBJS= cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= SHELL=${CONFIG_SHELL-/bin/sh} # Identity of this package. PACKAGE_NAME='VoR' PACKAGE_TARNAME='vor' PACKAGE_VERSION='0.5.5' PACKAGE_STRING='VoR 0.5.5' PACKAGE_BUGREPORT='jason@jasonwoof.com' ac_unique_file="config.h.in" # Factoring default headers for most tests. ac_includes_default="\ #include #ifdef HAVE_SYS_TYPES_H # include #endif #ifdef HAVE_SYS_STAT_H # include #endif #ifdef STDC_HEADERS # include # include #else # ifdef HAVE_STDLIB_H # include # endif #endif #ifdef HAVE_STRING_H # if !defined STDC_HEADERS && defined HAVE_MEMORY_H # include # endif # include #endif #ifdef HAVE_STRINGS_H # include #endif #ifdef HAVE_INTTYPES_H # include #endif #ifdef HAVE_STDINT_H # include #endif #ifdef HAVE_UNISTD_H # include #endif" ac_subst_vars='LTLIBOBJS LIBOBJS EGREP GREP CPP SDL_LIBS SDL_CFLAGS SDL_CONFIG SET_MAKE INSTALL_DATA INSTALL_SCRIPT INSTALL_PROGRAM OBJEXT EXEEXT ac_ct_CC CPPFLAGS LDFLAGS CFLAGS CC target_alias host_alias build_alias LIBS ECHO_T ECHO_N ECHO_C DEFS mandir localedir libdir psdir pdfdir dvidir htmldir infodir docdir oldincludedir includedir localstatedir sharedstatedir sysconfdir datadir datarootdir libexecdir sbindir bindir program_transform_name prefix exec_prefix PACKAGE_BUGREPORT PACKAGE_STRING PACKAGE_VERSION PACKAGE_TARNAME PACKAGE_NAME PATH_SEPARATOR SHELL' ac_subst_files='' ac_user_opts=' enable_option_checking with_sdl_prefix with_sdl_exec_prefix enable_sdltest ' ac_precious_vars='build_alias host_alias target_alias CC CFLAGS LDFLAGS LIBS CPPFLAGS CPP' # Initialize some variables set by options. ac_init_help= ac_init_version=false ac_unrecognized_opts= ac_unrecognized_sep= # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. # (The list follows the same order as the GNU Coding Standards.) bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datarootdir='${prefix}/share' datadir='${datarootdir}' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' includedir='${prefix}/include' oldincludedir='/usr/include' docdir='${datarootdir}/doc/${PACKAGE_TARNAME}' infodir='${datarootdir}/info' htmldir='${docdir}' dvidir='${docdir}' pdfdir='${docdir}' psdir='${docdir}' libdir='${exec_prefix}/lib' localedir='${datarootdir}/locale' mandir='${datarootdir}/man' ac_prev= ac_dashdash= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval $ac_prev=\$ac_option ac_prev= continue fi case $ac_option in *=*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; *) ac_optarg=yes ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=*) datadir=$ac_optarg ;; -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ | --dataroo | --dataro | --datar) ac_prev=datarootdir ;; -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) datarootdir=$ac_optarg ;; -disable-* | --disable-*) ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && { $as_echo "$as_me: error: invalid feature name: $ac_useropt" >&2 { (exit 1); exit 1; }; } ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=no ;; -docdir | --docdir | --docdi | --doc | --do) ac_prev=docdir ;; -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) docdir=$ac_optarg ;; -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) ac_prev=dvidir ;; -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) dvidir=$ac_optarg ;; -enable-* | --enable-*) ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && { $as_echo "$as_me: error: invalid feature name: $ac_useropt" >&2 { (exit 1); exit 1; }; } ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=\$ac_optarg ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) ac_prev=htmldir ;; -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ | --ht=*) htmldir=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localedir | --localedir | --localedi | --localed | --locale) ac_prev=localedir ;; -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) localedir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst | --locals) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) ac_prev=pdfdir ;; -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) pdfdir=$ac_optarg ;; -psdir | --psdir | --psdi | --psd | --ps) ac_prev=psdir ;; -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) psdir=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && { $as_echo "$as_me: error: invalid package name: $ac_useropt" >&2 { (exit 1); exit 1; }; } ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=\$ac_optarg ;; -without-* | --without-*) ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && { $as_echo "$as_me: error: invalid package name: $ac_useropt" >&2 { (exit 1); exit 1; }; } ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=no ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) { $as_echo "$as_me: error: unrecognized option: $ac_option Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; } ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null && { $as_echo "$as_me: error: invalid variable name: $ac_envvar" >&2 { (exit 1); exit 1; }; } eval $ac_envvar=\$ac_optarg export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option} ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` { $as_echo "$as_me: error: missing argument to $ac_option" >&2 { (exit 1); exit 1; }; } fi if test -n "$ac_unrecognized_opts"; then case $enable_option_checking in no) ;; fatal) { $as_echo "$as_me: error: unrecognized options: $ac_unrecognized_opts" >&2 { (exit 1); exit 1; }; } ;; *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; esac fi # Check all directory arguments for consistency. for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ datadir sysconfdir sharedstatedir localstatedir includedir \ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ libdir localedir mandir do eval ac_val=\$$ac_var # Remove trailing slashes. case $ac_val in */ ) ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'` eval $ac_var=\$ac_val;; esac # Be sure to have absolute directory names. case $ac_val in [\\/$]* | ?:[\\/]* ) continue;; NONE | '' ) case $ac_var in *prefix ) continue;; esac;; esac { $as_echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2 { (exit 1); exit 1; }; } done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe $as_echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host. If a cross compiler is detected then cross compile mode will be used." >&2 elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null ac_pwd=`pwd` && test -n "$ac_pwd" && ac_ls_di=`ls -di .` && ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || { $as_echo "$as_me: error: working directory cannot be determined" >&2 { (exit 1); exit 1; }; } test "X$ac_ls_di" = "X$ac_pwd_ls_di" || { $as_echo "$as_me: error: pwd does not report name of working directory" >&2 { (exit 1); exit 1; }; } # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then the parent directory. ac_confdir=`$as_dirname -- "$as_myself" || $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_myself" : 'X\(//\)[^/]' \| \ X"$as_myself" : 'X\(//\)$' \| \ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_myself" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` srcdir=$ac_confdir if test ! -r "$srcdir/$ac_unique_file"; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r "$srcdir/$ac_unique_file"; then test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." { $as_echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2 { (exit 1); exit 1; }; } fi ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" ac_abs_confdir=`( cd "$srcdir" && test -r "./$ac_unique_file" || { $as_echo "$as_me: error: $ac_msg" >&2 { (exit 1); exit 1; }; } pwd)` # When building in place, set srcdir=. if test "$ac_abs_confdir" = "$ac_pwd"; then srcdir=. fi # Remove unnecessary trailing slashes from srcdir. # Double slashes in file names in object file debugging info # mess up M-x gdb in Emacs. case $srcdir in */) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; esac for ac_var in $ac_precious_vars; do eval ac_env_${ac_var}_set=\${${ac_var}+set} eval ac_env_${ac_var}_value=\$${ac_var} eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} eval ac_cv_env_${ac_var}_value=\$${ac_var} done # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures VoR 0.5.5 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] --datadir=DIR read-only architecture-independent data [DATAROOTDIR] --infodir=DIR info documentation [DATAROOTDIR/info] --localedir=DIR locale-dependent data [DATAROOTDIR/locale] --mandir=DIR man documentation [DATAROOTDIR/man] --docdir=DIR documentation root [DATAROOTDIR/doc/vor] --htmldir=DIR html documentation [DOCDIR] --dvidir=DIR dvi documentation [DOCDIR] --pdfdir=DIR pdf documentation [DOCDIR] --psdir=DIR ps documentation [DOCDIR] _ACEOF cat <<\_ACEOF _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in short | recursive ) echo "Configuration of VoR 0.5.5:";; esac cat <<\_ACEOF Optional Features: --disable-option-checking ignore unrecognized --enable/--with options --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) --enable-FEATURE[=ARG] include FEATURE [ARG=yes] --disable-sdltest Do not try to compile and run a test SDL program Optional Packages: --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) --with-sdl-prefix=PFX Prefix where SDL is installed (optional) --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional) Some influential environment variables: CC C compiler command CFLAGS C compiler flags LDFLAGS linker flags, e.g. -L if you have libraries in a nonstandard directory LIBS libraries to pass to the linker, e.g. -l CPPFLAGS C/C++/Objective C preprocessor flags, e.g. -I if you have headers in a nonstandard directory CPP C preprocessor Use these variables to override the choices made by `configure' or to help it to find libraries and programs with nonstandard names/locations. Report bugs to . _ACEOF ac_status=$? fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d "$ac_dir" || { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } || continue ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } # Check for guested configure. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive elif test -f "$ac_srcdir/configure"; then echo && $SHELL "$ac_srcdir/configure" --help=recursive else $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF VoR configure 0.5.5 generated by GNU Autoconf 2.63 Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit fi cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by VoR $as_me 0.5.5, which was generated by GNU Autoconf 2.63. Invocation command line was $ $0 $@ _ACEOF exec 5>>config.log { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` /usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. $as_echo "PATH: $as_dir" done IFS=$as_save_IFS } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;; 2) ac_configure_args1="$ac_configure_args1 '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi ac_configure_args="$ac_configure_args '$ac_arg'" ;; esac done done $as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; } $as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; } # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo cat <<\_ASBOX ## ---------------- ## ## Cache variables. ## ## ---------------- ## _ASBOX echo # The following way of writing the cache mishandles newlines in values, ( for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:$LINENO: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) $as_unset $ac_var ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( *${as_nl}ac_space=\ *) sed -n \ "s/'\''/'\''\\\\'\'''\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" ;; #( *) sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) echo cat <<\_ASBOX ## ----------------- ## ## Output variables. ## ## ----------------- ## _ASBOX echo for ac_var in $ac_subst_vars do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then cat <<\_ASBOX ## ------------------- ## ## File substitutions. ## ## ------------------- ## _ASBOX echo for ac_var in $ac_subst_files do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then cat <<\_ASBOX ## ----------- ## ## confdefs.h. ## ## ----------- ## _ASBOX echo cat confdefs.h echo fi test "$ac_signal" != 0 && $as_echo "$as_me: caught signal $ac_signal" $as_echo "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer an explicitly selected file to automatically selected ones. ac_site_file1=NONE ac_site_file2=NONE if test -n "$CONFIG_SITE"; then ac_site_file1=$CONFIG_SITE elif test "x$prefix" != xNONE; then ac_site_file1=$prefix/share/config.site ac_site_file2=$prefix/etc/config.site else ac_site_file1=$ac_default_prefix/share/config.site ac_site_file2=$ac_default_prefix/etc/config.site fi for ac_site_file in "$ac_site_file1" "$ac_site_file2" do test "x$ac_site_file" = xNONE && continue if test -r "$ac_site_file"; then { $as_echo "$as_me:$LINENO: loading site script $ac_site_file" >&5 $as_echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special # files actually), so we avoid doing that. if test -f "$cache_file"; then { $as_echo "$as_me:$LINENO: loading cache $cache_file" >&5 $as_echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else { $as_echo "$as_me:$LINENO: creating cache $cache_file" >&5 $as_echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in $ac_precious_vars; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val=\$ac_cv_env_${ac_var}_value eval ac_new_val=\$ac_env_${ac_var}_value case $ac_old_set,$ac_new_set in set,) { $as_echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { $as_echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then # differences in whitespace do not lead to failure. ac_old_val_w=`echo x $ac_old_val` ac_new_val_w=`echo x $ac_new_val` if test "$ac_old_val_w" != "$ac_new_val_w"; then { $as_echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5 $as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} ac_cache_corrupted=: else { $as_echo "$as_me:$LINENO: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 $as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} eval $ac_var=\$ac_old_val fi { $as_echo "$as_me:$LINENO: former value: \`$ac_old_val'" >&5 $as_echo "$as_me: former value: \`$ac_old_val'" >&2;} { $as_echo "$as_me:$LINENO: current value: \`$ac_new_val'" >&5 $as_echo "$as_me: current value: \`$ac_new_val'" >&2;} fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) ac_configure_args="$ac_configure_args '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { $as_echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5 $as_echo "$as_me: error: changes in the environment can compromise the build" >&2;} { { $as_echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5 $as_echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;} { (exit 1); exit 1; }; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu ac_config_headers="$ac_config_headers config.h" # Checks for programs. ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. set dummy ${ac_tool_prefix}gcc; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}gcc" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:$LINENO: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_ac_ct_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="gcc" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { $as_echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 $as_echo "$ac_ct_CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:$LINENO: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi else CC="$ac_cv_prog_CC" fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. set dummy ${ac_tool_prefix}cc; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}cc" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:$LINENO: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi fi fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else ac_prog_rejected=no as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS if test $ac_prog_rejected = yes; then # We found a bogon in the path, so make sure we never use it. set dummy $ac_cv_prog_CC shift if test $# != 0; then # We chose a different compiler from the bogus one. # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" fi fi fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:$LINENO: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then for ac_prog in cl.exe do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="$ac_tool_prefix$ac_prog" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:$LINENO: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi test -n "$CC" && break done fi if test -z "$CC"; then ac_ct_CC=$CC for ac_prog in cl.exe do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_prog_ac_ct_CC+set}" = set; then $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="$ac_prog" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { $as_echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 $as_echo "$ac_ct_CC" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi test -n "$ac_ct_CC" && break done if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:$LINENO: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi fi fi test -z "$CC" && { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&5 $as_echo "$as_me: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; }; } # Provide some information about the compiler. $as_echo "$as_me:$LINENO: checking for C compiler version" >&5 set X $ac_compile ac_compiler=$2 { (ac_try="$ac_compiler --version >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compiler --version >&5") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (ac_try="$ac_compiler -v >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compiler -v >&5") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (ac_try="$ac_compiler -V >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compiler -V >&5") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files a.out a.out.dSYM a.exe b.out" # Try to create an executable without -o first, disregard a.out. # It will help us diagnose broken compilers, and finding out an intuition # of exeext. { $as_echo "$as_me:$LINENO: checking for C compiler default output file name" >&5 $as_echo_n "checking for C compiler default output file name... " >&6; } ac_link_default=`$as_echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` # The possible output files: ac_files="a.out conftest.exe conftest a.exe a_out.exe b.out conftest.*" ac_rmfiles= for ac_file in $ac_files do case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; * ) ac_rmfiles="$ac_rmfiles $ac_file";; esac done rm -f $ac_rmfiles if { (ac_try="$ac_link_default" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link_default") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # Autoconf-2.13 could set the ac_cv_exeext variable to `no'. # So ignore a value of `no', otherwise this would lead to `EXEEXT = no' # in a Makefile. We should not override ac_cv_exeext if it was cached, # so that the user can short-circuit this test for compilers unknown to # Autoconf. for ac_file in $ac_files '' do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; [ab].out ) # We found the default executable, but exeext='' is most # certainly right. break;; *.* ) if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no; then :; else ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` fi # We set ac_cv_exeext here because the later test for it is not # safe: cross compilers may not add the suffix if given an `-o' # argument, so we may need to know it at that point already. # Even if this section looks crufty: it has the advantage of # actually working. break;; * ) break;; esac done test "$ac_cv_exeext" = no && ac_cv_exeext= else ac_file='' fi { $as_echo "$as_me:$LINENO: result: $ac_file" >&5 $as_echo "$ac_file" >&6; } if test -z "$ac_file"; then $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: C compiler cannot create executables See \`config.log' for more details." >&5 $as_echo "$as_me: error: C compiler cannot create executables See \`config.log' for more details." >&2;} { (exit 77); exit 77; }; }; } fi ac_exeext=$ac_cv_exeext # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. { $as_echo "$as_me:$LINENO: checking whether the C compiler works" >&5 $as_echo_n "checking whether the C compiler works... " >&6; } # FIXME: These cross compiler hacks should be removed for Autoconf 3.0 # If not cross compiling, check that we can run a simple program. if test "$cross_compiling" != yes; then if { ac_try='./$ac_file' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then cross_compiling=no else if test "$cross_compiling" = maybe; then cross_compiling=yes else { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&5 $as_echo "$as_me: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; }; } fi fi fi { $as_echo "$as_me:$LINENO: result: yes" >&5 $as_echo "yes" >&6; } rm -f -r a.out a.out.dSYM a.exe conftest$ac_cv_exeext b.out ac_clean_files=$ac_clean_files_save # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. { $as_echo "$as_me:$LINENO: checking whether we are cross compiling" >&5 $as_echo_n "checking whether we are cross compiling... " >&6; } { $as_echo "$as_me:$LINENO: result: $cross_compiling" >&5 $as_echo "$cross_compiling" >&6; } { $as_echo "$as_me:$LINENO: checking for suffix of executables" >&5 $as_echo_n "checking for suffix of executables... " >&6; } if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # If both `conftest.exe' and `conftest' are `present' (well, observable) # catch `conftest.exe'. For instance with Cygwin, `ls conftest' will # work properly (i.e., refer to `conftest.exe'), while it won't with # `rm'. for ac_file in conftest.exe conftest conftest.*; do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` break;; * ) break;; esac done else { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&5 $as_echo "$as_me: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; }; } fi rm -f conftest$ac_cv_exeext { $as_echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5 $as_echo "$ac_cv_exeext" >&6; } rm -f conftest.$ac_ext EXEEXT=$ac_cv_exeext ac_exeext=$EXEEXT { $as_echo "$as_me:$LINENO: checking for suffix of object files" >&5 $as_echo_n "checking for suffix of object files... " >&6; } if test "${ac_cv_objext+set}" = set; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.o conftest.obj if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then for ac_file in conftest.o conftest.obj conftest.*; do test -f "$ac_file" || continue; case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM ) ;; *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'` break;; esac done else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&5 $as_echo "$as_me: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; }; } fi rm -f conftest.$ac_cv_objext conftest.$ac_ext fi { $as_echo "$as_me:$LINENO: result: $ac_cv_objext" >&5 $as_echo "$ac_cv_objext" >&6; } OBJEXT=$ac_cv_objext ac_objext=$OBJEXT { $as_echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5 $as_echo_n "checking whether we are using the GNU C compiler... " >&6; } if test "${ac_cv_c_compiler_gnu+set}" = set; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { #ifndef __GNUC__ choke me #endif ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_compiler_gnu=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_compiler_gnu=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_c_compiler_gnu=$ac_compiler_gnu fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5 $as_echo "$ac_cv_c_compiler_gnu" >&6; } if test $ac_compiler_gnu = yes; then GCC=yes else GCC= fi ac_test_CFLAGS=${CFLAGS+set} ac_save_CFLAGS=$CFLAGS { $as_echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5 $as_echo_n "checking whether $CC accepts -g... " >&6; } if test "${ac_cv_prog_cc_g+set}" = set; then $as_echo_n "(cached) " >&6 else ac_save_c_werror_flag=$ac_c_werror_flag ac_c_werror_flag=yes ac_cv_prog_cc_g=no CFLAGS="-g" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_g=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 CFLAGS="" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_c_werror_flag=$ac_save_c_werror_flag CFLAGS="-g" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_g=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_c_werror_flag=$ac_save_c_werror_flag fi { $as_echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5 $as_echo "$ac_cv_prog_cc_g" >&6; } if test "$ac_test_CFLAGS" = set; then CFLAGS=$ac_save_CFLAGS elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then CFLAGS="-g -O2" else CFLAGS="-g" fi else if test "$GCC" = yes; then CFLAGS="-O2" else CFLAGS= fi fi { $as_echo "$as_me:$LINENO: checking for $CC option to accept ISO C89" >&5 $as_echo_n "checking for $CC option to accept ISO C89... " >&6; } if test "${ac_cv_prog_cc_c89+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_prog_cc_c89=no ac_save_CC=$CC cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include /* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ struct buf { int x; }; FILE * (*rcsopen) (struct buf *, struct stat *, int); static char *e (p, i) char **p; int i; { return p[i]; } static char *f (char * (*g) (char **, int), char **p, ...) { char *s; va_list v; va_start (v,p); s = g (p, va_arg (v,int)); va_end (v); return s; } /* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has function prototypes and stuff, but not '\xHH' hex character constants. These don't provoke an error unfortunately, instead are silently treated as 'x'. The following induces an error, until -std is added to get proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an array size at least. It's necessary to write '\x00'==0 to get something that's true only with -std. */ int osf4_cc_array ['\x00' == 0 ? 1 : -1]; /* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters inside strings and character constants. */ #define FOO(x) 'x' int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1]; int test (int i, double x); struct s1 {int (*f) (int a);}; struct s2 {int (*f) (double a);}; int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); int argc; char **argv; int main () { return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; ; return 0; } _ACEOF for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \ -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" do CC="$ac_save_CC $ac_arg" rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_prog_cc_c89=$ac_arg else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext test "x$ac_cv_prog_cc_c89" != "xno" && break done rm -f conftest.$ac_ext CC=$ac_save_CC fi # AC_CACHE_VAL case "x$ac_cv_prog_cc_c89" in x) { $as_echo "$as_me:$LINENO: result: none needed" >&5 $as_echo "none needed" >&6; } ;; xno) { $as_echo "$as_me:$LINENO: result: unsupported" >&5 $as_echo "unsupported" >&6; } ;; *) CC="$CC $ac_cv_prog_cc_c89" { $as_echo "$as_me:$LINENO: result: $ac_cv_prog_cc_c89" >&5 $as_echo "$ac_cv_prog_cc_c89" >&6; } ;; esac ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu ac_aux_dir= for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do if test -f "$ac_dir/install-sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f "$ac_dir/install.sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f "$ac_dir/shtool"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then { { $as_echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&5 $as_echo "$as_me: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&2;} { (exit 1); exit 1; }; } fi # These three variables are undocumented and unsupported, # and are intended to be withdrawn in a future Autoconf release. # They can cause serious problems if a builder's source tree is in a directory # whose full name contains unusual characters. ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. # Reject install programs that cannot install multiple files. { $as_echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5 $as_echo_n "checking for a BSD-compatible install... " >&6; } if test -z "$INSTALL"; then if test "${ac_cv_path_install+set}" = set; then $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in ./ | .// | /cC/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else rm -rf conftest.one conftest.two conftest.dir echo one > conftest.one echo two > conftest.two mkdir conftest.dir if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" && test -s conftest.one && test -s conftest.two && test -s conftest.dir/conftest.one && test -s conftest.dir/conftest.two then ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi fi done done ;; esac done IFS=$as_save_IFS rm -rf conftest.one conftest.two conftest.dir fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { $as_echo "$as_me:$LINENO: result: $INSTALL" >&5 $as_echo "$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' { $as_echo "$as_me:$LINENO: checking whether ${MAKE-make} sets \$(MAKE)" >&5 $as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } set x ${MAKE-make} ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` if { as_var=ac_cv_prog_make_${ac_make}_set; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 else cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @echo '@@@%%%=$(MAKE)=@@@%%%' _ACEOF # GNU make sometimes prints "make[1]: Entering...", which would confuse us. case `${MAKE-make} -f conftest.make 2>/dev/null` in *@@@%%%=?*=@@@%%%*) eval ac_cv_prog_make_${ac_make}_set=yes;; *) eval ac_cv_prog_make_${ac_make}_set=no;; esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then { $as_echo "$as_me:$LINENO: result: yes" >&5 $as_echo "yes" >&6; } SET_MAKE= else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi # Checks for libraries. { $as_echo "$as_me:$LINENO: checking for IMG_LoadPNG_RW in -lSDL_image" >&5 $as_echo_n "checking for IMG_LoadPNG_RW in -lSDL_image... " >&6; } if test "${ac_cv_lib_SDL_image_IMG_LoadPNG_RW+set}" = set; then $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lSDL_image $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char IMG_LoadPNG_RW (); int main () { return IMG_LoadPNG_RW (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || $as_test_x conftest$ac_exeext }; then ac_cv_lib_SDL_image_IMG_LoadPNG_RW=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_SDL_image_IMG_LoadPNG_RW=no fi rm -rf conftest.dSYM rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:$LINENO: result: $ac_cv_lib_SDL_image_IMG_LoadPNG_RW" >&5 $as_echo "$ac_cv_lib_SDL_image_IMG_LoadPNG_RW" >&6; } if test "x$ac_cv_lib_SDL_image_IMG_LoadPNG_RW" = x""yes; then cat >>confdefs.h <<_ACEOF #define HAVE_LIBSDL_IMAGE 1 _ACEOF LIBS="-lSDL_image $LIBS" fi { $as_echo "$as_me:$LINENO: checking for Mix_OpenAudio in -lSDL_mixer" >&5 $as_echo_n "checking for Mix_OpenAudio in -lSDL_mixer... " >&6; } if test "${ac_cv_lib_SDL_mixer_Mix_OpenAudio+set}" = set; then $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lSDL_mixer $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char Mix_OpenAudio (); int main () { return Mix_OpenAudio (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || $as_test_x conftest$ac_exeext }; then ac_cv_lib_SDL_mixer_Mix_OpenAudio=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_SDL_mixer_Mix_OpenAudio=no fi rm -rf conftest.dSYM rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:$LINENO: result: $ac_cv_lib_SDL_mixer_Mix_OpenAudio" >&5 $as_echo "$ac_cv_lib_SDL_mixer_Mix_OpenAudio" >&6; } if test "x$ac_cv_lib_SDL_mixer_Mix_OpenAudio" = x""yes; then cat >>confdefs.h <<_ACEOF #define HAVE_LIBSDL_MIXER 1 _ACEOF LIBS="-lSDL_mixer $LIBS" fi SDL_VERSION=1.2.0 # Check whether --with-sdl-prefix was given. if test "${with_sdl_prefix+set}" = set; then withval=$with_sdl_prefix; sdl_prefix="$withval" else sdl_prefix="" fi # Check whether --with-sdl-exec-prefix was given. if test "${with_sdl_exec_prefix+set}" = set; then withval=$with_sdl_exec_prefix; sdl_exec_prefix="$withval" else sdl_exec_prefix="" fi # Check whether --enable-sdltest was given. if test "${enable_sdltest+set}" = set; then enableval=$enable_sdltest; else enable_sdltest=yes fi if test x$sdl_exec_prefix != x ; then sdl_config_args="$sdl_config_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_config_args="$sdl_config_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi if test "x$prefix" != xNONE; then PATH="$prefix/bin:$prefix/usr/bin:$PATH" fi # Extract the first word of "sdl-config", so it can be a program name with args. set dummy sdl-config; ac_word=$2 { $as_echo "$as_me:$LINENO: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if test "${ac_cv_path_SDL_CONFIG+set}" = set; then $as_echo_n "(cached) " >&6 else case $SDL_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_SDL_CONFIG="$SDL_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_path_SDL_CONFIG="$as_dir/$ac_word$ac_exec_ext" $as_echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS test -z "$ac_cv_path_SDL_CONFIG" && ac_cv_path_SDL_CONFIG="no" ;; esac fi SDL_CONFIG=$ac_cv_path_SDL_CONFIG if test -n "$SDL_CONFIG"; then { $as_echo "$as_me:$LINENO: result: $SDL_CONFIG" >&5 $as_echo "$SDL_CONFIG" >&6; } else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } fi min_sdl_version=$SDL_VERSION { $as_echo "$as_me:$LINENO: checking for SDL - version >= $min_sdl_version" >&5 $as_echo_n "checking for SDL - version >= $min_sdl_version... " >&6; } no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdl_config_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdl_config_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_CXXFLAGS="$CXXFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" rm -f conf.sdltest if test "$cross_compiling" = yes; then echo $ac_n "cross compiling; assumed OK... $ac_c" else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include "SDL.h" char* my_strdup (char *str) { char *new_str; if (str) { new_str = (char *)malloc ((strlen (str) + 1) * sizeof(char)); strcpy (new_str, str); } else new_str = NULL; return new_str; } int main (int argc, char *argv[]) { int major, minor, micro; char *tmp_version; /* This hangs on some systems (?) system ("touch conf.sdltest"); */ { FILE *fp = fopen("conf.sdltest", "a"); if ( fp ) fclose(fp); } /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = my_strdup("$min_sdl_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { printf("\n*** 'sdl-config --version' returned %d.%d.%d, but the minimum version\n", $sdl_major_version, $sdl_minor_version, $sdl_micro_version); printf("*** of SDL required is %d.%d.%d. If sdl-config is correct, then it is\n", major, minor, micro); printf("*** best to upgrade to the required version.\n"); printf("*** If sdl-config was wrong, set the environment variable SDL_CONFIG\n"); printf("*** to point to the correct copy of sdl-config, and remove the file\n"); printf("*** config.cache before re-running configure\n"); return 1; } } _ACEOF rm -f conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else $as_echo "$as_me: program exited with status $ac_status" >&5 $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) no_sdl=yes fi rm -rf conftest.dSYM rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then { $as_echo "$as_me:$LINENO: result: yes" >&5 $as_echo "yes" >&6; } : else { $as_echo "$as_me:$LINENO: result: no" >&5 $as_echo "no" >&6; } if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include "SDL.h" int main(int argc, char *argv[]) { return 0; } #undef main #define main K_and_R_C_main int main () { return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || $as_test_x conftest$ac_exeext }; then echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH" else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" fi rm -rf conftest.dSYM rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" { { $as_echo "$as_me:$LINENO: error: *** SDL version $SDL_VERSION not found!" >&5 $as_echo "$as_me: error: *** SDL version $SDL_VERSION not found!" >&2;} { (exit 1); exit 1; }; } fi rm -f conf.sdltest # Checks for header files. ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu { $as_echo "$as_me:$LINENO: checking how to run the C preprocessor" >&5 $as_echo_n "checking how to run the C preprocessor... " >&6; } # On Suns, sometimes $CPP names a directory. if test -n "$CPP" && test -d "$CPP"; then CPP= fi if test -z "$CPP"; then if test "${ac_cv_prog_CPP+set}" = set; then $as_echo_n "(cached) " >&6 else # Double quotes because CPP needs to be expanded for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp" do ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether nonexistent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then # Broken: success on invalid input. continue else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then break fi done ac_cv_prog_CPP=$CPP fi CPP=$ac_cv_prog_CPP else ac_cv_prog_CPP=$CPP fi { $as_echo "$as_me:$LINENO: result: $CPP" >&5 $as_echo "$CPP" >&6; } ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether nonexistent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then # Broken: success on invalid input. continue else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then : else { { $as_echo "$as_me:$LINENO: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { { $as_echo "$as_me:$LINENO: error: C preprocessor \"$CPP\" fails sanity check See \`config.log' for more details." >&5 $as_echo "$as_me: error: C preprocessor \"$CPP\" fails sanity check See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; }; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu { $as_echo "$as_me:$LINENO: checking for grep that handles long lines and -e" >&5 $as_echo_n "checking for grep that handles long lines and -e... " >&6; } if test "${ac_cv_path_GREP+set}" = set; then $as_echo_n "(cached) " >&6 else if test -z "$GREP"; then ac_path_GREP_found=false # Loop through the user's path and test for each of PROGNAME-LIST as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in grep ggrep; do for ac_exec_ext in '' $ac_executable_extensions; do ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext" { test -f "$ac_path_GREP" && $as_test_x "$ac_path_GREP"; } || continue # Check for GNU ac_path_GREP and select it if it is found. # Check for GNU $ac_path_GREP case `"$ac_path_GREP" --version 2>&1` in *GNU*) ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;; *) ac_count=0 $as_echo_n 0123456789 >"conftest.in" while : do cat "conftest.in" "conftest.in" >"conftest.tmp" mv "conftest.tmp" "conftest.in" cp "conftest.in" "conftest.nl" $as_echo 'GREP' >> "conftest.nl" "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break ac_count=`expr $ac_count + 1` if test $ac_count -gt ${ac_path_GREP_max-0}; then # Best one so far, save it but keep looking for a better one ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_max=$ac_count fi # 10*(2^10) chars as input seems more than enough test $ac_count -gt 10 && break done rm -f conftest.in conftest.tmp conftest.nl conftest.out;; esac $ac_path_GREP_found && break 3 done done done IFS=$as_save_IFS if test -z "$ac_cv_path_GREP"; then { { $as_echo "$as_me:$LINENO: error: no acceptable grep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5 $as_echo "$as_me: error: no acceptable grep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;} { (exit 1); exit 1; }; } fi else ac_cv_path_GREP=$GREP fi fi { $as_echo "$as_me:$LINENO: result: $ac_cv_path_GREP" >&5 $as_echo "$ac_cv_path_GREP" >&6; } GREP="$ac_cv_path_GREP" { $as_echo "$as_me:$LINENO: checking for egrep" >&5 $as_echo_n "checking for egrep... " >&6; } if test "${ac_cv_path_EGREP+set}" = set; then $as_echo_n "(cached) " >&6 else if echo a | $GREP -E '(a|b)' >/dev/null 2>&1 then ac_cv_path_EGREP="$GREP -E" else if test -z "$EGREP"; then ac_path_EGREP_found=false # Loop through the user's path and test for each of PROGNAME-LIST as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in egrep; do for ac_exec_ext in '' $ac_executable_extensions; do ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext" { test -f "$ac_path_EGREP" && $as_test_x "$ac_path_EGREP"; } || continue # Check for GNU ac_path_EGREP and select it if it is found. # Check for GNU $ac_path_EGREP case `"$ac_path_EGREP" --version 2>&1` in *GNU*) ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;; *) ac_count=0 $as_echo_n 0123456789 >"conftest.in" while : do cat "conftest.in" "conftest.in" >"conftest.tmp" mv "conftest.tmp" "conftest.in" cp "conftest.in" "conftest.nl" $as_echo 'EGREP' >> "conftest.nl" "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break ac_count=`expr $ac_count + 1` if test $ac_count -gt ${ac_path_EGREP_max-0}; then # Best one so far, save it but keep looking for a better one ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_max=$ac_count fi # 10*(2^10) chars as input seems more than enough test $ac_count -gt 10 && break done rm -f conftest.in conftest.tmp conftest.nl conftest.out;; esac $ac_path_EGREP_found && break 3 done done done IFS=$as_save_IFS if test -z "$ac_cv_path_EGREP"; then { { $as_echo "$as_me:$LINENO: error: no acceptable egrep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5 $as_echo "$as_me: error: no acceptable egrep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;} { (exit 1); exit 1; }; } fi else ac_cv_path_EGREP=$EGREP fi fi fi { $as_echo "$as_me:$LINENO: result: $ac_cv_path_EGREP" >&5 $as_echo "$ac_cv_path_EGREP" >&6; } EGREP="$ac_cv_path_EGREP" { $as_echo "$as_me:$LINENO: checking for ANSI C header files" >&5 $as_echo_n "checking for ANSI C header files... " >&6; } if test "${ac_cv_header_stdc+set}" = set; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_header_stdc=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_header_stdc=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext if test $ac_cv_header_stdc = yes; then # SunOS 4.x string.h does not declare mem*, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "memchr" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "free" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. if test "$cross_compiling" = yes; then : else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #if ((' ' & 0x0FF) == 0x020) # define ISLOWER(c) ('a' <= (c) && (c) <= 'z') # define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) #else # define ISLOWER(c) \ (('a' <= (c) && (c) <= 'i') \ || ('j' <= (c) && (c) <= 'r') \ || ('s' <= (c) && (c) <= 'z')) # define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) #endif #define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) int main () { int i; for (i = 0; i < 256; i++) if (XOR (islower (i), ISLOWER (i)) || toupper (i) != TOUPPER (i)) return 2; return 0; } _ACEOF rm -f conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else $as_echo "$as_me: program exited with status $ac_status" >&5 $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) ac_cv_header_stdc=no fi rm -rf conftest.dSYM rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi fi fi { $as_echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5 $as_echo "$ac_cv_header_stdc" >&6; } if test $ac_cv_header_stdc = yes; then cat >>confdefs.h <<\_ACEOF #define STDC_HEADERS 1 _ACEOF fi # On IRIX 5.3, sys/types and inttypes.h are conflicting. for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \ inttypes.h stdint.h unistd.h do as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` { $as_echo "$as_me:$LINENO: checking for $ac_header" >&5 $as_echo_n "checking for $ac_header... " >&6; } if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then eval "$as_ac_Header=yes" else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_Header=no" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi ac_res=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } as_val=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` if test "x$as_val" = x""yes; then cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done for ac_header in inttypes.h stddef.h stdlib.h string.h unistd.h do as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then { $as_echo "$as_me:$LINENO: checking for $ac_header" >&5 $as_echo_n "checking for $ac_header... " >&6; } if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 fi ac_res=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } else # Is the header compilable? { $as_echo "$as_me:$LINENO: checking $ac_header usability" >&5 $as_echo_n "checking $ac_header usability... " >&6; } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_header_compiler=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_compiler=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext { $as_echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 $as_echo "$ac_header_compiler" >&6; } # Is the header present? { $as_echo "$as_me:$LINENO: checking $ac_header presence" >&5 $as_echo_n "checking $ac_header presence... " >&6; } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include <$ac_header> _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then ac_header_preproc=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_preproc=no fi rm -f conftest.err conftest.$ac_ext { $as_echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 $as_echo "$ac_header_preproc" >&6; } # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in yes:no: ) { $as_echo "$as_me:$LINENO: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&5 $as_echo "$as_me: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the compiler's result" >&5 $as_echo "$as_me: WARNING: $ac_header: proceeding with the compiler's result" >&2;} ac_header_preproc=yes ;; no:yes:* ) { $as_echo "$as_me:$LINENO: WARNING: $ac_header: present but cannot be compiled" >&5 $as_echo "$as_me: WARNING: $ac_header: present but cannot be compiled" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: check for missing prerequisite headers?" >&5 $as_echo "$as_me: WARNING: $ac_header: check for missing prerequisite headers?" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: see the Autoconf documentation" >&5 $as_echo "$as_me: WARNING: $ac_header: see the Autoconf documentation" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&5 $as_echo "$as_me: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the preprocessor's result" >&5 $as_echo "$as_me: WARNING: $ac_header: proceeding with the preprocessor's result" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: in the future, the compiler will take precedence" >&5 $as_echo "$as_me: WARNING: $ac_header: in the future, the compiler will take precedence" >&2;} ( cat <<\_ASBOX ## ---------------------------------- ## ## Report this to jason@jasonwoof.com ## ## ---------------------------------- ## _ASBOX ) | sed "s/^/$as_me: WARNING: /" >&2 ;; esac { $as_echo "$as_me:$LINENO: checking for $ac_header" >&5 $as_echo_n "checking for $ac_header... " >&6; } if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 else eval "$as_ac_Header=\$ac_header_preproc" fi ac_res=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } fi as_val=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` if test "x$as_val" = x""yes; then cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done # Checks for typedefs, structures, and compiler characteristics. { $as_echo "$as_me:$LINENO: checking for stdbool.h that conforms to C99" >&5 $as_echo_n "checking for stdbool.h that conforms to C99... " >&6; } if test "${ac_cv_header_stdbool_h+set}" = set; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #ifndef bool "error: bool is not defined" #endif #ifndef false "error: false is not defined" #endif #if false "error: false is not 0" #endif #ifndef true "error: true is not defined" #endif #if true != 1 "error: true is not 1" #endif #ifndef __bool_true_false_are_defined "error: __bool_true_false_are_defined is not defined" #endif struct s { _Bool s: 1; _Bool t; } s; char a[true == 1 ? 1 : -1]; char b[false == 0 ? 1 : -1]; char c[__bool_true_false_are_defined == 1 ? 1 : -1]; char d[(bool) 0.5 == true ? 1 : -1]; bool e = &s; char f[(_Bool) 0.0 == false ? 1 : -1]; char g[true]; char h[sizeof (_Bool)]; char i[sizeof s.t]; enum { j = false, k = true, l = false * true, m = true * 256 }; /* The following fails for HP aC++/ANSI C B3910B A.05.55 [Dec 04 2003]. */ _Bool n[m]; char o[sizeof n == m * sizeof n[0] ? 1 : -1]; char p[-1 - (_Bool) 0 < 0 && -1 - (bool) 0 < 0 ? 1 : -1]; # if defined __xlc__ || defined __GNUC__ /* Catch a bug in IBM AIX xlc compiler version 6.0.0.0 reported by James Lemley on 2005-10-05; see http://lists.gnu.org/archive/html/bug-coreutils/2005-10/msg00086.html This test is not quite right, since xlc is allowed to reject this program, as the initializer for xlcbug is not one of the forms that C requires support for. However, doing the test right would require a runtime test, and that would make cross-compilation harder. Let us hope that IBM fixes the xlc bug, and also adds support for this kind of constant expression. In the meantime, this test will reject xlc, which is OK, since our stdbool.h substitute should suffice. We also test this with GCC, where it should work, to detect more quickly whether someone messes up the test in the future. */ char digs[] = "0123456789"; int xlcbug = 1 / (&(digs + 5)[-2 + (bool) 1] == &digs[4] ? 1 : -1); # endif /* Catch a bug in an HP-UX C compiler. See http://gcc.gnu.org/ml/gcc-patches/2003-12/msg02303.html http://lists.gnu.org/archive/html/bug-coreutils/2005-11/msg00161.html */ _Bool q = true; _Bool *pq = &q; int main () { *pq |= q; *pq |= ! q; /* Refer to every declared value, to avoid compiler optimizations. */ return (!a + !b + !c + !d + !e + !f + !g + !h + !i + !!j + !k + !!l + !m + !n + !o + !p + !q + !pq); ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_header_stdbool_h=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_header_stdbool_h=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi { $as_echo "$as_me:$LINENO: result: $ac_cv_header_stdbool_h" >&5 $as_echo "$ac_cv_header_stdbool_h" >&6; } { $as_echo "$as_me:$LINENO: checking for _Bool" >&5 $as_echo_n "checking for _Bool... " >&6; } if test "${ac_cv_type__Bool+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_type__Bool=no cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { if (sizeof (_Bool)) return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { if (sizeof ((_Bool))) return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_type__Bool=yes fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi { $as_echo "$as_me:$LINENO: result: $ac_cv_type__Bool" >&5 $as_echo "$ac_cv_type__Bool" >&6; } if test "x$ac_cv_type__Bool" = x""yes; then cat >>confdefs.h <<_ACEOF #define HAVE__BOOL 1 _ACEOF fi if test $ac_cv_header_stdbool_h = yes; then cat >>confdefs.h <<\_ACEOF #define HAVE_STDBOOL_H 1 _ACEOF fi { $as_echo "$as_me:$LINENO: checking for inline" >&5 $as_echo_n "checking for inline... " >&6; } if test "${ac_cv_c_inline+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_c_inline=no for ac_kw in inline __inline__ __inline; do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifndef __cplusplus typedef int foo_t; static $ac_kw foo_t static_foo () {return 0; } $ac_kw foo_t foo () {return 0; } #endif _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_cv_c_inline=$ac_kw else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext test "$ac_cv_c_inline" != no && break done fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_inline" >&5 $as_echo "$ac_cv_c_inline" >&6; } case $ac_cv_c_inline in inline | yes) ;; *) case $ac_cv_c_inline in no) ac_val=;; *) ac_val=$ac_cv_c_inline;; esac cat >>confdefs.h <<_ACEOF #ifndef __cplusplus #define inline $ac_val #endif _ACEOF ;; esac { $as_echo "$as_me:$LINENO: checking for int8_t" >&5 $as_echo_n "checking for int8_t... " >&6; } if test "${ac_cv_c_int8_t+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_c_int8_t=no for ac_type in 'int8_t' 'int' 'long int' \ 'long long int' 'short int' 'signed char'; do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { static int test_array [1 - 2 * !(0 < ($ac_type) (((($ac_type) 1 << (8 - 2)) - 1) * 2 + 1))]; test_array [0] = 0 ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { static int test_array [1 - 2 * !(($ac_type) (((($ac_type) 1 << (8 - 2)) - 1) * 2 + 1) < ($ac_type) (((($ac_type) 1 << (8 - 2)) - 1) * 2 + 2))]; test_array [0] = 0 ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 case $ac_type in int8_t) ac_cv_c_int8_t=yes ;; *) ac_cv_c_int8_t=$ac_type ;; esac fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext test "$ac_cv_c_int8_t" != no && break done fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_int8_t" >&5 $as_echo "$ac_cv_c_int8_t" >&6; } case $ac_cv_c_int8_t in #( no|yes) ;; #( *) cat >>confdefs.h <<_ACEOF #define int8_t $ac_cv_c_int8_t _ACEOF ;; esac { $as_echo "$as_me:$LINENO: checking for size_t" >&5 $as_echo_n "checking for size_t... " >&6; } if test "${ac_cv_type_size_t+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_type_size_t=no cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { if (sizeof (size_t)) return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { if (sizeof ((size_t))) return 0; ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_type_size_t=yes fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi { $as_echo "$as_me:$LINENO: result: $ac_cv_type_size_t" >&5 $as_echo "$ac_cv_type_size_t" >&6; } if test "x$ac_cv_type_size_t" = x""yes; then : else cat >>confdefs.h <<_ACEOF #define size_t unsigned int _ACEOF fi { $as_echo "$as_me:$LINENO: checking for uint16_t" >&5 $as_echo_n "checking for uint16_t... " >&6; } if test "${ac_cv_c_uint16_t+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_c_uint16_t=no for ac_type in 'uint16_t' 'unsigned int' 'unsigned long int' \ 'unsigned long long int' 'unsigned short int' 'unsigned char'; do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { static int test_array [1 - 2 * !(($ac_type) -1 >> (16 - 1) == 1)]; test_array [0] = 0 ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then case $ac_type in uint16_t) ac_cv_c_uint16_t=yes ;; *) ac_cv_c_uint16_t=$ac_type ;; esac else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext test "$ac_cv_c_uint16_t" != no && break done fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_uint16_t" >&5 $as_echo "$ac_cv_c_uint16_t" >&6; } case $ac_cv_c_uint16_t in #( no|yes) ;; #( *) cat >>confdefs.h <<_ACEOF #define uint16_t $ac_cv_c_uint16_t _ACEOF ;; esac { $as_echo "$as_me:$LINENO: checking for uint32_t" >&5 $as_echo_n "checking for uint32_t... " >&6; } if test "${ac_cv_c_uint32_t+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_c_uint32_t=no for ac_type in 'uint32_t' 'unsigned int' 'unsigned long int' \ 'unsigned long long int' 'unsigned short int' 'unsigned char'; do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { static int test_array [1 - 2 * !(($ac_type) -1 >> (32 - 1) == 1)]; test_array [0] = 0 ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then case $ac_type in uint32_t) ac_cv_c_uint32_t=yes ;; *) ac_cv_c_uint32_t=$ac_type ;; esac else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext test "$ac_cv_c_uint32_t" != no && break done fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_uint32_t" >&5 $as_echo "$ac_cv_c_uint32_t" >&6; } case $ac_cv_c_uint32_t in #( no|yes) ;; #( *) cat >>confdefs.h <<\_ACEOF #define _UINT32_T 1 _ACEOF cat >>confdefs.h <<_ACEOF #define uint32_t $ac_cv_c_uint32_t _ACEOF ;; esac { $as_echo "$as_me:$LINENO: checking for uint8_t" >&5 $as_echo_n "checking for uint8_t... " >&6; } if test "${ac_cv_c_uint8_t+set}" = set; then $as_echo_n "(cached) " >&6 else ac_cv_c_uint8_t=no for ac_type in 'uint8_t' 'unsigned int' 'unsigned long int' \ 'unsigned long long int' 'unsigned short int' 'unsigned char'; do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default int main () { static int test_array [1 - 2 * !(($ac_type) -1 >> (8 - 1) == 1)]; test_array [0] = 0 ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then case $ac_type in uint8_t) ac_cv_c_uint8_t=yes ;; *) ac_cv_c_uint8_t=$ac_type ;; esac else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext test "$ac_cv_c_uint8_t" != no && break done fi { $as_echo "$as_me:$LINENO: result: $ac_cv_c_uint8_t" >&5 $as_echo "$ac_cv_c_uint8_t" >&6; } case $ac_cv_c_uint8_t in #( no|yes) ;; #( *) cat >>confdefs.h <<\_ACEOF #define _UINT8_T 1 _ACEOF cat >>confdefs.h <<_ACEOF #define uint8_t $ac_cv_c_uint8_t _ACEOF ;; esac # Checks for library functions. for ac_header in stdlib.h do as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then { $as_echo "$as_me:$LINENO: checking for $ac_header" >&5 $as_echo_n "checking for $ac_header... " >&6; } if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 fi ac_res=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } else # Is the header compilable? { $as_echo "$as_me:$LINENO: checking $ac_header usability" >&5 $as_echo_n "checking $ac_header usability... " >&6; } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_compile") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then ac_header_compiler=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_compiler=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext { $as_echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 $as_echo "$ac_header_compiler" >&6; } # Is the header present? { $as_echo "$as_me:$LINENO: checking $ac_header presence" >&5 $as_echo_n "checking $ac_header presence... " >&6; } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include <$ac_header> _ACEOF if { (ac_try="$ac_cpp conftest.$ac_ext" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then ac_header_preproc=yes else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_preproc=no fi rm -f conftest.err conftest.$ac_ext { $as_echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 $as_echo "$ac_header_preproc" >&6; } # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in yes:no: ) { $as_echo "$as_me:$LINENO: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&5 $as_echo "$as_me: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the compiler's result" >&5 $as_echo "$as_me: WARNING: $ac_header: proceeding with the compiler's result" >&2;} ac_header_preproc=yes ;; no:yes:* ) { $as_echo "$as_me:$LINENO: WARNING: $ac_header: present but cannot be compiled" >&5 $as_echo "$as_me: WARNING: $ac_header: present but cannot be compiled" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: check for missing prerequisite headers?" >&5 $as_echo "$as_me: WARNING: $ac_header: check for missing prerequisite headers?" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: see the Autoconf documentation" >&5 $as_echo "$as_me: WARNING: $ac_header: see the Autoconf documentation" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&5 $as_echo "$as_me: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the preprocessor's result" >&5 $as_echo "$as_me: WARNING: $ac_header: proceeding with the preprocessor's result" >&2;} { $as_echo "$as_me:$LINENO: WARNING: $ac_header: in the future, the compiler will take precedence" >&5 $as_echo "$as_me: WARNING: $ac_header: in the future, the compiler will take precedence" >&2;} ( cat <<\_ASBOX ## ---------------------------------- ## ## Report this to jason@jasonwoof.com ## ## ---------------------------------- ## _ASBOX ) | sed "s/^/$as_me: WARNING: /" >&2 ;; esac { $as_echo "$as_me:$LINENO: checking for $ac_header" >&5 $as_echo_n "checking for $ac_header... " >&6; } if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 else eval "$as_ac_Header=\$ac_header_preproc" fi ac_res=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } fi as_val=`eval 'as_val=${'$as_ac_Header'} $as_echo "$as_val"'` if test "x$as_val" = x""yes; then cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done { $as_echo "$as_me:$LINENO: checking for GNU libc compatible malloc" >&5 $as_echo_n "checking for GNU libc compatible malloc... " >&6; } if test "${ac_cv_func_malloc_0_nonnull+set}" = set; then $as_echo_n "(cached) " >&6 else if test "$cross_compiling" = yes; then ac_cv_func_malloc_0_nonnull=no else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #if defined STDC_HEADERS || defined HAVE_STDLIB_H # include #else char *malloc (); #endif int main () { return ! malloc (0); ; return 0; } _ACEOF rm -f conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_malloc_0_nonnull=yes else $as_echo "$as_me: program exited with status $ac_status" >&5 $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) ac_cv_func_malloc_0_nonnull=no fi rm -rf conftest.dSYM rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi fi { $as_echo "$as_me:$LINENO: result: $ac_cv_func_malloc_0_nonnull" >&5 $as_echo "$ac_cv_func_malloc_0_nonnull" >&6; } if test $ac_cv_func_malloc_0_nonnull = yes; then cat >>confdefs.h <<\_ACEOF #define HAVE_MALLOC 1 _ACEOF else cat >>confdefs.h <<\_ACEOF #define HAVE_MALLOC 0 _ACEOF case " $LIBOBJS " in *" malloc.$ac_objext "* ) ;; *) LIBOBJS="$LIBOBJS malloc.$ac_objext" ;; esac cat >>confdefs.h <<\_ACEOF #define malloc rpl_malloc _ACEOF fi for ac_func in atexit memset sqrt strdup do as_ac_var=`$as_echo "ac_cv_func_$ac_func" | $as_tr_sh` { $as_echo "$as_me:$LINENO: checking for $ac_func" >&5 $as_echo_n "checking for $ac_func... " >&6; } if { as_var=$as_ac_var; eval "test \"\${$as_var+set}\" = set"; }; then $as_echo_n "(cached) " >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define $ac_func to an innocuous variant, in case declares $ac_func. For example, HP-UX 11i declares gettimeofday. */ #define $ac_func innocuous_$ac_func /* System header to define __stub macros and hopefully few prototypes, which can conflict with char $ac_func (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef $ac_func /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char $ac_func (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined __stub_$ac_func || defined __stub___$ac_func choke me #endif int main () { return $ac_func (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:$LINENO: $ac_try_echo\"" $as_echo "$ac_try_echo") >&5 (eval "$ac_link") 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 $as_echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || $as_test_x conftest$ac_exeext }; then eval "$as_ac_var=yes" else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_var=no" fi rm -rf conftest.dSYM rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ conftest$ac_exeext conftest.$ac_ext fi ac_res=`eval 'as_val=${'$as_ac_var'} $as_echo "$as_val"'` { $as_echo "$as_me:$LINENO: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } as_val=`eval 'as_val=${'$as_ac_var'} $as_echo "$as_val"'` if test "x$as_val" = x""yes; then cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_func" | $as_tr_cpp` 1 _ACEOF fi done ac_config_files="$ac_config_files Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, we kill variables containing newlines. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. ( for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:$LINENO: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) $as_unset $ac_var ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space=' '; set) 2>&1` in #( *${as_nl}ac_space=\ *) # `set' does not quote correctly, so add quotes (double-quote # substitution turns \\\\ into \\, and sed turns \\ into \). sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; #( *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) | sed ' /^ac_cv_env_/b end t clear :clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then test "x$cache_file" != "x/dev/null" && { $as_echo "$as_me:$LINENO: updating cache $cache_file" >&5 $as_echo "$as_me: updating cache $cache_file" >&6;} cat confcache >$cache_file else { $as_echo "$as_me:$LINENO: not updating unwritable cache $cache_file" >&5 $as_echo "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' DEFS=-DHAVE_CONFIG_H ac_libobjs= ac_ltlibobjs= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' ac_i=`$as_echo "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. ac_libobjs="$ac_libobjs \${LIBOBJDIR}$ac_i\$U.$ac_objext" ac_ltlibobjs="$ac_ltlibobjs \${LIBOBJDIR}$ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs : ${CONFIG_STATUS=./config.status} ac_write_fail=0 ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { $as_echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5 $as_echo "$as_me: creating $CONFIG_STATUS" >&6;} cat >$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in *posix*) set -o posix ;; esac fi # PATH needs CR # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo if (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 { (exit 1); exit 1; } fi # Work around bugs in pre-3.0 UWIN ksh. for as_var in ENV MAIL MAILPATH do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # CDPATH. $as_unset CDPATH as_lineno_1=$LINENO as_lineno_2=$LINENO test "x$as_lineno_1" != "x$as_lineno_2" && test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line after each line using $LINENO; the second 'sed' # does the real work. The second script uses 'N' to pair each # line-number line with the line containing $LINENO, and appends # trailing '-' during substitution so that $LINENO is not a special # case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # scripts with optimization help from Paolo Bonzini. Blame Lee # E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in -n*) case `echo 'x\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. *) ECHO_C='\c';; esac;; *) ECHO_N='-n';; esac if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 # Save the log message, to keep $[0] and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by VoR $as_me 0.5.5, which was generated by GNU Autoconf 2.63. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " _ACEOF case $ac_config_files in *" "*) set x $ac_config_files; shift; ac_config_files=$*;; esac case $ac_config_headers in *" "*) set x $ac_config_headers; shift; ac_config_headers=$*;; esac cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 # Files that config.status was made for. config_files="$ac_config_files" config_headers="$ac_config_headers" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 ac_cs_usage="\ \`$as_me' instantiates files from templates according to the current configuration. Usage: $0 [OPTION]... [FILE]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit -q, --quiet, --silent do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE --header=FILE[:TEMPLATE] instantiate the configuration header FILE Configuration files: $config_files Configuration headers: $config_headers Report bugs to ." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_cs_version="\\ VoR config.status 0.5.5 configured by $0, generated by GNU Autoconf 2.63, with options \\"`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`\\" Copyright (C) 2008 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='$ac_pwd' srcdir='$srcdir' INSTALL='$INSTALL' test -n "\$AWK" || AWK=awk _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # The default lists apply if the user does not specify any file. ac_need_defaults=: while test $# != 0 do case $1 in --*=*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) $as_echo "$ac_cs_version"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; esac CONFIG_FILES="$CONFIG_FILES '$ac_optarg'" ac_need_defaults=false;; --header | --heade | --head | --hea ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; esac CONFIG_HEADERS="$CONFIG_HEADERS '$ac_optarg'" ac_need_defaults=false;; --he | --h) # Conflict between --help and --header { $as_echo "$as_me: error: ambiguous option: $1 Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; };; --help | --hel | -h ) $as_echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) { $as_echo "$as_me: error: unrecognized option: $1 Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; } ;; *) ac_config_targets="$ac_config_targets $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 if \$ac_cs_recheck; then set X '$SHELL' '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion shift \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6 CONFIG_SHELL='$SHELL' export CONFIG_SHELL exec "\$@" fi _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX $as_echo "$ac_log" } >&5 _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "config.h") CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;; "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; *) { { $as_echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5 $as_echo "$as_me: error: invalid argument: $ac_config_target" >&2;} { (exit 1); exit 1; }; };; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= trap 'exit_status=$? { test -z "$tmp" || test ! -d "$tmp" || rm -fr "$tmp"; } && exit $exit_status ' 0 trap '{ (exit 1); exit 1; }' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || { $as_echo "$as_me: cannot create a temporary directory in ." >&2 { (exit 1); exit 1; } } # Set up the scripts for CONFIG_FILES section. # No need to generate them if there are no CONFIG_FILES. # This happens for instance with `./config.status config.h'. if test -n "$CONFIG_FILES"; then ac_cr=' ' ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' /dev/null` if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then ac_cs_awk_cr='\\r' else ac_cs_awk_cr=$ac_cr fi echo 'BEGIN {' >"$tmp/subs1.awk" && _ACEOF { echo "cat >conf$$subs.awk <<_ACEOF" && echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' && echo "_ACEOF" } >conf$$subs.sh || { { $as_echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5 $as_echo "$as_me: error: could not make $CONFIG_STATUS" >&2;} { (exit 1); exit 1; }; } ac_delim_num=`echo "$ac_subst_vars" | grep -c '$'` ac_delim='%!_!# ' for ac_last_try in false false false false false :; do . ./conf$$subs.sh || { { $as_echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5 $as_echo "$as_me: error: could not make $CONFIG_STATUS" >&2;} { (exit 1); exit 1; }; } ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X` if test $ac_delim_n = $ac_delim_num; then break elif $ac_last_try; then { { $as_echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5 $as_echo "$as_me: error: could not make $CONFIG_STATUS" >&2;} { (exit 1); exit 1; }; } else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done rm -f conf$$subs.sh cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 cat >>"\$tmp/subs1.awk" <<\\_ACAWK && _ACEOF sed -n ' h s/^/S["/; s/!.*/"]=/ p g s/^[^!]*!// :repl t repl s/'"$ac_delim"'$// t delim :nl h s/\(.\{148\}\).*/\1/ t more1 s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/ p n b repl :more1 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t nl :delim h s/\(.\{148\}\).*/\1/ t more2 s/["\\]/\\&/g; s/^/"/; s/$/"/ p b :more2 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t delim ' >$CONFIG_STATUS || ac_write_fail=1 rm -f conf$$subs.awk cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACAWK cat >>"\$tmp/subs1.awk" <<_ACAWK && for (key in S) S_is_set[key] = 1 FS = "" } { line = $ 0 nfields = split(line, field, "@") substed = 0 len = length(field[1]) for (i = 2; i < nfields; i++) { key = field[i] keylen = length(key) if (S_is_set[key]) { value = S[key] line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3) len += length(value) + length(field[++i]) substed = 1 } else len += 1 + keylen } print line } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g" else cat fi < "$tmp/subs1.awk" > "$tmp/subs.awk" \ || { { $as_echo "$as_me:$LINENO: error: could not setup config files machinery" >&5 $as_echo "$as_me: error: could not setup config files machinery" >&2;} { (exit 1); exit 1; }; } _ACEOF # VPATH may cause trouble with some makes, so we remove $(srcdir), # ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=/{ s/:*\$(srcdir):*/:/ s/:*\${srcdir}:*/:/ s/:*@srcdir@:*/:/ s/^\([^=]*=[ ]*\):*/\1/ s/:*$// s/^[^=]*=[ ]*$// }' fi cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 fi # test -n "$CONFIG_FILES" # Set up the scripts for CONFIG_HEADERS section. # No need to generate them if there are no CONFIG_HEADERS. # This happens for instance with `./config.status Makefile'. if test -n "$CONFIG_HEADERS"; then cat >"$tmp/defines.awk" <<\_ACAWK || BEGIN { _ACEOF # Transform confdefs.h into an awk script `defines.awk', embedded as # here-document in config.status, that substitutes the proper values into # config.h.in to produce config.h. # Create a delimiter string that does not exist in confdefs.h, to ease # handling of long lines. ac_delim='%!_!# ' for ac_last_try in false false :; do ac_t=`sed -n "/$ac_delim/p" confdefs.h` if test -z "$ac_t"; then break elif $ac_last_try; then { { $as_echo "$as_me:$LINENO: error: could not make $CONFIG_HEADERS" >&5 $as_echo "$as_me: error: could not make $CONFIG_HEADERS" >&2;} { (exit 1); exit 1; }; } else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done # For the awk script, D is an array of macro values keyed by name, # likewise P contains macro parameters if any. Preserve backslash # newline sequences. ac_word_re=[_$as_cr_Letters][_$as_cr_alnum]* sed -n ' s/.\{148\}/&'"$ac_delim"'/g t rset :rset s/^[ ]*#[ ]*define[ ][ ]*/ / t def d :def s/\\$// t bsnl s/["\\]/\\&/g s/^ \('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/P["\1"]="\2"\ D["\1"]=" \3"/p s/^ \('"$ac_word_re"'\)[ ]*\(.*\)/D["\1"]=" \2"/p d :bsnl s/["\\]/\\&/g s/^ \('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/P["\1"]="\2"\ D["\1"]=" \3\\\\\\n"\\/p t cont s/^ \('"$ac_word_re"'\)[ ]*\(.*\)/D["\1"]=" \2\\\\\\n"\\/p t cont d :cont n s/.\{148\}/&'"$ac_delim"'/g t clear :clear s/\\$// t bsnlc s/["\\]/\\&/g; s/^/"/; s/$/"/p d :bsnlc s/["\\]/\\&/g; s/^/"/; s/$/\\\\\\n"\\/p b cont ' >$CONFIG_STATUS || ac_write_fail=1 cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 for (key in D) D_is_set[key] = 1 FS = "" } /^[\t ]*#[\t ]*(define|undef)[\t ]+$ac_word_re([\t (]|\$)/ { line = \$ 0 split(line, arg, " ") if (arg[1] == "#") { defundef = arg[2] mac1 = arg[3] } else { defundef = substr(arg[1], 2) mac1 = arg[2] } split(mac1, mac2, "(") #) macro = mac2[1] prefix = substr(line, 1, index(line, defundef) - 1) if (D_is_set[macro]) { # Preserve the white space surrounding the "#". print prefix "define", macro P[macro] D[macro] next } else { # Replace #undef with comments. This is necessary, for example, # in the case of _POSIX_SOURCE, which is predefined and required # on some systems where configure will not decide to define it. if (defundef == "undef") { print "/*", prefix defundef, macro, "*/" next } } } { print } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 { { $as_echo "$as_me:$LINENO: error: could not setup config headers machinery" >&5 $as_echo "$as_me: error: could not setup config headers machinery" >&2;} { (exit 1); exit 1; }; } fi # test -n "$CONFIG_HEADERS" eval set X " :F $CONFIG_FILES :H $CONFIG_HEADERS " shift for ac_tag do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) { { $as_echo "$as_me:$LINENO: error: invalid tag $ac_tag" >&5 $as_echo "$as_me: error: invalid tag $ac_tag" >&2;} { (exit 1); exit 1; }; };; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || { { $as_echo "$as_me:$LINENO: error: cannot find input file: $ac_f" >&5 $as_echo "$as_me: error: cannot find input file: $ac_f" >&2;} { (exit 1); exit 1; }; };; esac case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac ac_file_inputs="$ac_file_inputs '$ac_f'" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { $as_echo "$as_me:$LINENO: creating $ac_file" >&5 $as_echo "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) ac_sed_conf_input=`$as_echo "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac case $ac_tag in *:-:* | *:-) cat >"$tmp/stdin" \ || { { $as_echo "$as_me:$LINENO: error: could not create $ac_file" >&5 $as_echo "$as_me: error: could not create $ac_file" >&2;} { (exit 1); exit 1; }; } ;; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` { as_dir="$ac_dir" case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || { $as_mkdir_p && mkdir -p "$as_dir"; } || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || { { $as_echo "$as_me:$LINENO: error: cannot create directory $as_dir" >&5 $as_echo "$as_me: error: cannot create directory $as_dir" >&2;} { (exit 1); exit 1; }; }; } ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= ac_sed_dataroot=' /datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p ' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { $as_echo "$as_me:$LINENO: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 $as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_datarootdir_hack=' s&@datadir@&$datadir&g s&@docdir@&$docdir&g s&@infodir@&$infodir&g s&@localedir@&$localedir&g s&@mandir@&$mandir&g s&\\\${datarootdir}&$datarootdir&g' ;; esac _ACEOF # Neutralize VPATH when `$srcdir' = `.'. # Shell code in configure.ac might set extrasub. # FIXME: do we really want to maintain this feature? cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_sed_extra="$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s|@configure_input@|$ac_sed_conf_input|;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@top_build_prefix@&$ac_top_build_prefix&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t $ac_datarootdir_hack " eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$tmp/subs.awk" >$tmp/out \ || { { $as_echo "$as_me:$LINENO: error: could not create $ac_file" >&5 $as_echo "$as_me: error: could not create $ac_file" >&2;} { (exit 1); exit 1; }; } test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' "$tmp/out"`; test -z "$ac_out"; } && { $as_echo "$as_me:$LINENO: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined." >&5 $as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined." >&2;} rm -f "$tmp/stdin" case $ac_file in -) cat "$tmp/out" && rm -f "$tmp/out";; *) rm -f "$ac_file" && mv "$tmp/out" "$ac_file";; esac \ || { { $as_echo "$as_me:$LINENO: error: could not create $ac_file" >&5 $as_echo "$as_me: error: could not create $ac_file" >&2;} { (exit 1); exit 1; }; } ;; :H) # # CONFIG_HEADER # if test x"$ac_file" != x-; then { $as_echo "/* $configure_input */" \ && eval '$AWK -f "$tmp/defines.awk"' "$ac_file_inputs" } >"$tmp/config.h" \ || { { $as_echo "$as_me:$LINENO: error: could not create $ac_file" >&5 $as_echo "$as_me: error: could not create $ac_file" >&2;} { (exit 1); exit 1; }; } if diff "$ac_file" "$tmp/config.h" >/dev/null 2>&1; then { $as_echo "$as_me:$LINENO: $ac_file is unchanged" >&5 $as_echo "$as_me: $ac_file is unchanged" >&6;} else rm -f "$ac_file" mv "$tmp/config.h" "$ac_file" \ || { { $as_echo "$as_me:$LINENO: error: could not create $ac_file" >&5 $as_echo "$as_me: error: could not create $ac_file" >&2;} { (exit 1); exit 1; }; } fi else $as_echo "/* $configure_input */" \ && eval '$AWK -f "$tmp/defines.awk"' "$ac_file_inputs" \ || { { $as_echo "$as_me:$LINENO: error: could not create -" >&5 $as_echo "$as_me: error: could not create -" >&2;} { (exit 1); exit 1; }; } fi ;; esac done # for ac_tag { (exit 0); exit 0; } _ACEOF chmod +x $CONFIG_STATUS ac_clean_files=$ac_clean_files_save test $ac_write_fail = 0 || { { $as_echo "$as_me:$LINENO: error: write failure creating $CONFIG_STATUS" >&5 $as_echo "$as_me: error: write failure creating $CONFIG_STATUS" >&2;} { (exit 1); exit 1; }; } # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || { (exit 1); exit 1; } fi if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then { $as_echo "$as_me:$LINENO: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} fi vor-0.5.5/data/0000755000175100017510000000000011310013352014023 5ustar jasonwoofjasonwoofvor-0.5.5/data/rock22.png0000644000175100017510000000300711310013347015637 0ustar jasonwoofjasonwoofPNG  IHDR ggAMA7PLTE+$lYI}fkYH*"UF9 yc{fTqOB6zfSwb9/'dSDwa 8/&N@5ydRoM@4xdQ7-%bQBu_ 6-$wbPq]kF:0j[K>o[/' oZi.'D8.o\KhmY-%XI;t~iV'!hVGzd<2)}gUr&QC7|gTq%;0(fTExb:0'eTDpOA5zeRt_uaPmI=2taO3*#^N@r]2*"s_NkG;0r_Mp\1(!\L>0( @5,kYI}f?5+jWt)"jV{e>3*iWG r' RD7xdRo!u` 6-%aQBn  K>3vbPmJ>2s^ _O@lo\LiC8.-%XI4*iVs(!SE8=2)zc }gTvabRCL?4wcQnK?3aPBt_5,$`PAt^mJ=2uaOlI=1_N@r]H;0nZ-&n[KhB7-lYWH;lXE8tRNS@fIDAT(c`@S^nw ^z~E:ݼkQRg4ٿ%ݹJm$N~WT}!IܥV;qXu&p&%GYt+fJ[?OYi(͖j'"+v엜lRrz/oJ+TAR\&XvSDe@, m>W|}{cP73Y3-~buCC CɇT-I;ëuӚ I\N~#-=ø!#E}>9;ɹ7Gf{MIgpl|*y36$*i\i *|n1?*w5)pIE_ngysoi&C>?WoXs/ sZn^d9i9y0X7?Ȓӯ,+^io'=4b]urg>q.x}brsgͰ9@1%\g뾡zJi"ɲ) -WaKNqk; N"L#oSN},yJhBApI+\:#tQz>TKOu@;J4Klra3iwf{9Ṃ::HL*Vꥌt&Okvtl^|+EBIENDB`vor-0.5.5/data/rock05.png0000644000175100017510000000211011310013345015630 0ustar jasonwoofjasonwoofPNG  IHDRUgAMA7LPLTE+$VH:lYI}fkYH {fT$wb9/'dSDwap N@5ydRo"M@4! 7-%bQBu_wbPjo[/' ZK=oZD8.o\KhC8-YIp[E9.VH;kYI}fjW>3*iWG{d ~hUr' RD7<1(gUExdRou`u_n K>3vbPmJ>2`OAs^ 4+#_O@I<1t`NimYWI;mZJ~gA6,+#*#kXH?4*90'zeSpva"8.& xcQn!L?3p\[L>p]LD9.ZJ=nZ.&hC7-{e=3*RD8}hUr& gUFyc fUE PB6{fSpeSDwa9/&s^3+#t`OlH<1q]2)"q\1)!jF:/~gkX*#|f?4+jXH|esSE8~iU=2)zc &vaoL?4wcQaPBt_5,$`PAuaOr]^N?nZn[KhlYWH;lXZODtRNS@fIDATc`Ӆ% (`L bp„̸)xn5/ٙ Z=)xrr@1q>lezVKy56P)`R=_VBۭ:붬X̰"T^JHOh vAxڜ[,P=d!cU=/MrsMl532l-WQ\bVuT;Z{2`iaٕUd|%= 23gL6?`CPɵMVʉrUTbkvb# tbTUj6K[gt8/9NUu8]8Ϗ. GŮD֪A Vv'qr 2k`IENDB`vor-0.5.5/data/rock02.png0000644000175100017510000000412211310013345015632 0ustar jasonwoofjasonwoofPNG  IHDR%#TIgAMA7tRNSnIDATHׇ[gp7$ E"`GDPz"~&Ma/11dͦ욲>%gg}s|,[#9>zέVG$n^*͋P\[9:1^1^yeљΪܬ)7֯Yus[N>>{]/ 6z7|߃n}EGv$&F;؆~w꧇3]룿<w&|k\FZZ+vMM`)1`Gs.}yu_WF;Z̆^x|޺ѓ7[OwUWDyqۅ/<9'on=1Z5+7'. 5+nT4]y ћVkNޞg$7ܻӝTl^8^;XBS*on.[rśV?=7/sv,Wjݛ22]CWG[<`.4QS[0SWX~tעGol_@u6tKfO8kOQ֞ȷssJ<Ҍ$VG,/P+/ 7^WQT_]QN{(=(pm*VlOdgWޙ Wi\K8%4?9׋X_Q|r ռų=WQoljCmf C_IA8~)]ſ iϳKCAfaݡb5g?v fљnz~m~viaMeȏjhE㟚e 稑jXX*"uTqps) <|@$,}v?\lHP/)rXq^HVpEXaE^|ԧ6bD\X05Lwj Z+D`uxdF4Ɗ; AjJ- jBd+ ã|ɰE)%( Mڡb3}OJ±!xΰh *-B8NI){I5ZRX(Wba|H5"bI 1؟A7ȩ8~5Axͳ= >U1mh׈O*H}\[W.rBIo닳rލX^ ob_9G4&JMٴ₣n0)-$G6JߞSn)o-֬ -xPVDpF5Lg>ErƘvmHK\NẍW̔ŧr&DQeݵh.*܌] J;>űיRO|xw8OBē7#㠣2i`Nָ:6&8;XG]tp(ZjzZa8?9Sw I7;@Nϓ@[tia.Ѓ5V)JĠ JpǤ%) a&DB\mՊbׯ]9X) Dw_y / PUZPĻPq1!y^.dw;rafY2l4ef>LL T!b\ЊQ@MeX8Qڒ"q^f: XHi# EfL F2kpɗĉzxkq YtuTǔF멈PGQ!>GڥI<_ m zU..$hJiHzDzUr)@HOy_R:=.` `|E!ei9)eU$biؑBU:gVU 9Zx儊R].} 6IENDB`vor-0.5.5/data/rock33.png0000644000175100017510000000410311310013351015632 0ustar jasonwoofjasonwoofPNG  IHDR#$gAMA7tRNSnIDATH׉WUp8", 2ygP'85fh6C M=5B&].{={}9}[lFvVԞ=}"1.rRSx .<*㭕- 2\Ԧ>UlSTD%}/^U)B?^CUd #s ݽu'/+ꡦEEԇ 1/n Q^w71;݁ruM;3RAU,o$wZ\ݩPN>ܤ, u04Ce4 ٱ["x\$ƽD*=9쳭Yl@ _vV%J)lp3v{ 92j`K; JJbAU{B}OmaJhuuAlŒd{$(Uta%z*wR^:0ӏ%][$zx^4ѡr嫺, be싥A.C6~; I{ΗH)@ @t:Э w\ʄ-ycV_O3!7 e 4`*wYsJǢ)&8r,"?:܅&TZb1|6 xv۽cüE ʞ8!(iG\x.=Ks$%ŧ'ŧ8R]!BCI፵TMݻk#"ہJH(w": iQW$+#DKSKq݌D@y.<FR6U64x ktSmRY'0 p\Zyrܲ~PI9$z5,V%i;7^i d3Kߨhi6 y_Pj< \|%D_}Z#  :ɷVt70O!bsٌ>%GG6"$ڼ\@+!A 5:pu1OZB=Uܿ77 LWRӳi,G Nf-jdăe̔MɽzҀZtq6JZOq _ BkZm=pD ǕϗG̫ҳ[+-`LaIT}q6SFg33DI;qu %TG/')*ɢ__R3H5E%:Y'Xڊ9KС΄(Ӏ03l=҅0#Gca'YRİ(&Ы`S9P~R͝B"1Ӷ8֌nL4`mn:BMR~Qex #+k'SfAgQ+VXt]"Ys& s?漿긷2~hdch7g<Ʀ~:35a?O{,WFܞy{}5Mf$r_s͊0:׻#77ޘ鿽h{5ro<9@ &mX[g35e1߄ܛ|Z ߷gӿ/Z*G'tH+vutvȨ)dj K/vOr'^wY]aڲ|qb,!VQeGף hppIO7nN0 Y2:m aϻ"N!ɲ>Ceo?^DX8|wy08 T&L<=춴*gRIJ.u6v6T~VTxT߃U󭙻KcԎhmDBxv #k8`_fOOL=R,?$@MiY{w}8oEX㦀s.!66avf#;OHridxف ?2.x8Ya[?^;;́v2@HGN7r EP6z>IRI2wx| ' Q0@gO#ã87C%KWU"Hxwk1 т, daf̤u[ }0KL3זu7*4<$Gwf]1r@7fGUh!Y(;ܹ:FxPiU)f3m c*YvBL@"XIFoktwAXA0}-r|ZS.NOGG 96k10zpKBqO6&a:fͭ@օ L¬JYVblŐ`(ZqM010@B*G펆JrLOSLNz(G]o p!? :" zHDvpE6 )cX8K"mηºD4:MT)' 9gFrO= "AlUљT`?/x#@`@Oc"þY!7dC7sIENDB`vor-0.5.5/data/rock03.png0000644000175100017510000000237511310013345015643 0ustar jasonwoofjasonwoofPNG  IHDREgAMA7PLTE+$}f@5+tUF9jV yc{fTq$OB6wb9/'wa 8/&cSCydRoM@4xdQu`bQB K>2q^Mjo[io\KC8-YIp[0( i@5,kYI}f?5+jWt)"TF9jV>3*iWG~hU' gUE xdRobQCu`aQBn K>3vbP`OAs^4+#_O@lC8.n\K-%XIjp]LiZJ=nZ.&YJ<C7-=3*sRD8}hUrQD7yc ;1(|fTq%PB6{fSwas^3+#t`OlH<1s`N2)"]M?q\G:0r^MjF:/q^LkX|f?4+jXH|eTE9iVs(!SE8~iUhVF&on t_`PAm J=2lr]3*"nZ-&hm[JlY,$WH;lXq"tRNS@fIDAT(c`$<9} `S.o.:pQ{N->4Qz$Tx\423l[,7l  ZbVeWb@]|mM՜2(lX_{fNYٵabNɦ^ E8=}̎Ig9͸޳b@f>>{9VtKlݝyHKfkꚂ|0K4ӎ.h5է}\gZDf=B)qmbx.nlῄ#R7xƬxr룷-?%j30_=nR|87 z3^θ@݋NjS8̐v-kNO;Ь ;rWn.ԏ0e>nBAнY6^zBB!8Ԭ*D@`.39]%* @ j)ʨ=g1~XTA"~*BiX gd9s DGIENDB`vor-0.5.5/data/rock40.png0000644000175100017510000000372611310013351015642 0ustar jasonwoofjasonwoofPNG  IHDR!$KċgAMA7tRNSn{IDATHWi]w-A@HI%H !BBBHHHQmײkr ]u|'gg}7;ȚΆYfsgW#Z*2IF|\̏Q'O~[{0kuM>K;`{}Z;-ҼW"N?z]IޢK7e]z;_<_qOV=ƭ1hdwkeo DGsv3aGD!Q⠎w|WkP;aUlٵ>ݧu2Rֽ{6Dw[ߣD| ,65g˃$D]6ڰqWIȈSGD@~ҧ,xK?m;iR;Bvw[G(fN#}+7^x=jCnzws0ĝ.˵!* ,8;\:I%dU_~;I-~h?eq3Q@>]!B;J5<{^kjuhUErJv ܽ3J,%0CKH6)Sxo6FB8:ZC]rm6**-ydPT[B/V|3>3%aC<@q8_}DVt5ʈn㷢C&;]AN ! Q#E< R$3FY~[ͭ`?- WD$D#i{' 2djoeH?ԂF]M;?#V~1@ڍk:;Pb'{;c`ʐ -0TX'x;Cz`; xѪV0;d` iOk!Lq"(@(BT#=H̔N:xY;K,nvԗL"*zpI $g{Sy0Z╋/"ܢ400JL?9A?m(}Gu4偖6Wŝ87_O$KKE-2P9`PKRYBEfU *x-JKyYIW. $$ ];>3yi`ĸO)}@׈Z e>}%DY}+ $`d$cGKL"ހ(k:D\sjMYD#ԇLw0 a XĢkY1MShk#2>fM "CQ[K'BqA&||`\ lY'9MbӌlTāqs=D- *+KpNYTAx`ݨ3>1CE1\@B 3<}qȝrE8.;.%!\8wK]5$~U ^[|-8趸Ex $Pxc! &:cdNzҭ4<  qbLj @0&Fmyo 4c nI2S:5!. @Tw= ~ $̰9ܟ. Bx0B`aԂzBFx?XQl.B!H4cɭ<܅BYA}a;8a f#}- ,᜝A 1HH+?I<>T[kpY&C6MY Ma pt Ep]ZOUKbyZ\uz)b}) }"Ngf%rTX7 IY 6_PAqR7#|ӷLbpƗJ+I2TPZ##%>|__a1\_6 '6_9vtۢIENDB`vor-0.5.5/data/rock29.png0000644000175100017510000000252311310013350015642 0ustar jasonwoofjasonwoofPNG  IHDR¥lgAMA7PLTE+$lYIkYH*"UF9)" ycq$OB6wb9/'dSDwa 8/&N@5ydRo"xdQu`7-%bQB wbP K>2\M?q^Mj[K>o[/' oZiD8.o\KmY-%tSE9'!hVGgVFrQC7|gTq%xbp$OA5zeRuaP3*#^N@r]2*"s_NkG;0r_M1(!\L>p[E9.VH;@5,}fjWt)"TF9jV{e>3*iWG{d =3)' xdRu`6-%aQBn K>3vbPm`OAs^lI<1t`NiC8.mY,%mZJ~gA6,lZIkXVG:kW*#kXH ?4*r:0(eTExb 90'zeSp#NA5yeRvacRCv` 7.%M?4xcQ!L?3aPA0(![L>E9/p]LiD9.ZJ=nZ.&hn[Jg{e=3*s}hU& QD7yc ;1(fUE|fT%PB6{fSeSDwadSCs^3+#t`OlH<1s`Nq]2)"]M?q\1)!r^MjF:/0' lZJkXUG:|fjXH|eiVs~iU=2)hVF &bRCoL?4wcQ t_5,$`PAvaPmuaO_N@^N?YJ=nZ-&hB7-m[J,$WH;lX7tRNS@f9IDAT(c`@g:3`qSLc;d._ݴ(sC7V6tet'3vpcc43ȡƒƒoJ1a?Z}絥/콹PoLv\o{|dilAZ|TxCIhkܷwA`/O/~swV]bul7xx\otWws^/-6I(H19*鞉沬:P (*7xŨÍTUzPㅁک_>$TtDhsy6bmVkgu~OmaEnѰ8ŋ:g^.$Yq<^KGmECqFҥƄ/ڕ6*WqL=v9eO*IM|Iے_%Zʳ 1Z"t'5>*m{w4ˬ\S ` .<= s}HV#IMPJiuȡ;y{a, qneES`zVdًZb⌲d@>i'k pQnj'V!luNG)RM_hLB:J˳G[@fjaɊ,LOH8#-aDe)x2,xk:X^;*h dEn^w?񬾳iJTtu~Ωd 9t+{訤I΃zkkuS ik>.&iRXЌSЎj dAr[enNJ`*❭SȊ̧29O|viݙ6aШI \:\&l.A)QSE`≣pnDGVZV`_ܜRSR?>a^e^>%I}ݫ^zvvRF`P B&@VCKC 6CD5;CI;o5)WƐ165ژov 9AAY>b1A615"/?afX>v&j)ARxKBJ"(h֠ڐЁJ&EIi'%wHx;vLFR `#nkn"pꭅ4YED$C8H:4(UюȢD_Q^7hjw7!c 8n,1޺"L"ZXGa6z캿7PEPV#OFEf|TS&0HvI&+wTw4Lluk<4uoGk/IENDB`vor-0.5.5/data/rock31.png0000644000175100017510000000203111310013350015625 0ustar jasonwoofjasonwoofPNG  IHDR]' gAMA7%PLTEVH:lYIkYH yc{fTqOB6wbdSDwa 8/&N@5ydRo"M@4xdQu_K>2\M?kq^MjE:/o[ZK=oZiD8.o\Kh-%~iVszd <2)zcrQC7|gTq%PC6xb:0'puaPmtaOr]2*"H;1s_Nkp\\L>p[0( i@5,kYI}fjWt)"jV{eiWG{d=3)r' RD7gUEu`aQBn vbPm`OAs^4+#_O@lin\KmYmZJ~gA6,+#kWeTEzeSpNA5cRCv`7.%!aPA[L>jp]LD9.nZ.&,${es}hUrgUFyc fUEq{fSwa_OAs^t`OlH<1s`N]M?q\1)!r^Mj/'~gkX?4+jXH|eTE9iVsSE8 =2)hVF}gT&vabRCoL?4wcQn t_5,$t^muaOr]^N?nZn[KhB7-m[JlYWH;lXuhtRNS@fIDATc`@ h`dn6KZ"Lec*"ԗՖ, QX*+te<]mDޭ\@A5]) ur );000-]ᯭ''`j׻hFÜ:]"l-m ¥CWo4^860ymZ5ZŃ׬:-EsyGub\04YK.ӒvoP44fjwVci"OcFe@)Tc]yluR*e Jܲ7zrk b=kئIUdqn<IMH`(i K2u.SfA*G0$>C{V SHIENDB`vor-0.5.5/data/rock16.png0000644000175100017510000000377011310013346015650 0ustar jasonwoofjasonwoofPNG  IHDR#$gAMA7tRNSnIDATHWSY3@DDz#; 5ZHBDze,3'{jpŌo^n>g} ]!>zy{z\P^ޗ<#˳7ǻ޾ѻЯ:Ǻ}|ň Wݻٿd~e`ZeU+9oj ?a:k  Y=[4ux ضC4|rfvz`>Tv`Dc0wVv'}kY?n{N6]v}]ci?ax/J'˕'{n;y%ڛ4@kʢP1+ܙmٝZ0R[+sscx]</D} d,D Cqi"X*KTI0Xut׫óEӋe -\!Hxx#>I@TZȎ$SS9INvuѝC 7o!|ݹ'Ӳ#ȁD"gyhˌp{`aA>^ɱaG.{zXdJtb DhqtdAg>HVC f-e4[ XOa_0IEGoKPb Dr,ގuך*m]5HuvY[QgQCYᮍu L3|AC Ep`Q.csfS:vCbRd O{NC V4Ta׃$ MrCȬ'S8C%EB }F?B dN6/3H$~-0`FkQ!_ynRe^iAArHYL(u'ic;6숅tݵ*`!`?\F[ySAMhWP.΂8ԇRh'A\ڮ׫X^J\KEN:->"( իU]t?Y=Ņӡ,3(77dH6 mOHF27W[\y0Ϊ´ *j S>iF,a '4- 61T,;sAW-f}TLj>=UDG#}ZTMƒ U!T2e|3Y2(O,MCOc.fAEK9n7ˀdm#oEx%!Έ%3CD,0^}y`%kOȕPb $#[\ ɱ="E:/V`o˓Kekr`NeO1LUAZhIlX ~ꐤqUh_8@ffax pd0I,+ 3Tp\&_i " BG'?d۲[YL>gai`Ւ7g1c #X AB Dx12k(fίDŽz@_ _&ņ7mUy9jEՃkW~7j7UK1M8+j̅_v0i<^vN6_y8QAs>MO"^Lk/仓Uikz9b+i_GpE稾gGlw\}-85@ʘ׼,`%U74_ ?^z/{;Sf>ZtBkRb{^s:>Yq d 'P{ߝZrW=L>^v[&joM ֗KA[5R,YAhotKch`xq7T61sjPd).6FLp0=^w!O1>/jvg<=tq rjH MN c}?oOP0f?—~8*3@g0d *u2P߾.#.=eۃ).d ;oW->Ôz'3y^-\ Έ"~ 3p:payT:С>{fDZʞmTfpΎOl6nQJXEF,hJS0YRxNƴy~ΡIZ\F%_YHenut5^&@ր>l"΃aVR/@SD.tG`v8SXk~rT=ȝ.=;cx6/w&et7נ>/J$t𠔼Ԍ+ŌUEUE4CDC!( ;^]ȀǤR* 9DȮkfAT,L)KBoMhBT#>T''sK LJ%^ˁs)" nsg`cI~NGC/>}$5$٩%lȊ鱑$q!O|l 䂂c4 Zq9 љ %t`~R_3Ϲs0c.ieIENDB`vor-0.5.5/data/rock21.png0000644000175100017510000000534611310013347015646 0ustar jasonwoofjasonwoofPNG  IHDR),wgAMA7tRNSn IDATXׇ[gp֨`o((()J;X^ғݔݴM'7߸M6dyfs9~QQ/sھȁ=i3оի^_(MЧnLꮺ7}*?;%aoֿr}֓ywg>1>:wiqj@呦;]:/ 7WfDYe7w~|4N ⟷&>q-}tyim(ɞ.|wf~~_ޞtWw&>6[3W*{q<~c}oW>uߟO]Y_؇~uTCM]WZ޽0pwhݙG_o_ܚͽ鏮 sas}OB@zomѵ֊.>zr.%*{Lۓz-@0 E0KFTmӺIq,Yݶ H~i~f $TNƬ4r'맂g6qj4p'Aua9>'w0yeY~ࠇ }Iz}g{{k k OK8p ~=;js#&p\/nx ҒC O{vl1/,fF '<㦊+^]OFU3TSTl[4'U۹pAw#6i@}_]zSJn.KM C_ݞT-F3ʰt%K`c:I} nMvHKu  2zj )\71[Xl,Iܽ9vaf2?{-0pŀsF W\:4ڌɳ|3` : 8fEYj2z #t''z#W>w ,^YˮT꨾ 4pTWHK,J4tcXٷkۊE+]`arA2c~L\MR90|x|$XIRc\4zj {QѫWs7--Xv%>2,oҢ4W#ia9ܤ?ƨ\7pvo!\C`ƒz8~XO?P_r8 XWHPlji}ƉV<9l>0G[KrRb~QWخAӢYu߿>SċJyc$NMx>L{@ ͥH+K/"\Ӱ"}`i n`kfR%VXH̃;@o᳥~ vSZ`kº4& Ls]8 uש.؞dʒ|bb[]u 4bo۸N*r,H(_aYkz:ԑ TbΙTMDۇ$X|`M?j>4KOjD>ei,2&Ynp-^8)3"e;'5;^&S4TL3ZZ!M*O?k2?d\djL~k H?(h&"UfF+)!ޜḫFLN0 K)4o!@ڨo/n4[LWhR vk}R\ |ז-D52 `r\ǦcC9GqSfȑAygJrRwi#J٫زi#M@ +'é4KÆːXD usk̖  |:llrlɱ=> ٜajٿGfjF/ X`$U6o$C Yx. v k<X֛^P UpCAMWGSPG}Xb9St 5fk8|g^-FM];@ݝ[/>;p%u{0‰G]]HO -+mrӒtPk#60q!Ó$~IG˗oȹeZ̃b "\AGhQQl^=B]UIENDB`vor-0.5.5/data/rock23.png0000644000175100017510000000304711310013347015644 0ustar jasonwoofjasonwoofPNG  IHDR_egAMA7tRNSnIDATHSZgӴI4q(**; n ׸]fOl4iM?u70xys}޸qxۮZە7˃\O꫺sI!A$wk3 tˊh}Č恽uĤKD!]Jx=μ_s4߭?n=_2jZ:yA%xZ=86G_,:^-9ɨ+ 2:=Z+j8"4hSz8k{uyptHw}GJ\[4[k 2S%';2,{hVֆx}L/ lM7'zDڣKO$$D& [Ka@%$ܼe\g3.PCsLJkyF&˸;}{4w{{2DuCU\ nCeQ uI007МDP]( _٧6Y#=i;5Dmi]YR1 ɐ ;&^k#'\KR;ƃ$->Ϡ]+ >'nP;tR Ȝ؍tpaÝ- ݠR@Qf9u[c(,֑bm-'%#4MHׁ&c= gQJ\J|4[Wx?O?p+ T{/^ЉׂFSU?eE+F" JY~lT;#%487t@b`]Fp>5 vj͍v & diS (IK2 0.:TA#Mas 1c!g4A֩VeR~<=PsbI~m@O7_eTruk_ ip8gro0-b4VIUe i~gaTSsc:P8 E_:2sH>%H?.v3ܻgX_-4UKs҉i8 )!ɨ2̡˖dиtD86zt(KBH њ JYgjDV6#.Lt^ Rʲ/4wĀ1ރ!4OX>x,% ďX-^d8Kbޯ9K&MOBSmƔD*.*]v̿ @`24mS1mJ(Ĉec Å ,^Q>iOo[ZK=oZo\KC8-XI;B6,zdgVFQC7% eTD OA5zeR#uaPG;0p\1(!\L>p[0( kYI}fjWt)"jViWG{d=3)~hUr' RD7<1(gUEbQCu` aQB K>3vbP`OAs^_O@lt`NC8.n\KXI4*TE9iV(!zd=2)&n t_5,$vaPJ=2uaO3*"^N?H;0hm[JWH;jtRNS@fAIDATc`^c)M^ @3S>gB07>J|Bg4I-Lx:"gũY8EEE%N ꙑ.]p=X^tT=Ms+C]\wݦݖ赑Iac 7#3zqnZltQ|{]l\ [&?ڝx:DT(j*RId5׾?eد}-?7A~wEO'iy$X!q tAÎ:B}08IF{SN`Iu|Qmb/_x}vS {3К7 bA' :Xϻ:\x^_U(J! YzWВɠ,hyq [R&(6U.;( T̻ӏUE9]8`DYk3nkꮟkݙxsҍ4s1:}g@jO\R7bD/Ma xV;:jI}U_ʀLav'm[~ XGȆuBmj|d$->;`~X^2ۛ-yM n㒷:Aetꔼ# Tf?Cgi$,5YVDW)&$ 24 @2 dJ40OKuBFV-ϗQ~ժ]Bİ;=#6f 8UJ'Foq SCob!fb *][&S ℐE(]:S}9P bT'7фEcNY;[ǀ &ʅa7`avӘbUE]\hAD!I @0HKߪܔN H3TH %U߉4C/N+r5C{ }":rيm0{)Fy @8C; w)J*?_V=̠'TP#PIo!0ּ%R Ľ/)3yXd[\5S=Dka2ԔAU(*#B-MO:]S*|a\ 6NTUhoQh"=9.?SWOʝ#Nͼ @xx}V!qyḞTu851('{L%,M$M ir%zxNHaWBb 㞆D߶RzY]6ʈq'&$̜l"?* tEax<9O>wxj|dQ(@&EP]LWȳjKLqB!y/.6WAQa2@n浹HTkEpTɳ:4e5n7;4 >(dqB ]wNM#-V!#'ǟn`! Gp:]sAQIqQ|{~)༯z]@gfQ$ſ'QD IENDB`vor-0.5.5/data/bang.wav0000644000175100017510000030000411310013233015444 0ustar jasonwoofjasonwoofRIFFWAVEfmt DDdata|xuvy}|yxxwxV!?srwQ-0NinfiB.w}4>}pS]֨h;>p羉u܍IDyɱׅCLkb⽊j_XTar\JQu}zsg_VOTcsϮuyH/OȼVW}{s¶L?p^̓G;UtW/TF"1Z|_=Iǿ¸ü̳{tfVLKNQPPQTTUZdqxwtu{|tsy~vollmnpqrstvwurqssof\VVVSNKMRVVTQOMLLNPOJEBBFJMLHB>?DHHDADJOLE@@DEA:8=GMJA;>JUXTNOV_dec_ZWVXZYVUX^aa_^adea[VW[^`chli^W`|ZCLmtrqk`WRPNHCADIKHCBFKMMKJJIGGGHHHJNSVWXXY[\_adfghhfdceinsw{÷ʾ¿~|ywuuuusqqt{wkaZTPNMMOQSTTRQQSSOJFFGFB@H]vypcSD92.+)('*4Haw|tiZH7*$9LVXUSRRPNNPRSSSSSSSTUUSRQQRSSSRRRSSSRRRRPNMLLLJHFFFEDCCBB@=;:99::;;;<=<<;;;:::;:8533345>Ndw~ysle`\XQIA:5.'#.8:3&  '7JYchijklmmnnoonligggffjptpcO<2159:8666653347:<<;;=??>=>@BCCCDFFFEDDEEEDDEGIKLLLKLNPRRRSUY^elrvxyywursv{пsb[YXWVVWWVUUTTTTTTSRSUY]_````aaaabbcddefhikmoqtvy|̿}yurponmkjiiihd_[XVURPOOOPNLIGEEDCA?=<:8643111345666652/-*('%$$"        /BQWUOIB;2*"  -65*  "&)+++,.024579;>@BBCCDEFGGHHHIIIIIHHGEDDCCBABCEFHILNQRQPMLKLNSX[\\ZZ[\\\^adffffggggghhhhgggffedddefilmmljihhhhijkkllllmmmnooopqrsuxz|{wsmaP>/&   ,9@DHQ\hq{ytrqrtuvxyzyvsrsuz{umf`[VRNJGCA?@BDFGHHIHGGGIJIHFFGHHFEDEDCA@@@ABBA@>=>>>>?AEJOQRSTUWWTOIEEHLMNPTZ_bfillkiiloponoqsssrrsw{}{uollnomkkox|y{ypf\SMKNSWZ\bimjaYYakqqooqrqlheegilnprqnhb^ZXWXY[\^_````abdgikmorvz~|umf_XQJGHLQTVXZ[\]\ZXUVY\]ZXY]bb``eknkgjqusjehr{}xpjgd`\Z]acb_^agjiggkmjfdhottqpprqomlmnnnmmnprrpprw|~~zkcbfhhginu|ļĽ|tooruvsniecdfggggiklmlkjjkllkjhggghjloppnkifb\VSSUW[`gnqnga_`a`^]_aba_^^_]ZWW\eq|xj^SH=2+(((((*.38;;:741122200134568:;:8655433369=?AABCHMRTSQQPLD;657;<=?AEHJMPTY]aehkllkkjifa[WVX[^`_\WRPQUXYXX[ainonnrx}wronnosy}topw}}zyywphb`beghhijjihhhhggggfec`^]]_accccehjlnrx}|{}}{z{{||{xsmgb`^\ZXWVVVWXYZZZ[\^adfhiijjkllkkjjigc`^]_adgijjklmosy}}zvtuwxxxyz{{ywvvy}ý{vpidbdghgfiotvtqprssokhggggffgikkga]ZZ[[\]aeimoqssrponmjfcba`_^]\ZYY\`ejptwwusrpmifdca`_`bdefedb_]\[ZY[_fmpqqqqqrsuwy|~~}|{{zyyyyxvtrokgedeffda]YVRPPQSTSQQQRRPMKIIIHGHJMNNMKIHHHHHHGFEEDCBA@?>>?ABA?=;:998:<@CDDCB?;87:>AA?==?ABBBEGGFCAAABCBA>;:<=<:75566431/-,**('%##$$%%'(**+,./000134432334444567776532100/013455541-)%$$%)0:EOUURMIECBBDFHJKKLMNOPRUWY[\]^_`_^]\\\]^^_`beggfgkpuwvututsqnnortvxy{|{xtoljjkkjhfeeiox}zyy{{ywwy|~~{yxz|}}|}~~}|{{|}~{yxy{~~{yxwxxyxvrpnlkhecb`]YWWXWUQNLJGDB?<94/*% %*)$"#$%')*)'# %*.035661,('),.0234567:>ACFHKLMNPQSSTUVWY]afjkkkiggkt{rmms}xtrsv}vpot}|yxxxz|~~}|zxwwwwvwy|~~~}}}{zxwtqnns{qeafp{wnihhiigfffedefhihhhjlmmmmnoqqrrsstvwxxxyz|||||}}~~~}}|||||}~~~¾¾~{wvy}|vokhec_\YXXXXWVUSQNLKKKKIHGEDCDEGILPTWWTQNLJHGGILPRSSSTVY[\[YWVUUUTPJB944:CMU[`ceedb`^^_abcehlnpqruwyz{~~|ywusrpnljhghiheb`^^]\[[[ZZYZZXUQNLLLKKJJIGFFFGHHGGFFGHIJJKKLMNOPPPPPQRSTTTUVWVSPNMKJHFEEEEDCBDFHJJJIJLMMMMNOOPPRTVXXXWVUSQQRSUUTRPOOPQQQRSUUSPNNONKGC@>=<;<=>?ACDDBBCEGHIIJIHFFGGGGHJMPSTTUVY\^``aaaaaaaaaaabcddccbbcccccdcccddcba``acefggedbaa````_^]\[[ZYXVUTUVWWVVX[^`aabdefhlprrqoqw}wsqpqtx|~yrjda___aeikiea``_^]^adffc`^\YUQMJIHGGIKMNMKIIJMPRRRQPPPOOPQSUVX[]_^\[ZZYWUTTUVWWY[]][ZZ[]]]\\\\[[[]`bccb_ZUPMNQTVWXXY[^bfijhea][\`dfffhknonlkjihfefhjjigedca__`bcba`abccegjmnmkihhhhea_aflrvy|~wpifgkqv{}}|{zyvqlihhhgdcdgknpnh`YTRTZahkifcbdgknpppponmmqw}{|~{xusrqomkhghiiigedb`^\]_bcba__add`[WVY\_`acccba``abdeffeffgijjjhhhijigffggfdbaaa`_____^]]^^^^^^^][XVVVUTSQPONMLKJJIHIJKKJIHHHHJMPRRQPRSUVWWWVWX[]\ZXWVWXZ]`cefgjlmllmorsssuxz|}~}|||}~}{{{{{zyz{||}~~|{ywvvwwwwxyyyyxwwwxxxxxxyz{|~~}~~~}}}}}|}~}~~|{zyyyxwvuutssrqpnlkjjjkmonljgfc`^^__^[XWWXXWWWXXYY[]^^^]\]]_`bdeeefgjlnqtvwwwwwvttv{}|}~}xsmhfeda^\]^___^]\[ZYXWXY[\]^^_`abcddfghhjloqssssuwz|}~~}|{{zzzywutsrrrtuwxwusple]XTSQPPQSTTSRRRQQQPPOOPPQQQPPPPPPPPPPPPPRSTUVWXYYZ[]^^^_`bdfjostuuwwurpqsrnigjostsrstuuttuwxxxxwwwwxz|}}}}~~~{xx|~ytqsuvuttvwxwvtsstuvx|~}|}}|{{||||yvrqppprvz|{vrqqrrrqpnkifda]ZWVVXZ\\ZXY\`ba`^^^]\ZYZ\^`acddb^[Z\aehiijkmqv|~|{yxvutssrqqrstttsrsstvwwxyzzyyxxxxwwwvtpmjhgghknonlihgd`\\^bfjnpnid`^^^]^^\YVSRRQQQSW\agmrusng_YUTW]elmi_SG?<=@DINTZ^bdgiihffgjmprssssssssrrsssstssrponmmmmmmnorsttttsqoopstuuuvvvvvvwvvvvwwwwwxyyyyyyyyyyzyxwwxxwtplifdddddefgikmpty~}xspmlkjifcbchq{~~|zwutqmjgghjlnonmligedbaacefgfca`_]\]_dgjjjiiiiiiihhhhjlnppppqstvwxz|~}zxy{||{zxvtrpqqrqomlmmmlkkklkkjjjjihghhihgffffeddddddefhhgedcb`__abcba```cfjllhdabeilmnnpruvutrqqqqppqsuwvtsrrsuvvvuuvwxyyyyyyxxyyzyxwwxxwwwwwwwvuttttrnic`_afkoqqppqsuuutttrqqqsttuuuvvvuuutsqponmllmnprsssqomlllmnqsuuuvwwxxxyyywvuvvwvuuuvvvuuvxyzywsommopqpoljhhhiiiijjjihfecbbcdddcddca_^^_`beggebbdgijihhhgfeca_][[[\^_aceghjlmmkhghknrux{}¿{wsrqpoqty|}{xuqmklorrqpqstuvx{}}{yyz}}{{{}|zxxy{|{zwtqppomkgc^XROLJHFDCDEEFFFEDA>:743210/-,++.269:94-&! #&*.4:?CDEDC>82/02210//00136998767889:;=@BCA=96579<<<<;;98630+'$#%'))(%"!!$(+./0248;>@ABEJNQSSRQQQQSUVVVVVVVWXYZZYVTRPPOMLKLMOQTX]befgggfda_^][YWVUVY^cgjkie`ZVSQOMKJJLOQTUTSRRSTVWY[]^^^][YWUTUX[^aeghgdb`aa`_]\[ZYWTRONNPQQPMJGDA><:99:;62.,*(''(+/4752-*)('&')+-./27<@@?=>???>=<;::9::;<<<<<;<=>????@AAA@@ABDHLPQOKGGJNQPLF?:89;==<<=??<867;>@@ABCCCDJPTRMIGHIKLORVY[^__]ZYZ]`abbba`^^_aaa`abcdefghiijkkkjigfeeefghiiiijkkkkkklllkihhfedccdfinqsrommoswz||}~}zwuttvy~}{y{~{yy~{xwx{|||~}|{}|xusqnljiijmrwxskc^[Z\_dhkllie`\YWVWX\bgjkhc]XVVY\^`abb`_][[[[[[ZZZZZYXWWWXXZ]adfgikllkhea][YYZ[\]_abba`_``bbcccdfgiiihhggffghiklmmnmlkkklmnopqrstttssttttuvwxxxxyz|}}}}~~¾}|zy{~tkdaadksxxtomlljihhijkmnppnljhgfffec`]\\]^][YWWXYXWVUVWXXXWWVVWXYYYYYZZ[\\\]^^^]\\^_^][\^`a`^^_``_____^^^^_^^\ZUOJIKORTUUVVX[]]]^adgggilquz|wwy}~~|{|{zywutrrsvy{{{z{||zvrmjijloponmnppnlkloponlmoopquz|vpkhhlryzvrpopqsvxz{{}{rideksxxtnjjnt{}tlhjr|~xuuvxyyyyzz{{||}}}|{zzyxxyyxwuutsrqqqomllllmmmnnonljihhhhhhhggfffeca``aaa`__^__^^][[YXWVVVUUVWXYXXXYZ[[[\]^^]\[[ZYXXXXYZ[[\\\\\]\\[[[[ZYYZ[]]\[[[]_`aba`_][ZYYXWUUTTTTUVWWWWXXXXXYXXXXYZZYYYYZ[[\^_`aabdegjnqsqomosx|}zuroljhhhjmprstsrpmjfdbcfjnqrqnkgedfinqsssrqomkifcceinsvxyyz|}|{{{|}}}~~~}{yyyzzyyxxwusqpooppqrrqqpnmllkjihgfc_ZWUVX[`eilmmmljfa]YXWXZ\^_`ab`]YUTTTUVWY[\\\]^__^\YWWWXYZZZXURPPONKHGGIIIFC@>;964469;=??><97567:=>>?@BCGKPUXZ[[[YWVVX[^`_]YVTUX\^^]]]]ZUPNNOPPPPQRTX\aefgghkmpty~}{zzzzzxuronoqsuwy{~|yvsqppprstuvwxyyyxvuuw~}{yvspnlkifc`\XVVWXXXZ[\[ZXXXYZ[]`ceffedcbbcdeffggghhhhhfeca`_^__abcefhikmortuvutsrpmjfb`^]]]_abbbcdeeda_]ZVQKE@<:::<>ACDFFFDB?=:7532123479:;;<<=<<<=>>>>===<:87778:;<>@AA@?<:8766678:;;;;:9999:;<=>>??@@@ABDEFGGFDB?>=<<<;<=?@AA@@?>=<=>ACDDEEEEEFGJOSVWWWWWWVVWXXXVTQOMMNNOOPQQOMLKKKMPTZ`cdeegilmnooopqrstttrpnjgdbabcegijkkklnopppppoopppqrsuvvvvusplhffhjmopqrstsqmiebabdgiiihiloqrqqrtxz{{zz{|~~~~}|zyxvtrpnmljiijlptwxyyyyyyxwvuspnmnoooonopruwxyyyyz|~~}||||}~~~~}{yxvuuuttuuvwxwvusrqqqrrrqpnkhfdb`^]\\]]^]\ZXVTSRQPPPOONMLKKKKJHFDB@?=<:9753100//.-,,,,.///.,,+*)))*+,--..-,,,-..//////////0123344556667887543221123333223357:<=?@AAA@??@ADFHJJIGDB@@ACEFGGGGHJMOPQPMJEA>=@DIMPPOMKIHIKNRVY[ZXUSQPPRTVXY\`dggfcaabegiihfeddddba__`cfjnqsuwxyxwtqpoprux|~}|{{{}~|zxxwvuttsrqonmmmmllllkjiiiijjihgfffggghiijklmnnmmlkigeca_^]]]]\[[[\\\\]^`bcba_]\ZYXXXXYYYZZZZZYYYYYZ[[[YVSPONNMMMMMMMNPRSUVWWWVUSQOMKKKKKLNOQQRSTTROLIFB?=;::::;<=>??@@ABCDDEFIMQSSPMKIIIHFDCCCEEEDDCCCBBAA@@>>>@BDC@>=<;:740-,+,----./133344321135789::9764320.,,,,,,,,++++**)))))))**+,,./269:;::9:98530-++,.2689889:;;:9630.-/269;<<<=>><:8889986321123333236;BHLPQRSSSSTUUUUTUUUUTTTSRRRRQQONLKKLNPSTVWY[\]\\[[ZYXWWWWWXXYYYXWWWWWVUSQQQQQPONNNNNOPQQRSTTSQPPQTVXXWWXXXXXXXXXXY[]_`bdeghiiiijjkklmnooppppponmmmlkjihhhggfghiiiiklnmlkkmnnmlklkkihgffedddddeeefffffffffeddcbbaaa````acegijkllkkkkklmmllkkkkjiihhhijkkkkllmmnooooonnooprtuwxxwwxxxxxwvvwwwvvutsrqpoonnnopqsuwz}¿½|xuqnkgc_\ZWUTTTTSRQONNNNOQRTVX[]_`abccdfilnoonnljihggfeddefhjllkkjjkmnooonnnoqrssqomkjjiheca_]\\\\\ZXWVUTSQQQRTVYZ[[[ZYYXXXXYYYYXVTSSUY\_````abbbbbaa``_^]\[ZZXWVTSQNKHFDCA@??>=<:864310/....../27;?BCCCCBAABDEFFFECA?><:85310//037<@BA>94/,+**++-/0110...03689987777765432234667779;=>@AAAA@ABCEFGHIJLMOPQRTUXZ[\\\[[\\\\]^`abcb`_]\[[ZXWUSPMJHHHJMOQRQPOOOPPQRRSSUVWXXWVVUTSRPOOOPQSTUVXYZ[]^_`aaaa`____^___``_____^^]]^`aa`_]\ZYYXXXXXXXXXYZ\]^_`a``_^^^^_`bdfiklmnoprtuvwwwxxyz{}~|{zyyxxxxxxxwwwxxxwvurpnmkigfeefhkmoqrsuwxzz{{|}}}}}}}}}|{zyxvusqonllkjihgfdca_]\[ZZZYXXXYZZYXVTRRRSRRSTX[^^]\\]`bdc_YSNJHGIMS[``]XUTUWZ\]\YVRONNORV[`defeddcccca]ZXXYXWVUUTTRPOMLKIFB=830/0112331.)$! "$')+-...-,,,+*))(()))(('&&&&()+,,--.02468::;::87643222234444333334457899::;;<====<:865568;>BGJKKJHFEDCCDFHKLNPQSVXZ[\\\[ZXVSQOMKJIIIJLMMMLKIFC?;86432234678876433322334445579:<>?@@@@ABCCBCDEFGIJLNPQSTUVWXYZ[[\\]\\[ZYXWVUSRPNMKKLMMNOPPPONPSVVSLFBADGIJKKLNOPRSTTTTTUVWYZ\]^_abdeghijkkllmmmmmmnnoprsuuvvwxz||{zzxvuuvwwwxyzzz|}yxy{{{{{{||}}~~~~~~|yvtrqppppqrstttrokhedegikmoqsttsrrstvxyzyyxxyz{|}~~~}}~~~}{ywvuuuuuutsstuwxyzzywurpoonmmmmmmmnnnnnnmmmllmmoppqqqqqrrqqrstuuutsrrrrrrqqonmlkigfeeeeffeddbbabcdefghhiiijjjiigffeeefghhhhhghhiijihgecba``_^^]]\[ZYYXXXXXYYZZZYXVTSSSTVXZ[[[[[]^`bcefghiiihfedcddcca_^]^_abbcccccccdefhiklmmnnnnnnnnoopqrrssttttsssttuvwxyz|}~}|{zzzyyyzz|}~~}}~|xtpke`\YWUTSRPPONMLKJHGEEDDEFIJJIGEEEEEEEFGHJMORV\bhkllkklkjhggghjkkkigfdb`_^^^^^^]\[ZYXXWWVVVUUUUUTUUUUUTSQOMLJIHGFEDCBBA@?>==<==>??@@?><:8766554444444455679;<>@AA@?>>?@@AAAAAAAAAAAAABDEEEEEEDCBBAA@?>>?@CEHIKKKLKKJIHHHIKMPRSTTSSSTUWZ\]\[YWURPNLLLMNOPPQRSTTVWY[\]^^^^_aa_\ZZ[]]\ZYXWVUUWZ]addc_\[[[[[[[[[[[\]^^__`acegggfecbbbdfhjlnqstuwxyzzzyz{|~~~{z}~}|{{zzz{|}~~}|{zz{|~~}}}~~|yxvuttttttuvwwurolkkkjifb_\YXWVWYZZXUQLHFEEEFHKNQSTSQPPQTVVUTRPNKJJKLLKHECAAABCCCCCCCCCBA?=<<>@ABBA?<878:=??><95322467789::9742101359=@BB@=<;;;<>@AA>:7679<>@AA?>>???>>>=<;;;=>?><964221001346677888888877665555655568;=>>>=<951039AINPPNKHFDDB@<:;@HOTURNKIKPX`fhgd_ZUQONORUWXWWX\adda\XWX[^`_\YVTUX[^``_^^_`aa``_]\\]^___^_`abdfhkmqtvwwtrqruz~ÿ}zwtrrrsssrqnkgc`^]^_```^][[ZXVROLJIIJKJJHHGHIKMPRTWYZZZ[[\\]\[ZYYZ[\]]]]]]\ZXUSRQQPPOONNMMMMMLJIHHGEDDCCBBABBBA@>=;8532210//02233443333444456777766778899999999:;;;<<==<<;;;<<==<<;:87789::99874236:=<:88:=@@>:742222358;>@A@?<;:::975446:<;6/)%&*/342.,+++*)(()-16:<<<<<>??@ABCEEFGGGGGGGGHHHIJJJIIHHIJLNOPPQRSTUVWWUSQPOPPQSVY[\[[[\]^___^]\[ZZZ[]^`bdfhikmoqrssssrrqqpoopprtwz|~~~}|{zzyyxxyyzz{{zzz{{{|}}~{tpqv}¿~~~~~~}}}||{{{{{{zzyxwwvutsqommnnnljgecccdfgijjjjiggfghiiihfc`^]]]^^___^\YWWY\^__][YVUSRQPOMLKJIIHGFCA?==<;9864322223444333345543223468:=@CEFGGIJLNQSVWXXYXWVTRPOMKIIIKLMKIFDCB@>==@DHJJHD@==?ADDCA@ADGJKLLKJIGGHHFC?:40--/3799730-,-/1357862.+***)'$#$'+-.,'"#)/35679;=@ABA@>>>@BDGHIIIHGFGHJMQTVURNLLOSVXXXXXYXVRMHFFHKMNPQQOLIGGIKLNNONKHDBCEHJIFCA@ADFHIIHGFEDA>=?DJOQNIDCGLQRNJGIMRTQJA;9>AFJLLLMNNNMKJKNSWYYUQMJJMPSTTSRPONMMNOPQSSSROKGEFILOQRSSSROKGDBA??@DKT]djmnlhc_]]^bfikkihgghijjjkklmopruwy{|~}{ywusrrqqppppponmkigfeeeeeedcbbcccccccddefffedccba`^\[ZYYZZZYWURQONLJGDCCEFFC>9547;?@@><:97520//0136799989:;<<<;:9877789:;<==>>>?????@@AABBBCCCCDFGIJKLMNOPQRRSTTTTSRQQRRSTUVVWWWWVVUUVWY[]^_``_^][ZYYXYZZXVROMMMMMMLKKKLMNNNMKGC@?@BEFFECA><96321/.,*('%%#" "$'+.1356779;865679;>@BBBA@>==>@AA?=;8654310//.-+)'&'&$  "###"""#$%&&%$""$(-2455542/+'%%'+/220-,+*)(''((&!+7>?9/%  "$'*-/123456666778:<:75444443322210.,+***)'%"    !%(*,..-,+,/37;>>>=<=============>>>>>>????@@AA@??????@@@???@ABBA@?>>>>==<:851/-,,,-.//0124689::;=>>>??????@@@ADJRY]]ZWUW\bggd`]]aehjkmoqrtuvwxxwwwwvvutsrrqqqqponlkjjkklmmmmmllllllllmmnnopqrrrrrrrstuvvwxxyz|}Ŀ¿ƽxspooqrrrqqrqnia[VTSRQQPOLIGHJMNLGDBCGJLLJHGGIKLLJHGGIJKKKKKJJJIIIIHHGGFEDCB@=;:9887776666789999::;<=>??><;9987665432110012222211111100.,*(%$$&(+./00///...//////0//.-,,,-/01123445556778888898888764310/...---..//0112222223333445678899999::::::::99999:;<>?ACDEFGIJKMNPRTVXY[\]^_abcccddefgggggggghjklnopqrtvwwxyz{|}}~}{ywspnnnoomkigeca_][YWVVXZ\]\[YXWVUUVVVVVUTRPMKIHGGHIIIIIIJJLMNOPQQQQPPOOOOMKKLNQSTSRPONOPQQQQQPNLJJJJHFFHJLKIEB@?>>=<<<<;;;<<=>>>>=<;:::;;<<;:86432210/.-,+**++,-/1479:::::;<=@BEGILOQRQOKGDA?@BGKOPOMKIHHHIIJJIIGFDCBAA@@????@AAAA@?>>=<;;;<>?@??@BDDDCBBAAABDEEEDDDDCCA@?>>??@@@ABCEFHJKKJIGGGGHHHIIJKLLMNOOOOOOOPQRRSTUWY[]_bdefggfedccccccddefhiklmmmnoprsuwy{||}~~}}{zyxxwwvvuttttsqpooonljhhijifc`^][ZXXXXXVUUTROKIHHHHGFEDCB@>==>><:9;>BEECA@ADFIKMOPPONNNNNNOQSUVUSPLJKOSVWUSRRSTTTSOJDBDJOQOLHEB@><<<<;::::::99999999999988889:;<=>?@ABBBBAAA@@@@@@@@@@@@AAAA@@?>=<;:98766656678:;<>?@@AABBCCCBA@?=<:86420////01345665421/.,*(&$"!  !"#$%%&'()**++,---,,+++***++,,,,,,,,++*)('&%%$$##""""""""!!!!!!""#$$$%%%%%%&&&&&&'''(()+,../0134444443322223333321100/.---...--+*(%#"! !"$%%&&'''''''&&''((''(())**++,,./134678899999999:;<>?ABDDDCBAA@?>>>?????>>>>>>?????@ABCDEEEEDCA?=;97543222210.-,++,,---,*(&&),/24568:=?AABBAAAABDGILOQQQQPPPPQRRSSSRRRSTVYZ[[[[[[\\]^_acefhijlmnoqrstuwxz|~}{zxwusrqppppqrrrrqqponmlllllmmnpqrstuuuuutsrqqpppppqqpponmllkjihgedcba_^][ZXWVTTSSSSSRQPPPOONMLKIHFDCBAAA@@?>>>??@@??>=<;:999999:::;<==>???>=====>>>>>>>>>>?@ABBBAAA@?>=<;::9876555554321/-,,,,,,++*(&$"!!"##$%&'''''''&%$##$%%&'((())*)('%##""""!!!!!!!  "$%&&&'(*+-/012468;>ABCCCBBBBBCDDCB@>=;:99:;;<=>?@ABCDFGIIJJIIHHHHHIJKKKKKKKKLMMNOPPQRSTUWY[]_aceghijkmnoopppqqqrrrrrrrrrrrrsstuwxz|~~|zxvuuuuuuuvvvvvwxz{{{yxvvuuvwxyyxwwvvwxyz|~~}}||}~~}|{zyyyz{{|{zxvtsqponmlkiiiiihgfeeeedccddeefgghijkkkkkkjihhgffeeddddddddddccccba```bdec`][ZZ[\]^^^]]]\[YWUTTTTTTUUUVUUSQPOPQTVXYZYXWVUUUUWXXWVUSQOMMORVXYYWUSQOMKIHGFFGGGGIJKLMMNOQSVXXVRMIGGGHIJJKKLLLJGD@<99;@DEDB?<:767:<>>?@ADFHIIJLOQSTTTTUUUUVVVUTRQONLKIHHHHHGFEDCCCCCCBBAABCFHIJJKKLLMNNOPQRRRSSSSTTVWXZ[\]]^^^^]\\\\\[[[ZZZ[\_bdefffeddddefghijklllkihffgiloqrrrrsuwy|~¿}{ywvvwwwvuuuuwy{}~}|zyxwvwxz|~}|ywtrrsuwwuspnlkhecbccddca^\ZYZ\`bcb_\YXXXZ[\]]\ZYXZ[\\ZWTQPOPQQPOLJGEDCDEFFFDB@?>??>=;976678:;<<<==>>>==<;;;;;;;:9876431/.--,+)&#"!  !#$$$#"! !!""#$%%'()***))****)'&$$$$$$##!  #%&'&%$#$&(*,-,,-/37:=>??@@?@@BEIKLKHFDDFGHIIJJJJKLLMMMOQTVWXYZZ[\\\]]]^^^\ZXVUVWXYZZYYYYYXWWVWXYZZ\\]\[ZZ\_accbaaaabccddefghhihgfeefhjlllljjijklnopqrtuvwwwxyz{{{z{|~~~}}}~}{zz{{{zyxxwvuttttuvxz|~~}{zxvuuuvvwwwwwvtsqppppqqqpnlkjkmorvxz{{{ywvuvx|~}}|{{zz{zxvsrqqrssssrpnkigfgghhgfeeeeeffeddccccba``_^^]\]]^]]\[ZYXXYZ[[ZYYXXXXYZ[\^_aceffffedcbbbcdefffghhiihgfffgggfedba``__^\[ZYZ[\]^___^\[YYYYZ[\]]]]]]]]]]]]]]^_`abccddefgghhhiiihgedccdfgijkkjhfdbaa`_^]]]]]ZWSQONMKIGGHJMNOPRSTSQOMNQVZ]]\[YXVTRPOPRVZ\]]\\\[[[[[]^^^^]]]^`acdeffghjkmmmnnopqrstttsqomllmoqstuvutsrqqppppponmkigecbbdgijigecbbba_\YWXY[]\[XVTTTUUVX[^adeda\WRQSW]bdedca_\XUSRSVY\]\ZXWWXXYZ[\_beggfedcdeghiihgeddefghhgghilnqrsrqqqsuwz}~}}|{ywtroljhgghiijjjjjlmnnnmmnoppppppqrsssrqonkigffghhhfda`__`aaaaa`^[XUSRQQQQQQQPOMLJIHFECA@@ABBCCBBAA@@@ABCDEDCA@@@ABCDDEEDCBBBBBCDFHJKKKIHFEDDDEEFFFFEEDDDDEEEDDDEGHIIIIIIIHHGGFFFGHIIJIIHGFEDCBA@@ABDEFGHIJJJJJIHGEDDFHJKLLLLLLKIHHHIJKKLLMMLLMNOPPPPQRTVXYYYYYYYXXYZZ[[\\]]]\[ZZZZZZZZZ[\]^_`abbcdefhijjkklmnnoopqrtvy{~~}~}|zxwvutsrponnnonnnoqsuvvvutsstuuvvvwxz|~}{zyxxxxyxxwvutsrqpoonmllkjiihggfeedca`_^]]]]]]]\[ZZXWVUTTUVVUTSRQQQRRSTTUTTTTTUUUUUUUTSQQPPQQPPONMLLLKLLLKJIGECBA@@@@@AABBBBCBBBBBBBBBA@@@???>>???>=:741/...-,+)((((''&&&'((((('&%%&'(()+-/.*&$#$$%&&%$#####"""! !"#"!  #%'('%#! !! !##$$$########%(+./0/.,+++,,,+**)**,,--../123443347:=??><;:;<>@ABBBBCDEGHIIIIJKMNOOPPPOMLKKJJIIHHHHHJLOQSTTSRRRRTUVWWXXXYYYYZZ[\]^__aceghgfdcbbcegknpqqqqqsvxz{{yxvvwxz{|||zwtrppqrrqomllmnoqrsuvwxyyxxxyz|}~}|zz{{|{zyxvutrponopqpnlheca``aaaa``_`````__^]\ZYXWUSRRRSSRQPOOOOPRSTUTTSRRRRRRQQPONLKKKLNPRSTTTSSRRQRRSTUUVVWXYYYXYYZ[[[ZYXYYZ[[ZYWUTTUUVUTSQPNMMMMNNMMMLLJHFDCCCCCCCCCCDEFGGGFEDDDDDCB@?=<<<<<<<<<<=>>?????@@?>===>>>=>>?ACEGGGFFFFGGGGFEEEFGIKLNPRTVWXYYZ[\]^`acddeeeeeedcccddefghijklmmnnoopppqqqqqqqqqrsuvxyz{{{zzyxxyz|~~}|{{{|~~}||{zyxwwwxyz}~}|{{{{{|}~~}|{{{|||{zwutsssssrrqponlkjiijjjjjiihhhgeca_][ZZZZYYYYZ[[[[\\]]^^__`abbcccccddefghiklnnooppoonmlkjiiiijlmnoonmmmmmmmmmmmnnnnmmmllkjhgfedddeeeedca`______]\ZYYYYXWVUUVWY[\]^_`abdefgggghijlnpqrqpnmkjigffeeffedcb````````abcddefhjkllkjiiiklmnoppqqqomkihhhhhgggfedcbbbccba`___``abcddddcba``__^^]]]\\\\\[[\\^^______^^^_```___^^^]\\[[[[ZZYXWVVUUUUUTTSSRQPONMLLKKKJJIHHHHIIIHGGFEEEEFFFFEEDDCBAA@??>>>=<:9766789::;;;<=>???>>==<;:976433345678999:::;;<=>?@AABCCDDDCBA@@@@?><;976544433333455543322334456789;<=>?@@ABDEFGGHHHHHHHIJKKJIHHHIKLMMKIGFFHIJJIHHHIIJKKLLMMOPRSUXY[\\]\\\]_accddddefhijklmnprstttsstvwxxxyz|}~~~}|{zz{}}|{zz{{|||{{zyxwvttstuuvvvusrqpponljigfffggggggfedcbba`_^]\\[[[[[[[\[ZYXVUTRPONNOOPQQQQQRRQPNMLLLLKJIIIJKKMNOPPOONNNMLJHGHILMNNMMMNOPPPOOOOQRSSSRRRSTTTSRQQRSUVWXWWVUTTTTSRRQPPOOPQSTVVWWVTRQPPQQRRQPONNMMMMMNOPPPNMKJJKLMNNOPPQPPOOPPQQQQQPPPPQRSTVXYZZ[[[\\]]]]\[ZYWWVWWVVTSQONNNNOPQQQQQPPPPRSUWXY[\]^`aabbccdeeffeedccbbbccddeghijklmmmlmmnoqrsstssrrrsuwy{|||{{{|}~~}{zyxwusrpnmkjihhhggfdba_^_`acdeeffghijlmnopppqrstuvvvvvvvvvvvwwxyyyyyzzzzzyxxxxy{|}~~~~~~}|zyyyzzzyyzz{||||{{{{|}}~~}}||{yxvusrqqrsttttttttuvwyz{|||||||||}~~~}}|{{zyxwwwwwxxwwvutssrrrrrqponmllmmmnnmmmmmmnopqqppooppqqrstuvwvvuttttttttttuuvvvvuuuttsrqponnmmlllkkjjjkkkklmoprsstuvwxyyywusrqqqqqppoopppppqrtvxy{{|||}}~~}}|}}~~|zxxxxxyz{|}}|zyxxxyz{|~}|{{|}}~~~}|{yyxwvvutsssrqqqqqqrsttutsrqpoopqrsttttttttsrqpnnnnnmmmmmmmmmnnmmnnooooonoooprtvwxxxwvuuvxz}~~~~~}}}}}||{{zzzz{{{{{zzzyyyz{{|}}~~}|{zywvutssrrrrrstuuvuuttttuvwxyyyxwvvvuuutsqponnnnnnopqrrrqponmllkkkllmmmlkjjjjjklmmmmmmllllllkkkkkkkkkkkjjjkkkkkkkkkklnopqrsttttssrqqqqqqqqqrstuvwxyzzzzz{{{|}}||{zzyyyyyyyyyyyyyyyyyyyyyyxxxxxyyyz{{|}}~~~~~~}||{zzzyxwvvuuttsssssttttssrqqqqqpppooppqrrrrrqqpooonnnnnnoooonnmmllkjjjjjjjjjjiiiijjklllmmmmmmmmnnooppppppppppppqqrrssttuuvwxxyz{}~~}|zyxwwwvvuuttttuuvvvvvvvvwwxxwwwwvvwwwwwwwxxxyyyyzzzzzz{{{{{||}~~~}}||||}}}}}||{zyxwwvuttssssssssssssstttuuuuuvvvwxxyzz{{|{{{{{{{{{{{{{{{{{{zywvuuuuuvvvvwwwwwwwwwvvuuuuuuuuuvvvutrpnmnooppqqstuuuutssrrqqqppqqrstutttssssssrrqqppppooooooooonnmmmlllkjiihgfedcbbbccdefghijkklmmnopqrrsssstuwxz|~~}|{{{{{zzzzzzzzzzzzzzzyyxxwwwvvvvwxyz{||}}~~~}|{zzyyyyyyyyzzzzzzz{{||||}}~~~~~~~~}|{zywvuttttttttuuuuttsssrrrrrstuvvvvwwwwwwvvvvwxyz{{{{{{zzzzzyyxxxyz{|{zzyxxwwvvuuuuuttsssrrqqqqqrrrqpomlkjiiiiiihgfeeeefghhgfecba`^^]]]]]]]\\[[[[[[\]^^_```a``__^^^]^^^___``abcddeefffghhiiijjjkklmnoqrtuvwwvvuuttsssrrqppoppqqrssrqpomlkkkkkkklmoopooppqrsstttuuvwyz|}~}||}~~}|{{zzyzyyyxvutsssstttssrqppoonmlllllkkjiiiiijjkkkkkkjkklmnoonnmmllkkjiihhggffeedcba`_____`aabbbcccbbbbbbbccdeeeeeeeeeeffeeeddddddddccdddeeffggghhhgggggghhhhhgfeedccbaaaabaa`__`acegghhhhhhhhhhhhhgghhhhhhhijkkjjiiiijkkkkkkklmmnooqrstuutttuvwxxyyyyyyzzzzzz{||}~~~~}}~~~|{zzyyxxwvvvvwxxyzz{|}~~~~~~~}|{zzyyyxxwvutsrqppooopqrsttuttsqpoooopqrrstuvvwxy{|~~~}}||{{{{{{{{{zyxvusrrqqqponmllkkkllmmlkjiiijklllmmnnoooooonmmlkkkjjjjjiijjjkkjiihhhhhhiiiijjjjjklmoqrsttuuvxyzz{{||}~~~||{|}~~}|{zyyyyyzz{{|}}~~~~}|{zzyxwwvuuuuuvvvuuvvwxyyyyxwvtssrqqqrrsstuuttsssstuvwxxxxwvuttstttttttssrrsstuvwwxxwwxxyz{{{zzzz{|}~~~~~~~~}{zyxxyyzzzzz{{{{zyyxwwvvvutsrqppqstvwwwvuttsssrrrrssstssssrqponnooopoonmlllmnopppoooprstuuutsrqqqqqpppppqrssrqponnnnooppqrsttuvwxyyyyxxxyz|~~}|{{zz{{||||||}}~|{zyxwvuuuuuuuuuvvwxyyyxxxxy{|}~~~~~~~~~|{{z{zzywusqpoppppponmllllllkjihgffffffeedcccddddccbbbbcdddddeeeddcbbbcefghiijklmnoprsstsrpomkjihggfeeedccba`_^^^^^^^]\[ZYYYXXXYYZ[\]^_`aaaaaaabbbbccccddeeeeddcccccba``__``aaaaaaaaaaaaaabccdddddddddddeeefghhiijjjjjjjjiihhgggfffffffffffeeeeefghhhhhggghhhhiijkklllmmnooonmlkkkllmnopqrstuvwxxyzzzzz{{||}~~~~~~~}}}}}|{yxwwy{|}|zwusssrrqpppprsstsrrqrrrrqpooopqrssssrrrrrrrrrrrqponmkkjihhhijkmnoppponmmlllllllllllkjigfdccbcccccbbbbbbbaaa`````__^^^^__``_^^]]^_`bcdeefffeeddccbbbbbbbbaa````__^]]\\\\]]]\\[ZZZZZZYYZZ[\]]^^_``aaaa```abbcdddccccefhijkjjhgfdccbbbbcccdccccbbaaaaaa`````aabccccbaa`__^^]\\[[[[ZZYYXXXYYZZ[[[[\\]]]\\[ZZZ[\]]^^_____^^]]]^_``abbbbccdddcbbbbcdeeeffghijkkkkkjiiiiijlmoqrrrrrrrrssttuuvvuutuvwy{}~~}|{zz{{||}}}}}|{zyyxxxy{}~~}|{z{{}~~|{zywvtrpnlkihggffffffeeedca`_^^]]]]]]]]]]]\\[ZYYXWVUUTSRQPPOOONMMLKKJJIIHHHHIJJJJIGEDBBAAABBBBBBBCCDEFGIIJJJIHGFEDDDDDDDDDDDDDDDDCBAA@??=<;9887789::;::98899;<=>?@@@@AABCDEEFEEEEEFGHHIIJKKLMMNOPQSTUVVWWXYZZ[\\\]]\\\\\\\\\\\\[[[[\\\\\\[[ZYXXWWWXYYZZZ[[[ZZZZYYYYXXXXXY[\^_abcddddddcccccdefghiiiihhggfffgghijkmnopqrssssttuuuuuvvwxyyyzyyxwvutttuuvvvvvwxz{|}}}}}}}}~~~~~~~~}|||||}}~~~~}|{yxwvvwxz|~~~}|{zzzyyyyyxwvussrrsstsrponmmmnnnnmmlllllllkkkkkllmmnnnnnoopppoooopqsuvwxyyz{{{{{zzyyz{|}~~~~~~~}}}}|{zzzz{{{||}}~~~~~~~~~}}|{zywutsstuvwwwwwwwwxxyyyyyyyyyzz{{{|||}~~}~~~|{ywvuttttsssrrrrrrrrrrrrqpppppqqrrsstttssrqpponlkjihggffffeeedccba``___^^^]]\\[[ZZYXWWVVVVVWXXYYXWWVVVWWYZ[]_abddeeeeeffghikllmmmmlllllllllllkjihgghhiiihgecba```````_____^^]\\[[\\\\\[[ZZZZ[\\\\\\\\]]]^^^^^]]]\\\\]^^^__^^]]]\\\\[ZYXXWWVVVUUUTTTSSRRQQPPONNNNNNNNMMMMNOOPPPQQQQPPPOONNNNNNMMMLLMNOPQQRRRQQQQRRSTTUVWXYYZZZ[[[[[\\\]]]]^^^^^^^^^^_`abccddeddddddefghjjkkkkkkkkkkkkkkkllllmmnopqrssssttuuvwwxxyyz{|}}~~}|{zyyxwvtsrponmmmmmmmllkjjihhgggfeedcbaa`_^^]\[[[[[ZZZYYYYYYYYYYXXWVUTTTSSSSSSSSSSSSSRRQQPPPONMLKJIGFEDCA@??>>>========<<;:99889999999999:;;;;;:864310//.-,+*)(''(()*))(&%#"!!  !!""!!! !!!""##$$######$$##""!  "#%'()*******++,./02333333333455677776666677899::9988889::;;;;;;;<<=>?@@ABCCDEFGHJKLMNOPQSTUWXYZZ[[[[[[[\]^_``aaabbcdefgijkllmmmnopqrsttuutttssstuwxz{||||||}}~~}{zzzz{{{{zxvtrpnmkjihgedb_][XVUSRQQQQQRRRRQPONMLLLKKKKKJJIIIHHGGGGGGGGFFFEEEEFFFEEDCB@?>==<<===<<;987655555667888776543222222233445677766544444556655443333345666543321111111100001111110/-,+********+++++++**)(('&&'()*+,,,,,,,,++*))(((((()))))))))))***++++++++++*****+++,,,,,,---../012333222100/.--,,,-./00111122223456789::;<<==>>>>>???>>>>>>>>>>>>>>>>>>??@AABBBBCCCCCDDEFGGHHIIIIIIJJJKKLNOQRSTUVWWWVVVVWXZ\^_````aaabbccccccdefhjlmopqstuvvvwwwwxxyyzzzyxxwxxy{}~}|{{{{||}~~~~}|zyxwwxxyzzyyxxwwxxz{}}|zyyyyyyzz{{{||}}~~~~}}|{{{{{{|||}}}~~~~}}||{{{{||}~~~}||{{{{{{{{zyyyxxyyyxxwvvuuuuvvvuuuuttttttuuvvvwwwwwxxxyyzz{||}}}}||{zyyxxxxxyyzz{{{||}}~~}}}}}~~~~~~~~~}}|||{|||||{{zyxwuttssttuvvvvvvuuuuuuuuuuuuuttssssttuvvvutssrrrrrssttttttsttuuvvvutsrrrrrrrsssssssstuvvvwwwwwwxyz{{|}}~~~~~~~}}||||}~~~}||||||||||||||{{{zyyxwvtsrqppppqqqqqppppppppppppooppppppppoonnmmmllkkjjiiijjkllmllkjihhggghijjklmmlkkjihggfffgghijjkkkjiihgggggggffffffffgggfedca`______^^]\\\\]]^^^__``aa`````aabbccccccbbccdeffgggfffeeeddddccccccccccbbbbaa``_^^]]]\\\\]^_`abbccbbbbccdefgghiiiiiihhhgghhggffeeeffgggfeeddeffgggggffffgghhhggffeddcccccddfghijjjjjjiijjjjjiihgffffgghhggffffgghhiiiiiiiiiijjklmoppqqqqqpooopqrrsttttuuvvwxxyyyyyyyyyyyyyyyyxwvuutttuvwxyz{||}~~~~}}}||||||{{{{{{{{{zzzyyyzz{||||{zyxwwvuuuttttsstttuuuttssrqqqrsstuuuuuuuuuutttssrrqqpppoooooonnmmlllklllllkkjjiihhgggggghhhhhgffffffffffeeddcbbaaa``_^]]\\\\\]]]]\\\\\\\]]^^^]\[[ZZZ[[\]^_`aaaaa````_____^^]]]]]\\\[ZYXWWVVVUUUVUUUTTSSSRRRSSSSTTTTTTTUUUUVVVVWWWWWWWXXYYYZZYYXWWVUUTSSSRSSTTUUUUVVVWWXYZZZYXWVVUUUVVWWWWVVVVUUUUUUVVWWXXXXYYYZ[\^_abcdeeffgghhhhhhiiklmnppqrrsssssttttttttttuuvwxyyyyxxxwwvvvvvvvvwxxyyyyyxxwvvvvvwwwwxxxxxwwvuttttuvwwxxyyyyz{|}}~~~}}||{{{zzzzzzzzyyxxwwwxxyyyyxxwwwwwwwwxxyyzz{{{{{||}~~}|{{zyxwvuttssssttttttsssrrqqqqqqppppoooppqqrrqqpoonnnooooonnmmmllllkkkjjjiihhgffedcbaa``_________^]\ZXWUTTTTTTTTTTUUUUUUUTTTSSTTUUVWXXYYYYXXWWWWWWWVVVVUUTTSSSRRQQQQPPQQQQQQQQPOONNNNOOOPPPPPOOOOOPPQQRRRRRRRRSSSSSRRSSSTTUUUTTSSSSSTTUVVVVWWVVVUUTTTTUUUVVWWWWWWWVVVUUTTTTTTUUVVUUTTTSSSSSTTSSSSRRRRRSSSTTSSSRRRRRRRRSSSSSRRRRRRSTTUVVWXXXXXXWWVVVWWXYZ[]]^_``````___``abbcdeffffeeddefghjkllmmmnnnnnmmlllklllmnopqrrrrrrrrrrsstuvvvvwwxyz{|~~}|{{{{|}~~~}}}}}}}}}}}||||{{{{{||||||{{zzyyyyyyyyyyyzz{{{||{{{z{{{|}~~~~}}|{{zzyyyyyyyyyyyxxxxwwwwwvvuutsrqpoonnmllkkkkllmmmmmllkjihhhhhhhhhhiiiiiiiiihhggffffghijkllllkjjihhgggghhhhhhhhhhijjkllllllmmnoopppppqrstuwwxxxxxxxxyyzz{|||||{zyxwwvvvvvwwxxxxxxwwwwwxxxyzz{|}}~~~~~}}}~~~~}|{{zzzzyyxxxxxxyz{|}~~~~~~}}~~~~}}}}}}}}}}}||{{{{{{||||}}}~~~~~~~~~~~~~~~}}~~~}}}||||{{{{zyyxwvvvvwwwxxwwwwwwwwwwvutssrqppooooonnnmmmnnoppppppoooppqrstttssrqqppqqqrrrrrrrrrrrrsssttttttuvvvwvvuuttttuuvvwwwwwwvvuutuuvwxyyyyyxxwwwvvvvwwwwwwwwvvvvvvvvvuusrqpooooppqrrssssssssstttuttttttttttssrrrrsstttttttttsssssttttttttttuuuttsrqpoooopqrstttttsssrrrqqqqpppppppqrrstuuutsrponnmmnnnnnnnnnooopqqrrrrrrqqqqqqqqqrrrssttttttssssssssrrrrrrssssrrqqqppppppqqqqqqppqqqrrrsssttuuvvwwvvuutttttuuvvwwwwwxxyyzzzyyyyz{|~~~~}}}|||{{zyxwwwwwwwvvuuuuuuuuuuuuvwwxxyxxxxwwwwxxxxyyyyyzzzz{{{{{{zzyyyyz{|~~~}}|||{{{zzyyyyxxxwwvuuttssstttuuvwwxyzz{{zzyyyxxxyyz{||}}}}||{{{{{{{zzyxxxxxxyyzzzzzzzzzzzzz{{{{{{{{{{{|}~~~~~}||||}~~}|{{{|||}}}}}}|||{{{zzzyyzzz{{{zzyyxxxxyyyzz{||}}}}}||{zyxxxxxxxxxwwwwwxxyzzzzzzyzzzz{{{zzyyxxxxwwwwwvvvvvvvvvvuvvvvvuuutttssttuvvwwvutrqponnnnnnnnmmmmmllkkjiiiiiiiiiiiiiihhhhhgghhiijkkllmmmmmllkkkkkkkkkkllllkkkkkkkkkkkjjihggffeeeeddcbaa```aaaaaaaa````aabcccdddddeeeeeeeeeeeffeeeeeeffggggggffeeefghijjjjjiiiiiiihhhhhgghhhhhhhhhhhhhiiiijkllmnnnnmmmllkkjjjkkllllmmmmmnnnnnnnnnnnnnmmnnnnoooooppppooonmllkkjjjiiiijjkllmmmmnnnooppppoonmmmmmnopqrrsstsssrrrssttuuuuuuttsssssssrrrrrrrsssssrrqpppppppppqqqqqqppoooonnnnmllkjjiihhhhhhggggggfffffgggffeedddddeefffggghhiiiiiihhgggfggghiijjjjjjjjkkkllmmnnnoooonnnnmmmmmnnnnnooooooooooooooooooppqqrsstuuvvvvwwwwwwxxxxyyyyyyyyzz{{|}}~~~}}|||}}~}|{zzzz{{||||||{{{{{{{{zzzzzzzyyxwvvuuvvvuutssrrrssstuvvwwxwwvutssrrqqqqqqrrrssrrrqqqqpppppppppoonnnnnopppqqpppppppppqqrrsssssrrssstttsssssttuuuuutttuuvwxyyzzzzzzzzzz{{{zzzyyyyyyyyyyyyyyyyyyyyyyyyyzz{{|}}}~~~~~}}|{{zyyxwwwvvvvvuuuuuuuvvvvvvuuuttssrqqqpppppoonnmlkkkkkkllmmmmmlllllmmmnnnnnnooooopppppqqrstuuvwwwwwvvvvuuuuuuuuutttssrrrrrssrrrrrqqpoonnnnoooppqqrrrrrqqqqqqqqrrsssstttttttttuuuvvwwwwwwwvvvvvvvvuuttssrqqppooooooonmmlllllllmmmmmmmmmmmmmmmmmnnooppqqqpppppppqqqqqpoonnmnnnoooooonnnmmmmmnnnnnmmmmlllkkkkkkjjjihhhgggfffffghhijjjiihgffeefghijkkkkjjihgffffgghiiiijiiihgfedbaaaabcddeeeedcba_^^]]]]]]]]]\\[[ZZYXXWWVVVUUUUUUUUUUUUUUUUVVWXYYYZZYYXXWWWWWWWXXXXWWWXXYZZ[[\\[[[[ZZZZYYXXXXXXXXWWWWWWVVVUTSSRQQQQRRSSTTTTTTTTUUUUUUUUVVVWWXXXXXXXXXYZ[\]^^^^^^^^^^^^^____```aabbbccccccddddefghijkllllllllllmmnoopppqqqqqqqrrrssssttuuvwwxxyyyyzz{{{|||{{{zzyxwvuuttttuuuuuuttttttttttttssssrrqqqppqqqqqppoooppqrssstssstttuvvwxyyyyyxxxxxyz{|}~~~}|{{zzzzzzzzzzyyxxwwvvuuttsssrrqqpppppppponmlkjjjkklllllkjjiiiiiiiiihhggfffffffgffffeedddcccbbbbbaaaaaaa``__]\\[ZZZZZZZ[[[[[[[ZZZYYYYYYYYYYYXWVUTTSSSTTUUUUUTSSRRQQRRSSTTUUUUUUVVVWWXXXYYZZ[[\\]]]\\[[ZZYYYYXXXWWVVVUUUUUUUUUTTSSRQQPOONNMMLLKKJJIIIHGGFEDDCCCCCCDDCCBBA@@?????@@@@@@@ABCCDDDDDCCCCDDEFGHIJJKKLLLLLLLKKKJJJJJKKLMNNOPPQQQRRRSSTTUUVVVWWXYZ[\]^_`abccdeeefffgghhhhiiihhhhhhhhhhhiiijjjjkkkkkllllllllllllllllllllllllllllllmnnoppqqqqqqqrrsttuuuvvvwwwwwwwwwwxxyyz{{{{{{{{{||}}~~~}|{{zyyxxyyyyyzzzzyyyyyxxxwvvutttssrrrqqppoonnmllkkkjjjiiihhhhhhgggfeedcccccccddccccccccccdddeeeffgghhiiiiiiiiiiijjjjjjjiiiiiijkllmmllkkjjjiiiiiiiiiiijkkllmmnnnnnnmmmmnnnoooooooppqqqrrsstttttsssssssttuuvvwwxxyzz{||}}}}}}}}}~~~}}|||||||}}}~~~~~~~}}|||}}~~~~~~~~~~~~~~~}}}}|||||||||||{zzyyxxwwwvvvuuuutttttuuvwwxxxxxxxxxxxxxwwwwxxxxxxxxxxxxxxxxxxxxwwwvvuuttssssssstsssrrrrrrrrrrrrrsssssssrrrrrrsssstttttttsstttuuuuuttsrrrrrsssssssrrrqqqqpppppoonnnmmmmllllkkkjjjjiiihhhggffeeddddeefffffffffeeeeeeeeeeeddccbbbbbbbaa`__^]]]]]]]]]]]]]]]]]]]]]]]]]\\[[ZZZZYYYYYYYYXXXXXWWWWWWXXXYYYYYXXXWWWWWWXXXYYZZ[\\\\\\\\\\]]]]^^^^^^^^^^^]]]]]]]]]^^^^_____^^^^^__``aabbbbaa``______````aabbbccccccdddddccdddeffgghhhiiiiiijjjjjiiiiiiiiiiiihhhhhhhhhhhhhhhhhiijjkkkjjiihhhggghhhijjkkkkkkklllmmnoprstuwxyz{||}}~~~~~}}|||||}}~~~~~~}}}}||||{{{zzzzzzzzzyyxxwwvvuttssrqqppoonnnnnnnoooooooooonnnmmmmnnoooppooonnnoopppppoooooooooonnnnnnnooppqqqqqqqqppppqqrrssttuuvwxxyzzzzzzzz{{{{{{{{{{{{zzzzzz{{{{{{{{{{{{{|||||}}}}}}}||||||||||}}}}}}~~~~~~~~~~~~~~~}}}||{{zzzzzzzzzzzzzzzzyyxwwvvvvvvvvvvuuuuuuuuuuttttsssssssstttttttttssssssstttuuuuuuuuuuuuuuuttssrqpoonnnnnnnmmmllkkjjihggfffffffffeeeffffffeeeeeeeeeeeeeeddddddddeeeeeeeeeeeeeefffffeedccbbbbbaa``___^^^^^^^]]]]\\\\\[[[ZZYXXWWVVVVVVVVUUUTTTTTSSSSRRRRRRRRRRRQQQQQQQQQQQQPPOOONNNMMLLLLLLLLLKKKKKKKKKKJJJIIIIIIIIIHHGFFEEEEEEEEEEDDDCCCCCCCDDDDDDDDDDDDDDDDDDDEEEFFFGGGHHHIIIJJJJJJJJJJKKLLLMMMMMNNNOPPQQQRRRRRRRRRSSSSTUUVWWWWWWWXXYZ[[\\\\\]]^_`abcdefghhijkllmnoppqrrstuvvwxyzz{{{{{{{{{||}~~}|{zyxwwvutrqonmlkjihgfeddcbaa`_^^]\\[ZYWVUTSSRRRRRRQPONMLKKJJIIIHHHGGFFEDCBBA@??>>===<<;;:9987666655554332211000000////......--------,,,,,,+++**)))((((((((((''''&%%$$##"!! !!!!!"""!!!!  !""##########$$%%&''((())))****++,,,---...///////00011222223334444444455567899:;;;;;;;<<==>>>???@AABBCDDDEEEFFGHIIJJKKKLLMNNOQRSTUVVWXXYZ[\\]^__`abbcddeeefffgghhiijjkkllmnopqrstuvvwwwwxxxyyz{{|}~~~~}}}}~~~~~}}}}||||{{{{{{{||||||||{{{{{{{{|||||||}}}~~~~~~~~}}||{zyyyxxxxxwwwwvvvvvvvuutttssstttttssrrrrqqqqqpppppppppppppooooonnnnnmmllkkkkjjjjjiiihhggfeeeeeedddcccccccbbbaaaaaabbbcccccbba```````````````______^^^^^]]]^^^^^^^^]]]\\\[[ZZZYYYYYYYYYYZYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZ[[[[\\[[[[[[[[[[[[ZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYZZZZZZZZYYYXXWWWWWWWWWWVVVUUTTTTTSSSSRRQQQQQQQQQQQQQRRRRRRSSSSTTTTTTTSSTTTTUUUUUUUUUUUUUVVWWXXYYYZZ[[\\]^^^____`````aabbbbccccddeeffghhiiijjkkllmmmnnooooooooooopppqrrssttuvvwwxxxxxxxxxyyzz{{|||||}}}~~~~~~}}||{{zzyyyyyyxxxxwwvvuuttsssssssrrrrrrqqqqqqqqqqqqqqqqqppoonnmmmlllllkllllllkkkjjiiiihhhhggffeedccbbbaaa``__^^^]]]\\[[ZZZZZZ[[[[ZZZZYYYYXYYYZZZ[[[\\\\\\\\\\\\\\[[[[[[[[[[[[[[[[[[\\\]]]^^^^^^^^^^^^^^____________```aabbbbbbccddeffffgggghhhiiiiiiijjjjkkkkkkkkkjjkkkklllkkkkjjjjjjjjjkkkkjjkkkkklllkkklllmmmmmmmmnnnnnooooooooooooooooooooooooooooonnnnnnnnnnnnooooooppppppqqqqrrrssssstttttttttttttuuuuuuuuvvvvvvvvwwwxxyyyyyyzzzzzzzz{{{||}~~~}}|||||{{{zzzyyyyyyzzzzzzzyyyyxxxxxxxxxxxxxxxwwvvuutttttssssssssrrrrrqqqppooooonnnnnnnnnmmmmmlllmmlllllkkkjjjjiiihhggffeeeeeeeeddcccbbbbaa``__^^^^]]]]]]]]\\\]]]]]]]\\\\\[[[[[ZZZ[[[[[\\[[[[ZZZZZZZ[[[[[ZZZZZZZ[[[\\\\\\\\\]]^^^____````aaabbbbbbbbbbbbbbaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbcccddddddeeffffffffffggggggggghhhhiiijjjjjjkkllmmmmnnnnoooooooopppqqrrssttttttttuuuuvvvwwwwxxyzz{{||||}}}}~~~~~~~~~}}}||||||{{{{zzzyxxxwwvvvuuuuttttttttttttssssrrqqqppooonnnnnnnnnnnnmmmmllllkkkkklkkkkkjjjjjjkkkkkkjjjjiiihhhgghhhhhhhhgggffeeeeeeeddddddcccdddddeeeeeddddddddddddddddeeeeeeeeeedddddddddddccccbbbbbbbaaaaaa```aaaaaaaaaa``````````aaabbbbbbaaaaaaaaaaabbbbbbbbbbbbbaaaa``````````````_______^^^]]]]]]]]]]]]]]]^^^^__^^^^]]]]]\\\\\\\]]]]]]^^^^^^^^^^^_____````aaaaaaaaabbbbccddeeffffggggggggggggggghhhhhggghhhiiijjkkkkkklllllmmnnnnnnnoooppqqqrrssttuvwwxxxyyyyyyyzzzzz{{{{{|||}}}}}}~~~~~~~}}|||{{{{{{{zzzzyyyyxxxxxxwwwwwwwwwwwwwwwvvvvvvuuutttsssrrrqqqpppooonnnnmmmmllllkkkkkkkjjjjjjjjjjjjjjiiiijjjiiiiiiiiiiiiiiiiihhhhhhhhhhhhggggffffeeedddcccbbbbaa``__^^]]]\\\[[[ZZZZYYYYYYYYXXXXXXXXWWWWWWVVVVUUTTTSSRRRRRRRRQQQQQQQQQQQQQQQQQQQQQQQQQQQRRRRRRSSSSSSSSSSSSTTTTTTTTTTTUUUVVWWXXXXXYYYYYYYZZZZYYYYYZZZZ[[[[[[[[[[\\\\\\\\\\]]]]]]]]]^^_______________```aaabbbccdddddeeeefffgggggghhhhhiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhiijjkkklllllllmmmmnnooppqqrrssstttuuvvwwwxxxxyyyyyzzz{{||}}~~~~~~~~}}}||{{{zzyyxxwwvvuuttsssrrrrrrqqqqqqqqqqqqqqqqqqqppppppoooooooonnnnnnmmmmlllkkkkkjjjjjiiihhggfffeeeeeeeddccbba```___^^^^]]]]]]]]]]\\\\\\\\\\\\\[[[[[[[[[[[ZZYYXXWWWWWWWVVVVVVVVUUUUUUUUUUTTTTSSSSSSRRRRRRRRRRRRRQQQQQPPPPPPPPPPPPPOOOOOONNNNMMMMMMMMMMLLLKKKKKKKKKKKKKJJJJJJJKKKKLLLLLLMMMMMMMMMMMMNNNOOOOPPPPPPOOPPPPPQQQPPPPPPPPPPPPPPPQQQRRSSSSSSSSSSSSTTTTUUVVWWXXYYYYYZZZZZZZ[[[[[\\\\]]]^^^^^^^^^^^_________```````````aabbbccdddddddddddeeeeeeffffggghhhiiijjjkkklllmmmnnnnooppqqrrsssttttttttuuuvvvwwwwwwxxxyyyzzz{{{||||}}}~~~~~~~~~~}}}}}||||{{{{{{zzzzzzyyyyyyxxxxxxxxxxxxxxxxxxxwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxxxwwwwwwwwwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvvvwwwwwwxxxxyyyyyyyyyyyyyyyyyyyzzzzzz{{{{{{{{{||||}}}}~~~~~~~~~~}}}|||{{{{{{{{{zzzzyyyxxxxwwwwwwwwvvvuuuuuuuuuuuuutttssrrrrrrqqqqppppppppppooonnnnnmmmmmmmmmmmmnnnoopppppppoooooooooooooooooonnnnnmmmmmlllllkkkkjjjiiiihhhggffeddccbbbbaaaa````____^^^^^^]]]]]]\\\\\\\\\[[[[[[[[[[[ZZZZZZZZZZ[[[[[[[ZZZZZZZ[[[\\\\\]]]]]]]]]]]^^^_____________________________^^^^^^^^^^^^^______________```aaabbbbbbbcccddddddeeeefffggggghhhhiiiijjjjjkkkkkkllllllllllmmmmnnnoopppqqqqrrrrrsssttuuuvvwxxyyzz{{||||}}}}}}~~~~~~~~}}}}}}}}}}|||||{{{{{{{zzzzzzyyyyyyxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyyxxxxxxyxxxxxxxxxxxxxxxxxxwwwwwwwwwwwwwwwxxxxxxxxxxyyyyzzzzzzzz{{{{{{{{{zzzzzzzzzzzzzz{{{{{{||||||||}}}}}~~~~~~~~~~~~~}}}||||{{{zzzzzzzzz{{{{{{{{{{{{{||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzyyyxxxxxxxxxxxwwwwwwwvvvvvvvvvvvvvvvuuvvvvvvwwwwwwwwwwxxxwwwwwwwwwwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvwwvvvvvuuuttttssssrrrqqqqqqppppoooooooooonnnnnnnnnnnnnnnnnnnmmmmnnnnnmmmmmmmmmmlllllllllmmmmmmmlllllmmmmmmmmmmmmmmmmmmmmmmnnnnnoooooooooopppppoooooooooppooooooooooooooooopppppppppppppppppoooonnnmmmmmlllllllllmmmmmmmmmmmmmmnnnnnnnnnnnooppqqqrrrssttuuuvvwwwwxxxxxxxxxyyzzz{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzyyyzzzzzzzz{{{{||||||||||||{{{{{{{{{||}}}~~~~~~~}}}||||||{{{{zzyyxxxxwwwvvvuuutttttsssssrrrrrqqqqqqpppppoooonnnnnmmmmmllllllllllllkkkkkkkkkkjjjjjjiiiihhhhhhhhggggggggfffeeeeddddddccccccbbbbbbbbbbbbbbbbbccccccbbbbbbbbbbaaaaaaaaa`````````````````aaabbbbccccdddddeeeeeeeeeeeeeeeeeeeeeeeeeffffffffffffffffffffffffffggggfffffffggggghhhhiiiiiiijjjjjkkkkllllmmmmmmmmmmmmmnnnnnnnnnoooooppppppppppqqqrrrrsssssttuuvvvwwwwxxxxxyyyyyyzzz{{{{{{{{{{{|||||}}}~~~~~~~~~~}}}}}}}}||||{{{{{{{{{zzzzyyyyyxxxxxwwwwwwwwvvvvuuuuttttsssrrrqqqqqqqqqqqqqqqqqqqppppppppppppppppoooonnnnnnnnnmmmmmmmlllkkkkkjjjjjiiiiiiihhhhhhggggggggggggggggffffffffffffffffffffffffffffffffffffffffffffgggggghhhhhhhhhhhhhhhhhhhhgggggggggggggghhhhhhhhhhhhiiiiiijjjjjjjkkkkkllllmmmmmmmnnnnooooppppqqqqqrrrrsssttuuuvvvvvvwwwwwwwxxxxyyyzz{{{||}}}~~~~~~~~}}}}}}}}}}}||||||||||||{{{zzzzzyyyyyxxxwwvvuuttssrrqqqqqqqpppoonnnmmmlllkkkjjjiiiiiiiihhhhggggggffffffeeeddddddcccccccbbbbbbbbbbbbbbaaaaaaa``````___^^^^^^^^]]]\\\\\\\]]]]]]]]]]]]]]]]]]]]]]]]]]\\\\\\\\\\\\\\\\\[[[[[[ZZZZZZYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZ[[[[[[\\\[[[[[[ZZZZZZZZZZZZZYYYYYXXXXXWWWWWWWVVVVVUUUUUUUUUUUUUUTTTTTTTTUUUUUUUUUUUTTTTTTTTTTTTTTTUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVWWWWWWWWWWWXXXXXXXXXXXXXXXXXYYYYZZZ[[[\\\\]]]^^^^___```aaaaaaaabbbbbccccccddddddeeeeeeffffffgggggghhhhhhiiiiiiiiiiiijjjjjkkkkkllmmmnnnnnnnoooopppqqqqqppppppqqqqqqqqqqqqrrrrrrrrrrrsssssstttttttttttttuuuuuvvvvvvwwwwwwwxxxxxyyyzzzz{{{{{{{{{{{{{|||||||||||||||}}}}}}~~~~~~~~~~~~}}}}||||{{{{zzzzyyyyyyxxxwwwvvvvuuutttsssrrrrqqqppppooonnnnmmmmmlllllkkkjjjiiiihhhhggggffffffffffffffffffffeeeeeeeeeeeeeeeeddddddddddcccccccbbbbbbbbbbaaaaaaaaa`````````````____________``______________^^^^^^^^^]]]]]]]]]\\\\\[[[[[[[[ZZZZZYYYYYYYYYYYYYYYYYYYYYZZZZZ[[[[[[[[[[[\\\\\\\]]]]]]]]]^^^^^^^^^^^^^^_________________`````aaaaaaaaaa````````aaaaaaaaaabbbbbcccccddddddddddeeeffffgggggghhhhiiiiijjjjjjkkkkkklllllmmmmmmnnnnnooooppppqqqrrrssssttttuuuvvvwwxxxyyyzzzzzz{{{{||||}}}}}}~~~~~~~}}}}|||{{{zzzzzzyyyyyyxxxxwwwwwvvvvuuuuuttttttssssssrrrqqqpppppooooonnnnmmmmlllllllkkkkkkkkjjjjjjjiiiiiiihhhhhhhhggggggggfffffeeeeeeeeeeeeeeddddddddeeeeeeeeeffeeeeeeeeeeeeeeeeeeeeeeeeeeffffffffffffffffffffffffffffffffffffffeeeffffffffffffffgggghhhhhhiiiiiiiiiiiiijjjjjjjkkkkkkkkllllllllllllmmmmmmnnnnnnnnnoooooooooooooooooooopppppppppppppppppppppppqqqqqrrrrrrsssssssstttttttttuuuuuvvvvwwwwxxxxxxxxxyyyyyyzzzzzzzz{{{{{{{{{|||||}}}}}}}~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}||||||||{{{{{{{{{{{zzzzyyyyyxxxxxxxwwwwvvvvvvuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuutttttttttsssssrrrrrrrrrrrrrrqqqqqqqqqqqqppppooonnnnnmmmmlllllkkkkkkkkkkkklllllllllllllllllllllllllkkkkkkkkkkkjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkkkkkkkkkklllllllllllllllllllllllllllllkkkkkkllllllllllllmmmmmmmmmmmmmmmlmmmmmmmmmmmmmmmmmmmnnnnnnnnnooooooopppppqqqqrrrrrrrsssssstttttttttuuuuuuuvvvvuuuuuvvvvvvvvvvvwwwwwwwwwwxxxxyyyyyyyyyyzzzz{{{{{{||||||||||||||}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}||||||||||||||||||||||||}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}~~~~~~~~~~~~~~}~}~}}}}}}}}}}}}}}}}}}}}}}}}}|||||{{{{{{{zzzzzzzzzyyyyyyyxxxyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyxxxxxxxxxxxwxwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{||||||||||||{{{{{{{{{{{{{{{||||||}}}}}}}}}}}}~~~~~~~~~~~~~~~~}}}}}}}||||||||||{{{{{{{zzzzzyyyyxxxxwwwwwwvvvvvvvvuuuuuuuuuuuuuttttttttttttssssssstttttttttttttttssssssssssssssssssrrrrrrrqqqqqqqqqqppppppppppoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooonnnnnnnnnnnnnnnooooooooppppppppqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrrrrrrrqqqrrrrrrrsssssssssstttttttttuuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvwwwwwwwwwxxxxxxxxyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{|||||||}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}||||||||||||{{{{{{zzzzzzzzzzzzzzyyyyyxxxxxxxxwwwwwwwvvvvvvvuuuuuuuuuutttttttttttttttssssssrrrrrrqqqqqpppppoooooooooonnnnnnnnnnnnnnmmmmmmmmmmmmmmmmmmmnnnnnnnnmmmmmmmmmmmmmmmmmmmllllllllmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmnnnnnnnnnnnnnnoooooooooopppppppqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrsssssstttttuuuuuuvvvvvvwwwwwwwwxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyzzzzzzzzzzzzz{{{{{{{{{{{{||||||}}}}}}~~~~~~~~~~}}}}|||||||{{{{zzzzzyyyyyyyyyyxxxxxxxxxxxxwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvuuuuuuuuuuuuuuuttttttttttssssssssssssrrrrrrrrrrrrqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrssssssssssssssssssssttttttttttsssssssssssssssssssrrrrrrrrrrrrrrrqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrssssssssstttttttttttuuuuuuuuuvvvvvvvvvvvvvwwwwwwwwwwwwxxxxxxxxxxxyyyyyyyzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{||||||||||}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}||||||||||{{{{{{{{{{zzzzzzzyyyyxxxxxwwwwwwwvvvvvvuuuuuuutttttttsssssrrrrrrqqqqqqpppppppoooooooonnnnnnnnnnnnmmmmmmmmmmmmlllllllllkkkkkkkkkkkjjjjjjjjjjiiiiiiiihhhhhhhggggggggggggggggggggggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiijjjjjjkkkkkkkklllllllmmmmmmmnnnnnnnnnooooooooppppppppppppppppppqqqqqqqqqqqqqqqqrrrrrrrrrrsssssssssssttttuuuuuuvvvvwwwwwxxxxxyyyyyzzzzz{{{{{{|||||||}}}}~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~}}}}}}}}}}}}}}}||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|||||{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}||||||||||||{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzyyyyyyyyyyxxxxxxxxxxwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvuuuuuuuuuuuuuuuuutttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttuuuuuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvwwwwwwwwwwwwwwxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}||||||||{{{{{{{zzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyxxxxxxxxxxxxxwwwwwwwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{|||||||}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~}}}}}}}}|||||||||{{{{{{{{{{{{{zzzzzzzzzzzyyyyyyyyyyxxxxxxxxxxwwwwwwwwwwwwwwwwvvvvvvvvvvvvvvvvvvvvvvvvvvvvuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwxxxxxxxxxxxyyyyyyyyyzzzzzzzzz{{{{{{{{{{{{{{||||||||||||||||}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{|||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{||||||||||||}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{z{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{|||||||||||||||}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{z{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}|||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyxyyyyxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||||||||||||{|{{{{{{{{{{{{{{{{{{{{{{{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}|}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}|||||||||||||||||||||||||||||||||||||||||||||||||||{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|{||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}vor-0.5.5/data/rock49.png0000644000175100017510000000367611310013353015661 0ustar jasonwoofjasonwoofPNG  IHDR# /VgAMA7tRNSncIDATHW[G N\ #I DB@ф$j)wS\-qc'=:}sgܙ]BB.c#SE'-1V؞egҵb7&McaVJldˆo=^ڛp2ۡ}7H9bQzRJ&Y-N.EEd;^lM=Zx:?}s٘6U**Jқx7wm-5Ҝ[CU+=ٟn8~iҀy{]kN`;|zL}?U2!& 9hN0\CEdiIq'FБ3ʒM&&vo{@l_2:=wRK$7-$$ HH sVN%9+^^qJ)DrY"(Nr en^D1$#*t٢5  Ze$5@iJ'Xwt;G9l[ATǠBl2 R 2%ٹip'\SA؉Q Qڙy+ŋtaubmf ,Av(2 9bxk1暀XJ  g8888P09"`{H[#JMq$5X@H|4;*Snwd&s~a w(pW( B\]\Q>CVpxZo?s֯>5 ݅<mq@#M`E'gM*ibߴ'2:*٤G\9(wA:v^VWB)/'Stn _&`sIPO-2P4\1|zAf !w^BΆs0@%̔Aya&^] vj0 K\:p@Ĝqʋ4MF\TuRB{럭`]9IENDB`vor-0.5.5/data/mph.xm0000644000175100017510000001707411310013233015164 0ustar jasonwoofjasonwoofExtended Module: VoR ThemeMilkyTracker   } _1Paa0Pa< a*Pa6 a%Paa1 *Paa6 )@aa5*Paa6 .@aa:,Paa8 ,@aa-@.Paa/P0@aa3@ 1Paa= 0@aa<1Paa= 5@aaA2Paa> 3@aa?8PaaD 7@aa8P:PaaD 6@aaB3Paa? 0@aa<,PaP(a+@P8,@aP(a-@P(.PaP8a/PN80@aM(a3@K( 1PaUa= 0@aa<1PaRa= ,@aa8*PaY#a6 )@aa5%PaTa1 %@aa1*PaIa6 )@aDa5N*PaKa6 .@aAaFa:Aa,Paa8 D,@aDa-@D.PaDa/P0@aIa3@H1PaIa= 0@aa<M3PaKa? ,@aHHՀa8H*PaIa6 )@aFa5%Paa1 B%@a?a1I*PaHa6 )@aDa5*Paa6 I.@aIa,Ha ,PIa ,@Pa5,PaPa6 .@aPa:,PaPa8 N,@aMPa-@KN.PaIMa/PPK0@aNIa3@MP '1Paa I0a= K00@aII0a<I B01Paa B0a= IB0,@aI D0a8IB0*PaI A0a6 I ?0)@aI(=0a5I :0%PaI(80a1 I80%@aI80a1I(60*PaI 50a6 I 30)@aI(10a5I*PaIa6 I .@aI(a:I ,PaIa8 I(,@aIa-@I.PaI(a/PI(0@aIa3@I 1Paa Ua= 0@aI a<I01Paa Ua= I ,@aI0Ta8K *PaM Ra6 K0)@aI Pa5K %PaM Ma1 K(%@aI0a1K0*PaM0a6 P0)@aPEa5P+*PaP@a6 N0.@aM(a:K ,PaP0a8 P@,@aPEa-@P+.PaP@a/PN00@aM a3@K 1Paa0a= 00@aI*a<I01Paa0a= I*,@aI0a8K**PaM0a6 K0)@aI8a5K0%PaM8a1 K(%@aI(a1K8*PaM0a6 P0)@aP8a5P(*PaP(a6 N0.@aM8a:K0,PaP(a8 P8,@aP(a-@P(.PaP8a/PN80@aM(a3@K( x1Paa Ua= a0@aI a<I01Paa Ta= a0@aI a<I01Paa a= 0@aa Ua< a1PaI Ua=a01Pa a1Pa1Paaa 1Paa Ua= 0@aIa<I 1Paa a= I,@aI a8I*PaI Ia6 I )@aI(a5I %PaI(a1 I%@aIa1I(*PaI Pa6 I )@aI(a5I*PaIa6 I .@aI(a:I ,PaIMa8 I(,@aIa-@I.PaI(a/PI(0@aIa3@I IMPS(>&tfh 2q]\M?q^MjE:/o[/' iD8.o\KhC8-mYt~iVszd r&QC7|gT%fTExb:0' OA5zeR#mr^^N@r]2*"s_NkG;0p\\L>p[0( ikYI?5+t)"{eiWG ~hUr' pxdR6-%u_n K>3vbPJ>2`OAs^4+#_O@in\K-%XIjp]LZJ=.&YJ<hC7-lX{e=3*hWGsRD8}hUr& yc ;1(fUE|fTq%PB6{fSp$wa_OAs^3+#t`Ols`Nq]2)"q\1)!r^MjF:/~gkXkW|f|eTE9iVsSE8hVF }gToL?4wcQ aPBt_5,$`PAt^m J=2uaOI=1_N@r]nZ-&n[KhB7-m[JlYWH;lX둞tRNS@fIDAT(c`@]> @E'#涅EٖJ6lYJ*|5DpPAGUIkÜi [qmܻ%R~Ie3 g@(T՞npn]u8<9(Ud [#w:91080yBC鵥7^WP:kn@5+BG0```ST;~&كSU7+?_]b+הWK0Yy}'*+N\i9a=v˝[s(\OM_e#o̊5ʋT5gmvỚȷM/?nJIYf,kKvOZ?ֽM6Kkv1hlֹaꪢ'w$aYU[@IM&몹t[͂.`𬯸tn"}Yt{ECoriG&Ċyfs/rx"Eny i]ȑ;e~}Rށж3j|IENDB`vor-0.5.5/data/rock34.png0000644000175100017510000000266211310013351015643 0ustar jasonwoofjasonwoofPNG  IHDRgAMA7PLTE+$lYI}f@5+kYHUF9 {fTqOB6wb9/'dSDwa N@5ydRo"M@4xdQ7-%bQBu_6-$wbP \M?kq^Mjo[/' ZK=oZiD8.o\KhmY-%B6,tSE9~iV'!hVGzd<2)gVFQC7|gT%PC6;0(xb:0'eTDzeRmtaOr^r]s_NkG;0r_M\L>p[E9.@5,kYI}fjWt)"TF9{e>3*iWG{d=3)~hU' RD7<1( !u`u_n K>3vbPm`OAs^4+#_O@lI<1t`No[in\KXIjE9/p]LiD9.nZ.&YJ<hC7-g{ehWGs}hUr& gUFyc ;1(fUEq%PB6{fS$wadSC_OAs^t`Ols`N2)"]M?q\j0' ~gkX*#UG:|f?4+jXH|e >4*iVs(!SE8zd=2)hVFzc&vabRCoL?4wcQnaPBt_5,$`PAt^m J=2uaOlI=1r]^N?nZ-&n[KhB7-lYWH;lXitRNS@fIDAT(c`@ XA^ r}%,\h܃-ۑe6ο$Na{/$ߌ0WsCI\SEϤ LJ `PW"%Y) s2OkfE2${o{a.9v^e$U[ͬ-",Ȣw;W-᪞Y"gLvjsPjmPz!MKLeg]a$UuuSm%PF+s30,q{ On)O530);8i.ruւԾ vy+YRq[5sp1QS-*4m!'6pւ@p{%v?D)x 2ធ :}g7GB*\+Vl*znp{q*lوL}VLFKęjcA:)y,0MXX\!#EWnWJChˬ|Sq5  wa=%F0A?D|U&P(%^1.x7&S0z7l09#Z7xצV/ʼn3v("Al_$p7uL,"+T=ҘȖCT {=Me^YqI!nY=eȧ(>5!+I cw篔cŔ6p`•e8pih&6H61oh!Fi]F(P]~'y>.arcp,7P*}qM]Dǔ)1c>*M̞h89 \ .D0k1D"fjs(/#8Whö%hۏ۶_g*Lwhv#-۱l᢭ɭ*ae~W|H+O bGLvV+g;v1I_}j_d3-sa:E{i)ͫjfB\MeАcfܗ97 9cyVG&߬z"LC>0E:2ha^*aن|;<9am# lP}?DY"\nED$lo*$4QcjO S}`` w.OݝLelb<@Qv=dRS# PP ƚpHw>YU{|+)7rrKжcA˪" edkK @S{ L|b)}l{ #9/V.~K95P|]Gǀ,4B~r^DйP [}h}g_a%9mH=v[NlpOW2ZcmK5٢fݝ"(^eũYE&c0.,7jY*%)5.5MI]2B~dU4z-+JJvC d%p oiG/{Ai͟i=|5Ve:р&vm"sz.euL )No Y fڈ䚜iBl)?dg{ᴮ&B34KV80 2qoJy<^1?5$4zrIӿ^7w=!$*>F>1\;{]X&a|ӔoوStC&FGIENDB`vor-0.5.5/data/font.png0000644000175100017510000010710311310013345015503 0ustar jasonwoofjasonwoofPNG  IHDR OSgAMA7tRNSn IDATxwxUױ E$ QDfz] I z *@ ޫ NI)7'&ww}y?g>yΣGk=kw֚5D_:ɶm>Y4Q5ї0/-<4O+uڻysC2ys_gخ]];'zl[o߹}Nǧ3RV+󛨉NHK۶|<18{bdhzK~+wR ~~\ p^° ;v6kc{: _ڵ=((Ddkʴux"$b#Fƥ>dOoόT''HHǎ]KΘh 2T b^}6:}=}Skǎ Gqy 1>6}{5N5 ࢇh}9HBŏ=&j&j6z@A=GEm?S@@7ګ͛+OlݺG˖e.\ܩSw9"#,I0ae߄\4X iРfͼ}#N֭#SxERyfu6s+sGEY&rӐ!"#Ȥe!|2|Ծ}G:8o3bbb%$Tlt .n958V%9UIIU6Y0ɩH6ؘY`;w'&+emNRْtp}|x74tMjU~FQR&$cM0OMyO3c֭+?6_}޼~3Eݻf7eKd'p} (((]N,>}"6\lm@]d[WlHn9s#ԩ-ZՠM&سglY< eٳjذ)f3W5 nqA.kSN@iiGC dXid;Gc9C398p##V]=ҎweAƯXrX ڵ%&L:fV-zjѪU{{$EΑFcQt_Q D:btLrib!P^{ĈiA0P}h3繘DX{+WcUANT}Yuj?Qçڱ(#WEFM*cX-HɫpU(v2z/PջP 14˗g3/?Pި3cmq+ēcZ紱爊osycla)=e2> MDMDM(xi⎱c;58@wٲ,,G> B*ĸBOz 9s=L '|cpaa ,V,]:3b i Ɏl7uj_`@@S7n 8uWkv%$dͻ_9qý{_!YG$9qՀ&MZ6= ۻe~l_޳畒WjUĉ :v FZ֭+E\Gȹs7<캥KӉmH[Uξ}Z?yJ_@>> ;?Ԝ9~ HJ3 қkז̙Ao''֭0bcw$'LO?~v=f9SOeg<{g<">~wj᜜qq/2d1\JJ:xqlAeE\ *ji GLٲe;y985:5mGD{d؄ fJeWT~k K'aӧ-# 7n/?`p`ӑ#a=fpYM"d  #0re 1صEJ$'@t$Lر.!@@X!C&\62Ȣmdwx%&gxIP\Y֖-W͕Pdj*;3=1\%X'I${!US+K5c>ڇk{7->#Br>iʕޠ{ lՇ[Zz_qE‹gtf6LXyAGoO^]}X=Qhx`64eʚvԏw|*%K x`Kmw ^Pi!BBlB
 rF֬)95"#MhlYVyݝ;[D() [u'xLQgL !ĶF$r  a}h%GynJ?6{-ף@h7I\*ٳ?<@ OPOIYMxt:tx?dF(.&9ʎ|** }R.m{ 8GxEɓW>|y6L=G|GD, dkǍ[O>wĆ &O@/<2gp7Q5Q5Qm[o&p̙]/Hǥܩؿ}xvZf'?dX0OCM11f̈v9&:?_ӧkј1sy+F`AFEm!p/a֭עKb%%7`(nx_&,l#;w޹Gh w+V0mނ!۫м37 EFz7m:Z"ߘ ޱcלSDGy͚"bB` BMputj֝Vοqg 4}z^K:˂M!2"d;N>>-WȾr/ݜŤ,Y>kV#GG~nG~^C߾'5}܍xAT ËX8mN{ÒcĀpfÆr-2x RWW3+ݾEReqFϬYqSFɃ-۶={?HK g-[5sz;: Xΰ8}xd$%d!7pi;wp$dfѢ䈈E3gpsdS?xAxo2Juu?ܲ*:tg@ŋf"ı;gUғc|<KZMxpMy{HKUZۋN滌;Сo꽒(>sFѦ 2Ν0~"Fwpmsz%'aii׮ ϱ3c#6j o0U֑`btօ7dGO|ڭ2%ª|˖+,<~{X̃jǒ%i{3Caf iFV5Q5Q=ƍ[@NGH"G<.СoxqAOP%&f,_}׾vQ\x{Ȋb#FL\JMtGƏ_TpVx$w];)DO"%ijwf75"e6jcZ&MReSalq;wg+GF\ӎjݽA5uj^QXxa߾Yi̴5ˠ'.7~>|GZ`!$KG::WYR`cРc6WԘ'>n"Ƒ*aLe[o۲pa2#zF&TW:UWݔ: i3fle6 ?@,$-vgY5kV,=;~ٲ,8'i8 b3K6jni¶hOw/^z6Yw͙^Z-ŴaVcŧK^_y\MHffٳ &MeV?ݺ%pݧ{'40>>pmwS ?@G*zO[O_7gNdː]gh|׷ ;oV֣MlRDĢ2DF~zS#/zWH JOUXhQq^\nJY- K< c\b gr9w .4i1,AEL0 ` F&E,̶a\.-z„e|FCYC|eXM32sOOe #n'LEϜ? Z]@JZF3L:-ImcN }Bbl$.wgwiǎT{u#`&ZZl> 7n- Ϊ$\En^|?II5ř3gu楤t799uGHH-\|4@i<Hq/y^xby„X0 (];x)^آ`z2d2 ^7BJrIǍ[{~I6I>Bs2(6b[֡5vذ)X& G^ʤX#@(Gv,"t9u4ɉ;uF=9+x8lumЂpj|%VO>1Q(88دZ8r@*ݹ󷄄}z{reƍ{/FԌX|ϴvyo^r鹴w~3 ֕<2m)%e]caԆ {x#{%%yܭqS))dIZ4f̼7zY\}3y`Oa</`Aa'N|c}GL\…f҂T0xMre5ڵ%rĞ,Ϙ|}[ßkqfH6~XF:yР3۷cE䛟_ c[t+ /; -V7a²%K ZNiЗ0}XQfΚ|y&q͚БqJ^9>esl ?v< z {-+߱c9sQ|$lv:8i |e\ŋS1  b~?i=0I;ۓ5VRGipӗ.w&R9gYqR) y:9#(*$dUPPC|q \5ѥ j[w\BYY;9Kkd٫!C&=Q&tɹ7nrY>9%{[Fw uu?t&o`ZcU>@&32;8v߱sn*[j`AO+E|ep< 6<|.P+=~]㑉_|x:ׄfͼq}@Z,;`;2 952Զ?B6\Nmi޽%IEX iɒ4@ Wn,(X̋WmG*nQZ=̆gw [O:u9) |$mYvRRorHق$gY2%a d6yatt)1V_F3`p/c|pRy{-+[ڸq~F$rY^rQ%`;W s=ÂZ@-[ E N}ܸkKI= a=}P+̗qȑo0V2iH_^XHGG{Q~T53C&xƍ{w\c3g1Ξ׽+ԚW9v']w f]~Nx8&O^laRx^RrK{&G6-} g)P&g0~hyzz7o^"Sf<=bQu;X ]='|j$2npC(%:;NOȰ6vTE60Q[3(u}…ii5CٛrvnTYMc yDM`{6iKˑy.xL6ɏ)i!ᔵ`UFiU,kfot<#hҥɇ ] A}cNAxLOf0^"w6;wa}?q%o` #ffD;PYs/ .h*mx{\<ӏ.X[F:ᗚYnHn v[^]@_i56y@60h,!3gAݸg;*ciujngRR/sɛsGh8eJvx n*8 (/&W.Z%OArUqBs5MialZZ-|PܿM?\IT"Άo^^ڹ Vcf?T2<͊Vڃ""nV)[4~<l&R/3/d6h&}΄7WإҒ ǘ0FK⠻te/JH7,uu7rR=:T k9I$Y\(aƍ_ƌ1ũZ9Z/Gv[N%DDYŴ!ܹ5qvr̘y;w>O%+ >L,-a&AA!RzL`os7l(h}Сo^&4͘{mnX1c}N_׋u_}ݺ5k;\xIt4`X" ]oWeԨY{kiӢ0qqA`pDAn*.\Ttُ-.^޽b-g!\⍳aV.Ы*zo/(/ƶY31-ª8Bw0;v ӶmH3fGn&ȉ֪Y$ ݱF|}2HkvV\<ݱhQS'du?xmր||Zu>yz{td@fߝ:mTG16W}blrYJ2~G 0, },V(Dq۶g2lKMzPS-׮4nQRr…_i~'F@'߼/`*&̵Ǻu%'B7*zņKZ9T2l 8ڙ =BBF2yպtq1`V'&șXg5nebRWz IMѨ`6֌=SF䎩%bT=0[\vO}޼c'=$}>BE+QKl*%o%Tzw]s#ر$F[ 丧5o߉c> !#"bUۣA$⥤I~0 ےqlŊl#iiG22][@.{]"b"CSzP58s&0=gX\Mr2VL0ڱyc Fà)8DŽQ'.(PY6k\g"88Tk{h"Cɚf| ̌dfAgX3gڵ}<>};2/<(3 ClСKPӥ3Km(cn~eexk tycmژ${ӿ]_e_[8hHA*9D1$d3UŪꌍ=8!ZY;B Oa^LSHKpU:u70bK6m-`M]K<~?I0gǃVo>d0̹Di͛vOV h2h'~m͕%vj풭${T v"C _Ppaǎ0sn.)܀ꪫYXxԞZ}QQs纎7250~ֽ*|yb/]͡C,S]Hjeɴ i[jI>cԨYZu0.c EZy 9pkx=;hPOx@<ݹ7el;fEڈEǯ\=cǚ$!MLN,Hb\pykiߐdgdLjsO]DŽ7n܇_׷5q/~(#$ Yb1D 3fSµ!3Eta0cHٳ?xCm{uG'/F33brMٙ [:ʔHS:(zXb NsÆ=]={^yiSmct"L6bh̘ ʵG.uOJxD"bܼH / >>ΤayI*2=NW4kG<9Rq?[i=-h/18Έ(:B͘Z.C!+ۣ0-%X*+{)! 36y1Cш7lNKC{Df{H٪6Z V@Ln @P̈vNCVk%$QL[3/fFƶ#< 9}%%׵ $Ԡw}~V'0d愷Al枩y%Lhe!3t2irN(EFc3R#iQČzWVĀ֭Mv[NL {'Xysw|6gȄ$$`hpf)<|XW28sȷ_?z^-ƈ~"zi=1;w>oKKo` h@/tĀD6a1::tj-j)_fpw< wX\;[Bmp ѣmvif{ >>ڃIݺ&$s~Сi, OFR]DNLq>ud ^8Nʅ:59cPR\K J΍h!&Gԑa2\͎䵙)8dGfAؙNYZv!dNl7/΁;Ҷ5W3CzjdolJz1G1.!z7:8ujsUZ^E!s{r->_l'!w<)Q0) $Iy f:5򋒭󲞺*!uuڜ.@UP ("z35r@{[\<s8]Gt6$d@~?eg8>;À 99cqa)i?wO /ip"@XνEFj9(|1/w<5KD{r/ʘ'J`\d][_Ƥ''W_Ç;KM Pwyd>Zhl'dӧl$gW>ÉBCG'W :렠9GXn›=ÌG†6UTMQ7ьQR e,Q$tԋD8 l!xO:%Wii5` ̻AD=Jyzhl,<$lgKx_Pbttvs paA,W(]1!ư{w &G_LT_]="]D8(23' HKW%$ٳ?y_wdP%,nZ8XmB9%Lԁ))%X,^r!t.Criv6eުz DYVI;vx=lPGgi G6u}|Z.\G?YڻMzW 0Сo|K\ŋ&Bh2ymaAڈ )c]^=GӀ@DRZVo`6  ѣߕl|OPNyg  N&#-)cX+m۶vG/%8Ӭ&_`^CrOmX G%^roǏ}[\!;vz{s~ 2xښ9Akk@hSA#G}O`DW_R"EZZ!wKu5B(]r\a)BPt~Ӛ[ۯـ!',~ h= Ca x55!=7bx3g~ gz<2]^4zzXV,Ύ56ɜO ET WTtifgyMHxO̜(8hEa;#` ~]z 3 ro{\OnS{j0UE@$Nd{`R^kXeM3a %{JŪp$#$ed++r|=DLlϞ+*^qTb8|pP7O| {,Ր >gNWHKJJ5oWO՞Ϙ 3 HT6׮ # |98֮-x8sJS4L{ZY//Zf $Q=]PmUv ̝|m,4G2p:X4Qo8x" f[.g۶<#3[,Rf|tmY11e;k݇0mIIvOEg7g7b`'gOӧGcVxy/\55ZY}T iSOP,a_V0gǏٲE*@Dx:ր.R=/A[jF\ڵt3٭<7FzXa/ 3HMg>ii~H-}AW[U,.\‰5kCttQFe[55ggdhͭv/Y %(iAlP IDAT*dzk1;YDL'֠^ 0̑޸ep.XSHK^mXkQ:n->Y!k!fnHVcL wx*a5 U- _ee2TsW28?~zg@>"?h-XP_uL"\?TR`wriW)xе1Bjn4 ߾WDEA.Ek 3X*㰙a <-uYl<)daرUWa!oFkpʞ4nB =T)Bh="x[jq_+-xTp%|((8"[" nfm۞A3ЋW 5e/ߺ_pX"\ WzӢփ7C,bNΩc֑lif]hV8,l¡C޼g,v6r}r‹hva̘yyygKJKH3[iKt~7}n{%wD;w9*c?o"Fd8JTPadܷiܸvxFoosz䛻*j-"0Y 5|xo Kjqĉ˵!>}z;c1\DzN猀p^a۶g)/k`3k@\-}3ǘHm؂7Hq?j߾Zc0 DDq7V=t%%7wڧmjmX_\ HbY9lJ`QѥוM9N]#c8 j˱OhО==;U#0tC8~.E{t#GDz #t_YD1I'$@l]N%Y/@z*:gskHe۷o3t9AHMZv kuT0=!|` G!Zxc0so3?׷uNΩ78Ƥo z*v|VVTi I߾lG;AkNɓ?8gu??{+'.7g+%ZSyj{V͞2h͛]=UZF\w$\34t6$YZC{,⑵/!-)8>UGz%xPQڢF`s{{تUPn1j "4+ȸ4[azVmݺt8#=s>(Wk rN;AI =qՎY&DZoWr.@"Βlba[{w˴ZəXc#FKe͚n~#䖚%LMYWĊkA{]ZD4_ bLþ69*#.jGb%Fh͌ 6@-#ktr|upԢE]^ؾ&ycg6oq_JC'[ZڵXUi_ 5#BS-f?վyygK,w?Z,pm#ןnQ08XP:A[[@;)CۙusfwwzQ-!꼈V1w]ug08^@Dn˭MSf`8/V!R;&8H`mY'~vHIDk̛]rHԠ11mi8[C,\- -ŲZde+jʥqXW\3% VYJ튢70+ <):>kV{7(f%l#xo.eGx`R`LjYtåWUKoc4Oy0=dO 3vy||Z䜺~?O#ɏR\}ށ$] '-c3*RO@@O?[\ G|^r VBh_gi޼QG(׿qZZ^SVwa((iaUO;km.'17 MO2ƍ[+闀p/ՂVy,0JȄEH n?`(4iPU#Eza*TXry˼=ҋ$kuJp_C0@ .aEe[ I%XH팦1Ek{h?,vr1pJD]/é)\›dG#"ed8mW3|4`[޸EҼO8M:۫0,&%3N.k{ LRRvr'e07o!_J0hр+_ܤ,֘&$d$JJ oPфSd3OAx gp9!$'܄S/)0i**TY6%9ɤ]cf 2 0\l<">KL\]c-8hiΧOGDxqi'FB8[RÐQDOl{h:PENZ[ZDۻӭEFp?E7}"-& 4uu8?9x@6`@Cf hG`挜zX-=`<"`l))aXO~B IOOr>X0<N6<[F+rY_u&>0y6~quv'N|XQ.[5j&山vEm~.,+uD?-Jd%d`'->ef{#ıc\{ԇߝ BQQŒf=HT^RK}j*ر™(0/VRZSTkZ [/}wtPiq%%1:-̅CN7v@&$[UFFK"䘛q,Àjwg%lE:j o%<4`hn=x7&?@ŋy)ԿX=j?~ɡCߨ.@ |Ppp?trqJG ¼\;G 6h!GZEܿuٵd[W/:A}Ʃ/]jF@ZT@YG%$w…i@:/tt7$_=\ n{cR 2l'}u=\gkIn+./!b";anhAB<ע)ZӽztϩD(6 uZCۑl n G\2 iVV-~8іYZN-\vkH^Rcvr _#"+ [`ib-)M.:t8&mڵ7G7hP |8c9خh#38XjqL4,.|﫪6XYZZmfq "f,SڝP.=zDŘxR\E}l-ւH/sglObL/qvX8*ren+kA;w_*{Nq6EnNOk=:i+W~,XNmbUJ?LЭV]ݏKSߔܳ=>="apxd {,Ћ_̀s6޹˗%آA~娭$de{k45}t[ixm޾}gb6CmX>=ZB0Vے.OyvK툺k9FvT~*XTBdov3qd{'?[nSZNUlr"JhIJ66b/$VcsO`i/_P4**.x%mРlAU$tkit! K4`4d`ЗoE - .>x)9q*ܯ-f鱦ڵ%vj{ $zC7( ',Xd){_,GNi}c3<EMvdcy=oPw@xΚ)-+d#%)h  fG jpM`N.}8>Js&?y(dD[U=܉q`Kzz-K`?6n4^;c֍x;"b#wΝ䁦B(CB1Qoor\J-ā uȷkjAX~LZX$}QH= +m[`)4U5v Y3 ע=swG aֵ#< f̈veh,no)%A1_;pjLpϞ-Ylzx/ڲʵkLO?5iXFs×/Vڬ+8sǏ_~|swתƀcv?UСYD6 G6n:UݻV a B2]lԘ` +E\Ivر~Oe֑59Ոs?K5_dz8h-Pˬ_Ғ'p`W'xUɼfRc!=@XbMTՋ>6Sp/q6mGdZv^75j|poQHq LUOаaS홙 81gl!ANj#OWbS oߩٮa4vX%[;asprr50WVmTpy)UkK]$jg{Dm;8b IDAT]PsUT˕yG%vOaF.Sse&;vZPpa Qk4& ܒ+b͆UV.^˃D8~-LP`O&>JhfĶ11f{d\{;"*X]W*2r,X92FK1qh^}ۚW^dL|ydF7iqŊl޶}Ǐ_fzS' ƀcxUB ˳Nd5wV~*#'zJ\8Zۣnpt `7Wg4:t2BNpOrSPP46/NZKYWF;۷5dW/C4s䃴H<ԾKnn=4hy j8fмy A\Gbcw ږ.Mg-v*"G ig4fr bqq%#K/h!1>@fb0XͶ7uej0_ol :UDeg咉~{-V%%䇑uxU*V=aȄ~z~9G]:` 2d"vvǂ6ȰaAh:%ʪ lBFv A9pЄxC_6ÃO)ÛYYf+;w>_Tt4<8>iԩ{^cǾkW0@0VG'5npE 9-!1:f<]T9,;gҤ/pyKάSc6 ,@ǟ7_juwGťJ݅ BqMHOK~W?P)!qV։'>$E fXm5M]Ag5IN&DGXx$wʪ۴i&HKqqqZ#G2hPUrO4ˬpH/u4ߦI[\殺ߒ 7B7fO5jfBBlxdD߈6nܧYMS tX9([,;jA2<6PO>^Z1Hhhx7XP6U.]>mZQeݽ9rFcGxoYwh9RT]F7oY& v!d ZMPKȖ-j^f9_ø*ُL-N.}&{H)F-9gX~9xH=E|\aWNI2OrPZZTLk7 ֯Nd]7h%M9ҥmZ?kV,vm!J2E?Ӹ]X@؈>o|K 1{ }*WfiRR>M&w׮7b ^"X %X p"/lZZ3ˈE"#]DJ(9SbSۻTJ?_VvKs /Lj(Fzq GkS0(#ޟ㌰ꥥ7KJnL8D;ā9ǁWX=4Nݻ@, #e!G*\l@ycfhq_XQ;8 ӪNرlj*HHاmܵG}hdVXohm҂Iapa$ cdϕJnm\v1*RG1u}?մxq)2wV;`l\ۣԜx u5ZUZ`82f ط$J h=mmXHuξTS +VTOwDi{w={'(s~9Dy]s?cbpMW*׫PXQ\|eZU=z<&" f'Nj2(%% xb&;iӲ=TG@ 1=Q w+q }=xoQ\GiFVxbsa)Knj.]2Rp0>*eޯ>YK=zmO0GU E@ PVT쁟yPV" b6hԬ!TI eyۻd{ܚmL #y:#F>Kj{0:ɏZr<&2sBwDmA=PI_ʧsnɓ?޻k(,[`XE-<&AqmRu{V9e[`@2K ќU.!?"5h6`ZZζmo5+@4ۃ1Um k3g^_Uap_=ԎܹR=޿p+V'#QBsc'Z>tן} laRw|w)jWҒ&Q2^A`*6R\M}y _p"?СǏIfoM(Mb訳GVȘ>hUeeUTYiZz}ٲ-3kQۭuF#|,P[sU(W+Ё e|N VYݻ/\N5~WlO% !j{޽`53*9 D4nAUUQANƌYn ƛoWcٹs6nK]VK3>9J6\`Vjb;ժQ&Nӈt9!%j2޽ +2aeCs'|tDgbK A3WɓmB km߾ /rSjp5dRZ顇F+eM&;woݩ Fѱ;#([<翤U ϙS^Q'/a.]v9V}h;뾤BӺ1tU<@UOd0k zu1o"}Y(c ʨRE vo7 %lڵ={۸s0"T|Qz[Ŋn5.&.]0ɖ-@R/n4UV'K=d(欬+VںKX"(/Es~뮸2==Pwk̓eeVb'Fo\PxBʣn)IGʂo4P!d[x=#0gF?1:/j@@sHf`9t }ΝʕR !*@䕽u>zCiQ̫~G8<\Gk<D4Ο޽,؞Yumnnaq1W& J_¿uKJϸnJLlRq,\0{˖s hE@=T?A9PxŊ´-iNw<)1 EaS>ď0T!K!C&2ΩS/U&a؞=t|,5D$_oĄ{_" 2X hN|"sO63JOS_` pA [ yX"Yѹ+Z7cSmXLj۶tSMQP܂=.۴iG`jU;UVWw~A-,bx^xo߼x91\aPW^'~jʐ6#0surA=2ǎ*O" yǎI\Չ ># ࡰelqK ʸ!zӋ/aI%YM<`a|Y*cgp`]ލ9σ'FTfrOȧl+R]C-Ejy~Ff p"Z0ҐE7"h0.B!^ V%ј6)~f%׮5֝ I6D78GN tn.55[&_iBJ;lA$KYY$hcVa?1#S[7jԣ:bWb8&UVEJ)e*į~`۶7ݏ?$TxԂyEfQ1a(%"1 W}~`F*X,)٦*}Xb//ÜzKƌB|شw*٪yUվ{෈uْ7kʕUo*ݾeXSnb"U7D66QS+$k"#ҥvS;t2|lv2]f=KNjIP m,׫dPdGet-ɡK~IKD6blxevv-VBTuo.z8`+~{w6`6$> KvZd_ \ÇټF!OV j1"]3-`CynVe+bjᠻP&&]%׆ZO{ad1Rffsq;'_5R 4BBB('X"lUݻ],U㓙V8`+*k.;w4JkحmpbW(: LYzvI #Oa$}"U31]E8ZENyCф{r.yn._0Q+VZ|W}q]P(y>h]gewx kWn"g8DĉWFuK@СoY_J1yDbb;s~Fh*;{-XʙX$v`&Ğ,eKOE cFHqްԺ+rfgQ_Y;(塰{ r$cUS(lB&P<}zPhsYRݣ0Rc(#D)zfB[;1Y-li>|+NY^r4($%eXH:={i~+?δyW&533߹liB +Y"h JЇ5T-c/?IT"k,|]k'4!D[Kg>r_q?Gvԩ755AzSej"X\" &N߿dgR/ )AmXƼZ2|x* rz\7_R~TnXE q7Ei?XX'y $j*0&mp1,On_-i,"tX%6$dS[wIҰQH'o B0ʪ/лಲyy vXDqzSZ]7bnʻ 8p/u3pqcM,[cXyn[6N;eKqWWwL$HP(-'χg,Z/]C:A^hg,ā!08FPR>v0avE ()a+#b[>8< s}؃0$"c^Qz{)A[mE; 8{GWp3[JAʺa,9 ebj\f.B4+@*mdr ? '+W 6jDā2Q%B93S f)W{wQ̙'ouYXn ]#s(Iv`p2U\DT;B*%33deUmWsXԣBҳpBOVX 3xp FEC>-W[P3FϺv #,!,cXgA]&Pg`ĵ6>2r]WnQ :z{55WeBn/+QQ{b{&!;&wQ۶<$wۙ&ɒkP5&9Y.w$ȯ8 B rrVi6K/P,ZJsIlH~J$&On{#Sy7lxC]}'ɩE'TV6?ZbĀ :iĹ$~W;9.F8sAj3|)4 `V>y:C%>ӱcÁwz:'N [:Q KgCDkN2Tnt_U\$8!:$Ut@!dFLxE#=--gS*eEqrG zဩi.39]zicg:y1=aEQ =|ipSPiԨfZb*KպݫoKڇ5k65}PPEyyy-{pjj} } {>,le{rd0CmѢYY)s\ڱcŋ*+xh75OڸUXSo`W:x,Q97u_>xxxx2+7/nw<<kOggv7nΝooz^^yܹ+ Z~Μ*R6hи~FVU{饟_*;vԢ[=+,gѢuUYlK]ݱ^Νo/]%jI0t[mEE[fϮ@XZ%RS+*\k{xHK˕Emn>ro񟕕{}I?bԨGk̛W=wʜ5{*+=ChˬY+Yϴ~ƌEA>uONqֹs32܂dpaiii9푒2pϝ9 !5!~DAH`J8+@'NO虾慵w۩][WE=KS?l8z2r8=g:n{=kS5͕ܮ"ߧO88]ei?߲qѲ:z5csj״(U7Ցmp@*MfRT_SOp3\|ÆӶIRqՐBiжUΚj(SYth[!{3"w= cw50m5u;@Κ!$;+}ޝx2c&)LZ@~ꎎo͇Sz`;\ߺ,AhuD +d* 4'QYZ^RE et0, q6QhHe~}9<5 ԼE5z~A'qs3b"2J |}I^=Fڰ)EyK"Tͪ #G(I hk/~ޛ1NS9K%6jZ  $I1ޗomSAj'/BQP̮meFvL }Z<-=! ,0 .Y{i>XpylE2ťp7>2|kHE Q¬Ը+4-ûԀupx e"O07&DJe)eL@ijM;cj@щoM5R(>'$F779p(a%tDF)C)=8ǁ> Ф'e3:j 0jf|< 椡E[A!"ӶfSіSfC}ـE|P6U\j(́MNh.[ɝ*{\YyiI!b*l,80!X{';ЉRq4?RY||!!85%)C:j0C(䲼 2FPf|O=n }hjExuKEul_BG:$(d4#Hd /A$@!HWu?]I'SU L7:K#qM ѐ_Ql*UVԗPA܌ޟҡA_2q]\M?kF:0q^Mjo[oZiD8.o\KC8-YI0( q]L@5,}f?5+UF:jWt{e>3*iWG~hUr' <1(ou`6-%aQBn  K>3vbPmJ>2`OAs^4+#_O@I<1C8.XIp[jp]LiZJ=nZYJ<C7-n[J{ehWGRD8}hUgUFyc fUEqPB6{fS$wa 9/&s^t`OlH<1s`Nq]2)"]M?q\1)!r^Mj0' [K=kXUG:|f?4+|e>4*iVs(!SE8~iUzd zc bRCwcQn t_5,$t^mJ=2uaO_N@r]3*"^N?n[KhB7-m[JWH;lXT6tRNS@fIDAT(c`a (`K"y6g96UsɨeJ 򟓷ܢBvʖ`d'o1^=[de5r ፚgxDHecР)J4Uv@Ur:~ K+-wm4w%l,i '-'Gjing[20؉_pjY3`#OLt5[Y{/ `Vu;| lרۑs+‡Dϟ2.՚xHDo[ZK=oZiD8.o\KhC8-mYXI;B6,t~iVzd<2)gVF}gUrQC7|gTqPC6fTExb:0'eTDp$OA5t_uaPI=2taO3*#^N@r]s_NkG;0r_M\L>p[0( E9.}gkYI}f?5+UF:jWt)"TF9jViWG{d ~hUrRD7gUEpxdRu`6-%  K>3vbPJ>2s^ 4+#lI<1iXIp[E9/p]LinZ.&C7-n[JhWGRD8}hUgUFyc ;1(fUEq PB6{fS$eSDwa9/&n_OAs^3+#lH<1s`N2)"]M?1)!0' /'kXUG:|f?4+jXH|e >4*TE9iVs(!=2)hVF}gTvabRCoL?4wcQnaPBt_5,$J=2uaO_N@r]3*"^N?YJ=nZ-&n[KhB7-m[JWH;lXV1tRNS@fRIDAT(c`@1`:^CQPK:eD^vJ{߁K۞3ӫB%Ϝ"n!, ejZBQcDO[]D}ɢ(Mh˿3?X+ʲV-چC{k{V= ,޷C#-74'##L c;i|IENDB`vor-0.5.5/data/rock28.png0000644000175100017510000000311411310013350015636 0ustar jasonwoofjasonwoofPNG  IHDR *}gAMA7PLTE+$VH:}f@5+UF9)" yc{fT$OB6zfSwb9/'dSDwa ydRo"M@4bQBu_ q]\M?F:0q^MjE:/[K>o[/' ZK=oZ.'D8.o\KhC8-YI0( q]LkYI}fUF:jWt)"TF9jV{e>3*iWG{d=3)SD8~hU' RD7<1(pxdR!u`6-%aQBn K>3vbPmJ>2`OAs^4+#_O@I<1t`N2)!o\LC8.n\KXIp[jE9/p]LiD9.ZJ=nZ.&YJ<n[JlX,${esRD8}hUQD7gUFyc ;1(fUEq%PB6{fS$eSDwadSCN@4_OAs^t`Ols`Nq]2)"]M?q\1)!r^MjF:/[K=~gkXUG:kW|fjXH|eiVs(!SE8zd=2)hVFzc }gTvabRCL?4wcQ t_5,$`PAt^mJ=2uaOlr]3*"YJ=nZn[KhB7-m[JlY,$WH;lXUtRNS@fIDAT(c`@ͻ$ZCϔ>_`@W XMitdž=So^,A~'}K+lS|ij6ṊƦǟVfF?#w|C7_ĸ-[{$5!z~њ㍳L4~8g)X1[vwLپc'kg6_T9$U}׊랧_o >q:@PaF%7mb(k8wSD-S 6GivT\fu3pIӵ y~8IfvhEB ܭ5v&U`}fMnaKG9zsַ j38o3Y0,?0h̸,Z}6$lH~5A^/9FY-- nl*ҥ1_YtV_׫~g*7}Q{w;obwtGiT&;Q{d%/V 13"Y]K LRu`m|-WdZޒ?Nո TUqQP>OIҸb_ٴ xrRxe8EՄZ`'0 }[!ﷰ؜)rI%kxUh9A(ApZ2 2agghj>Q߷@͛7oŞW* RJ 3`cv+I& '6k57o* IIENDB`vor-0.5.5/data/rock46.png0000644000175100017510000000250411310013352015642 0ustar jasonwoofjasonwoofPNG  IHDRgAMA7PLTE+$VH:lYI@5+UF9)" qOB6dSDwa 8/&o"M@47-%bQBu_ wbP q]\M?kq^ME:/[K>o[ZK=oZD8.o\KC8-mY-%SE9~iVs'!zd <2)gVFQC7|gTq%PC6xb :0'p zeR#uaPmtaO^N@]N?G;01(!p[q]LE9.VH;kYI?5+)"TF9{e>3*iWG{d =3)~hUr' RD7gUExdRu`6-%n K>3vbPmJ>2`OAs^4+#I<1t`Nin\KXIE9/p]LiD9.ZJ=nZYJ<C7-n[JghWGsRD8}hUrgUFyc ;1(fUEq%PB6{fS$eSD9/&_OAs^3+#lH<1s`Nq]2)"]M?q\1)!r^MjF:/0' kX*#UG:|f?4+jXH|e iVs(!SE8~iU=2)hVFzc<2(&bRCwcQK?3aPBt_5,$`PAvaPmJ=2uaO3*"hB7-lY,$WH; ctRNS@f6IDAT(c`@ XM ݆&sw[H8tH.qs[Xv 0/46n(*P]iqDλ宓8q+.r+%:eXg l?]kg,JMwn@Mڼ1+gG~P @u+(\ji{B~!f@IgmBjtu웃R:ܐd1rZa~<d Ǘٷl=R̒p61ӷIENDB`vor-0.5.5/data/icon.png0000644000175100017510000000541111310013342015461 0ustar jasonwoofjasonwoofPNG  IHDR00`ngAMA7tRNSn IDATXylTI!!fMIR 8=^eƀW n%-5AS -ITP"QQjU߻gyC3~w~L5sܢ-mee;JKweڂɌ9)1 WT-/߳nݮe+ NvsgL}qs5땥KJJQ[{pm!*+dLI 3,X8~sAqpXiSMG7o&m&'d0E'F#s3C iF'+}k(㍍'O55乾~>$`9Hb CJ #` 5{'5m?ߩb--oK @ o0YEZfehiLHQ 2(o5tZc T@9 ˌbjՍ6X !y: ~o9rGɓ[脯SRe:P()3^Z59`>TGg|g֋W10xvׯcp}}zz>zM-TN:Bp(\2<+KZKbnl<5W;ɥKoG;wlz{\ G0;ZViF۔DFN.MM";@Iؽ2u7>3߻g{|w_SS_w'cUc7_]:uBcyfݺ6Q 5FxjUD!y̱:V%Ɣ}}8~.A6&҇ĉSe": ]Ӕ]F[ K4ѩ=b}ݢ|2W+b/g@q15")j8 UpϤ#/0߸C~[@CK62G9ڏNMcT~w9@?\4i{{GF۲#b:%;j>4߿9e  ed9ZK ^'@a^!7) 3-v Ja_Hүh տ]WќhpfMwYY7Ly͜srMY5LkSKb8eŘBҌ01׸p˜9N"'@9 *?t[>32\3x, -J݇^Sf'1 IENDB`vor-0.5.5/data/rock42.png0000644000175100017510000000417411310013352015643 0ustar jasonwoofjasonwoofPNG  IHDR"% -gAMA7tRNSn!IDATHׇWgl6 6 (HoJ^TE)b4cwMfW{$;;s>f}{ߏ>Z+;)0#:?DmQFKyŒ#wش~YeʼN˻cu^lxrx۹ΪW}`zn´ٞƅϯ 5^t~q6[0ҎDh |=7Ӄ ?=\<os{O/~wcDAW3 [)F_~|PϮn-{K}D;~ykCCM%%9I;6WƑp*#(\Xl_hkٍ3{jR0t7'x2N\yygId1E~yl;>T"~MىX[єQ'YR7Wni/n)uԽt]' 22b  {wr0=vƈ3F[uiFU~*^YVK0(6QyN'N4.PKYF1l I廷aֿ^BdO/ZLx{8-tsTٶ KԹUf铲> _\iM]rau aƎTR;ޗ롶U7;^Cw]ڎ<`@4BIWɂ)XPw`OgM{{gWJ$VJBE"j@*d'e%,Nrd&ԟ4vDJ}1\C"LA *Oسs׶;nZˆٻ e:8\hIQYQ-=Zf87K0W|񥁆gWk6|57@}ۍoBWVOu1R$nI0q@˒8ʮ~ݧECGZKNuIkCR`_?y0ܛ,H?b(([++-|g+a5j'"bIuB&.MϹ&H7= ٳ&8iHO|?ɦ7G޻Dc3eWk|yۂ;UM"S/n^"$)Ps̾]yiq8؄¶4rvV+0*3Ґ"Ŭ3WwmX"&rqVsuLJ*̴G \S;KIL  Z1MXr 3T)iNaS?]cBό!)*׷v1.~0~0)WPiYl)7m멓ՓՖKW݉Llڟxp0K  168b)q8eq*yqnH9h{O6FP э8'*b$>z<?xm9} M`&aEId_6ĕӌnvмycvmS =hPwTDGLGЄJqP7*!#g)ޱkȴ}I R_ &`O4$03#1o>Fŧl߲B) Wʱj{,~Hu< P8Ԙck`PPg&*ջ?b{-',(C{2$H-zdY|"ZПVT rV.FIENDB`vor-0.5.5/data/rock00.png0000644000175100017510000000163111310013345015632 0ustar jasonwoofjasonwoofPNG  IHDRXFgAMA7PLTE}fkYH {fTqzfSdSDwa ydRo"7-%wbPK>2\M?kF:0q^ME:/oZiD8.o\KmYXI;~iVhVGgVFrQC7|gTqPC6fTExbzeR# m3*#^N@r]2*"k1(!\L>p[VH;@5,kYI}ftjV{eiWG{d~hUr' o!bQCu`n K>3vbPmJ>24+#_O@n\KmY,%mZJ~gA6,kX+#VG:kW*#kXHreTExb90'zeSp#yeRcRCv` !kjE9/p]LiD9.nZ.&YJ<sRD8}hUr ;1(fUEqPB6$ s^ls`Nq\r^M[K=~gkX?4+jXHs(!SE8=2)zc }gTbRCowcQn5,$`PAt^J=2uaO_N@^N?nZn[KhB7-WH;lXɰ:tRNS@fBIDATc`l H`FUfeRg-nmKe2tPrV[HVC԰ɼF-@1$Ł\RsXD[YJ/ f*-ʉӜYӮдWa.' A4u.b|fR 3#]JII13v(Oc1oMt)dI f1GC5 ,fН1I[rq_X+Oyw>K<$@b@?[5f8F;A~ )" _Z&$C7EiT8;"H W^IENDB`vor-0.5.5/data/rock08.png0000644000175100017510000000276111310013346015650 0ustar jasonwoofjasonwoofPNG  IHDRXgAMA7PLTE+$lYI}f@5+kYH UF9jV yc{fTqwbdSDwa 8/&N@5ydRo"M@4xdQ!bQB wbP q^MjE:/[K>o[/' ZK=p\LiD8.o\KhC8-YI0( q]LE9.}gkYI}f?5+UF:jWt)"TF9jV{eiWG{d ~hU' RD7pxdRu`6-%aQBn K>3vbPmJ>2s^ 4+#_O@lt`No\LiC8.n\KXI4*iVs(!SE8=2)hVFzc<2(}gTbRCowcQnaPBt_5,$`PAJ=2uaOlr]3*"nZ-&hB7-m[J,$WH;lXjftRNS@fIDAT(c`@~2 ث|n뼜ؠ 4HT;ssWKZ(ʷĭiŀ,O_18_5VGeiz o,wW6 լ'y?Vk)ưg#'Ly:}k_׭/j3إ:4S9?ߍմͰZU֔ լMU7ņT`(\s9{n>xO©u|k9m=yVz\eD7@|>w}iĮ 3#5x}D{z&eګ| \IwI'O - *6'}u{+rr2~@ S::*%NmǸB[Q#e&ߝYO)Cˊ~@P9e.gWp̿u6>H4pO[F[uv% } ,<00muT>J]%#?_L`[>\ -bIENDB`vor-0.5.5/data/rock17.png0000644000175100017510000000223011310013347015640 0ustar jasonwoofjasonwoofPNG  IHDR7gAMA7dPLTE+$}f@5+ {fTqzfSdSD 8/&oM@4u`7-%bQB6-$wbPkq^Mj[K>o[/' ZK=oZiD8.o\KhmYXI;t~iVhVGzd <2)gVFrQC7|gTqPC6xb:0'eTDzeRmtaOr^^N@r]2*"s_Nkr_M\L>p[0( q]LE9.kYI}fjWtTF9>3*{d =3)r' pxdRu`aQBu_nK>3vbPms^4+#lt`NiC8.n\KmY,%mZJ~gA6,lZI+#*#kXH|e?4*reTExbzeSp8.&v`n!L?3aPAr_Nkp\[L>p[jE9/p]LiD9.nZ.&YJ<hn[J{es}hUrgUFyc ;1(fUEq{fS$3+#ls`N2)"]M?q\1)!r^Mjq^L[K=~gkX*#kW?4+jXH|et>4*iVs~iU =2) va7.&wcQ K?3t_ 5,$`PAt^muaOl_N@r]3*"^N?H;0nZn[KhB7-m[JlY,$WH;lXctRNS@fIDAT(c`5 :In (meх;Ⴌ.+6Q8gDԧp\)ޓV/n7)22A=rU\M@z<= C 9zoT-` }nԈU+M5z\nvnd+=1cG yiZ 3kWizN k`kװ%M{6yЈlkn)'s15̔9)ߨ=zG1+ ݢ05Eϲpjo]j|O!I6pK&ōRv8И!2HaH頣U^1\ bCdPkwLE(,o0{љBVFΜc弼@>`8^0k_qmd+'mpK;nhUd5d|~H@/a9vJ`a{hl/_4ۜqRmoTeπڐޘw<IENDB`vor-0.5.5/data/rock06.png0000644000175100017510000000241311310013345015637 0ustar jasonwoofjasonwoofPNG  IHDRogAMA7PLTE+$VH:}f@5+UF9 ycqOB6wbdSDwa 8/&N@5ydRo"M@4xdQ7-%bQBu_  \M?kF:0jE:/o[/' ZK=D8.hC8-mY-%XI;~iVs<2)r&QC7|gTq%fTExb :0'p$OA5#I=23*#^N@r]2*"H;1kG;0r_M\L>p[q]LE9.kYIjWt)"TF9jV>3*iWG =3)~hURD7xdRou`6-%aQB K>3vbPmJ>2`OAs^ 4+#_O@lI<1iC8.mYmZJ~gA6,lZIVG:kWkXH|ereTEzeSp#NA5va"8.&cRCv`7.%M?4n!L?3p\0(![L>p[jE9/p]LiZJ=nZ.&YJ<ghWGRD8}hU& gUFyc ;1(q%PB6{fS$9/&N@4s^3+#lH<1s`Nq]2)"]M?q\1)!r^Mj[K=~gkXUG:?4+jXH|e TE9iV(!SE8~iU=2) <2(&vabRCL?4wcQnt_5,$`PAJ=2uaOlr]3*"H;0YJ=-&hB7-m[JlY,$WH;lX%}tRNS@fIDAT(c`K#u. h٧y*h0{^l4E_{s񅦻Gh-יqn̢01$ U[TWڿXͼ8 *ξ?]ƿV59!d:ڹmރ qU8@O¾TSsd筒5b/Q8+rYMرƈSh2 |MP9.VQ-Slo?,"Rp(0mۍkY]ͮ7P (aΚkb`zk{ŒZ+n@e;$XXԎo5InvSW]}\T;gRŗ娕"Jò]ߖ}+w* _X6Y{p"4Uh/^< IENDB`vor-0.5.5/data/rock14.png0000644000175100017510000000316711310013346015646 0ustar jasonwoofjasonwoofPNG  IHDR h~gAMA7tRNSnIDATH[Ri2Ds} q_pCTE6ErLsIieffZr~CY|}{y|^p%S sRboD\\Չ~UhΌ^S&N9_hzwvuENjѷӟflN~z4z~$YuީWJ%WG=W =UߛSvwɜ;X zG .xS>0rgkM۞!OHvk9$o@U_#] ?9洙{3LMw;>rVm=3bylgho,,Kkv +,xI&H!OX.&ݭa-kok+˝Xok0XH~ 2 Q ܐuޡi7&MsQOPٮIV_ 9Ypk$(r<_%E0CezOxf}K @~U"#EPfV7\`k K˻3V>3ؑL?3njB\mnc; kn*ʆ1z0,@Jq6}D H@YI5<䞞,A :ػeۺF{ػTu+/; 찮e JML+j:J~`ٳh|`Zi~H@!E3iV?mseo1kJNI!JI@ѼLa(ANd(XkѠWT@;T&YEDG1a=_r" 0K0ì^1n,_H`Ƞ'4;asBӢNQ v)ITWW%N6MAT@bfBA( $XsY?1xSZK"ҒMp@"0;$jL]8p ^6D> cRbCAbLuppe&Njq2 miq7:n]MQKqN(zNZ" -ҏGV}Y~*J2htAP aCy>F|FMcEEh%|H7iikHg2F( ^Q%( v`'%Eg(znzDGqeMb bڰ|.K؏TKrz5A_5hsr.F xav"F9|ǐ^U5Ҽcì:뻋PA&E*i @돝b]%(iH`FQ#FQzRY~&i(k֖00@N(nh9e_ DFGa em1rϓ+w sq/W$qHIENDB`vor-0.5.5/data/rock20.png0000644000175100017510000000226011310013347015635 0ustar jasonwoofjasonwoofPNG  IHDR`ygAMA7gPLTE+$VH:lYI@5+kYHUF9)" yc{fTqOB69/'wa8/&N@5ydRoM@4bQBu_6-$wbPq]kq^M[K>/' ZK=oZihYIp[0( q]L@5,}fjWt)"TF9jViWG{d=3)RD7xdRu`6-%aQBu_ K>3vbPs^ _O@lI<1iXIjE9/p]LiD9.ZJ=nZ.&YJ<hC7-n[J,${ehWGRD8}hU& yc ;1(fUEPB6{fS$eSDwa9/&_OAs^lH<1q]2)"]M?q\1)!r^MjF:/0' [K=~gkX*#UG:|eiV(!SE8zd=2)hVFzcvaowcQaPBt_`PAt^mJ=2uaOr]3*"H;0nZn[KhB7-lYWH;lXN#tRNS@fIDAT(c`3ݓLDN2 EzBSDoB5w[˱OjfҲePQ6ONGm&Ŏ%  du u W zE-ߪ·~޼}wgwu J^(騻\HYajzv,s^ޜl:DUQk$ŜIv-!$qv> s./ڽvaJR-n/,,9}Be2` <3\}9,>5OH1nqi w/=eo9?X͡-+Afnm^h"9]uaʸ5R|K6K濫2c P!OU_Aw3Q+KFSr"yWpMaF@QLRәSXx:70Fuj40XaXu7ZE% ieL¦,ߤEl!jϵiR: LfmU&d@"WlP,IENDB`vor-0.5.5/data/b_game.png0000644000175100017510000000336011310013233015743 0ustar jasonwoofjasonwoofPNG  IHDR [e!PLTE8Uq`itRNS@fbKGDHpIDATxZKSF6Ůs֚!HQ $ Ivuwx79!7WFz,T\|ӏ{XF6l.kzAS!>UNKȢfO1wC$(sQ-XvP}A@e̟S/آQG')xct^Y~vQbkdqҕFS<&MCxr8Qlı@0oun@UCuro`IYj4IBe YdI6^ի} h8>"Cm'Ȁc UpȚVJί1s.s GTQFRZx5Fb2uCh 6/j?hj3xXŁyY85G-*8b0OnjcؒYc8n#*8D6hgZ@9+ϖC۵b߽ zdr&W#\!)}cٿgIOGJ!:-{#yOja&P*X95I-16+zrZψR_8@}+|/ uX +8?9/p&'\Q .徫 x'Ɣ4PxBuD`d7q [RGpvߠ4,M'elr04=9ا8é h}p-Wb' a8L\`dKAr7]O*iCuJd.%z s0 Mo44Jt\|9]n%ɒF|F▤'mB~m`q/R!V枅 Dd$<U!/3CZ)\Xilld0xE"y!pZNqxgC[9dfEvAdnk9bN8n3YƔ>rn.y/b*0~C9Jz%Zʔ!YGv \/X s,㒷S>/%}~ FGQNEUEDbnxSC`,.P#YNH ,pN2}A Ȅ|F:Y tӪ9(p\=we>&Hl0ΔR5 Tƺ˄cK#6AЛ!T_d(rmL/ǽLdx4LB 9ܚth*2ӑJ]܇vW;@G`M"!9$u"Ź# 'eeHT`Գ vt9*cM 6OG?*.FƮLoeX3tR31sө 6/@|8"0M&f+Y*d`q̹W Yk!b#k~JG됵d +S;zgmd#F#n~FIENDB`vor-0.5.5/data/rock09.png0000644000175100017510000000302311310013346015641 0ustar jasonwoofjasonwoofPNG  IHDR!FqgAMA7PLTE+$lYI}f@5+kYHUF9)" ycqzfS9/'dSDwa 8/&N@5ydRo"M@4xdQbQBu_ wbP q]kF:0q^Mjo[/' ZK=io\Kh-%t~iVshVGzd <2)gVFrQC7|gTq%fTExb:0'p#uaPmI=2r^r]2*"s_Nk1(!\L>q]LE9.kYI}f?5+jWt)"TF9jV{e>3*iWG{d =3)~hUr' RD7<1( pxdRou`6-%u_n vbPmJ>2s^4+#_O@lI<1t`NiC8.-%XIjE9/p]LiD9.ZJ=nZ.&YJ<C7-,${e=3*s}hUrQD7gUFyc ;1(fUEq%PB6{fSp$wa9/&dSC_OAs^3+#t`OlH<1s`N2)"]M?q\1)!r^MjF:/q^L[K=~gkXUG:|fjXH|e>4*s(!SE8~iUzd=2)hVFzcvabRCowcQn aPBt_ 5,$mJ=2uaOlr]3*"nZhB7-m[JlY,$WH;lXS)tRNS@fIDAT(c`#B0G4վ:}G ԍ8}%Lcd`xuC:NG׭>!l5'pC W-lozϐqBt@ꧾ'(­32aaϿHg0ll5˚;*JϿ1|d'WѴl3{b*Nmo3PNAWboeZU.OɩX߂U/+=p0 EA4vɗ\WYŻ뺵_h +Ѐ g4T>)h2U)ʯRċm ;z+1[= &wLq\ۗ1}E>oX,554wuh@0j 璫jDfihlG Y.k5lX͛]e xe8Cʌ'y'o&`&Bae 7 ;Y-Cx,@HI@2"cv|IENDB`vor-0.5.5/data/rock26.png0000644000175100017510000000461111310013350015637 0ustar jasonwoofjasonwoofPNG  IHDR''bgAMA7tRNSn .IDATX׉WWpǙ ↈ" ." 5gbhL9:h&Ӈݪ[n=MלY3l8r,߆mbYSYW]o.m=6X|`ƮL[]~W;.WipHڑ^`^#owUQ_~hfظ9RvHSm*7w}_}{oK>RZ_ KrvѰO7wU)KW{kfZ'^?bgshj(eec道ؾUuFVʨ߳7u'PU AwK -cip;*smW 6z#c+Gu/ ʣOt{swv.=R;1<]uwe_kU/&7a3g|rqU(Tx#EI#6ԳTdlz H=n[6m),A7cK FKӓ>y$sFH\뭹_[-(E zr0 HN_iVH[䈧*`Hjm*D~ 7z$_݂@2~ibT|tKO,m+y{͚{UGb.g#H_R'~F{dCUpjn`{QKTS`oA"-tWZ7}pzv?ئaRo& >^DD[!:ʵ,ߛSSpߑAY5߭P{k=b %P!XH=@{ v44岑#; ĩl8t(I.JЇ9T #FP| [|>1HC޶q 8"h> 1+dh =9佴BΉskY:D`4+#cQ̲Ebc,tʉW Y6Q|a+>0֮)q<_:,Ҝ]r]:z*} ϥ ,-KwIySQrŊYič^0 Ab16u.W7<;F  Bo U;I.ԳFKp{R6˗ZB}^I͆·X*Xf/;JNEIVL90&Gxd_R:ey\- xkS=*1 DEz!$)XHLĩqa@V0,m>a{[7Oe9i۽J޼DGr.(ȍL}ɖÑ`gcĆ8{gaYitk'o\[r`W}qv[bW/SϨM,Ă1vJƈ}qH48-0,7ŭ+usÔ,e˗SWB yX3m,̾'XDSbIAā<2:)Jj#=8 .$rW@ӊcOCsUAͫ(&s-+=(Z8{֍(SpDqjg<˵vwn]8{g?/ypo g|v 'vVe;oҔ3Df>52Z}9i}:55ԕ#Q}SDHnrSb9Q`Ö /ZF+6!y\ݼ^YSE*:e{Gu2po*'w/6FV XD` vDo: agT7ߢ.ݟ{2kFj~{71tKkP"572ۈ ^yƓf4%߸! "4IOnևi5G'y@r'ck.ۛ`0Ayֆ^Q}yq~ !ٌAm- h&SVHͷh"EI_O%!bo8HV͌Y@̼Τ.ޣ.Y yi,x^r A|Mjp>pDi =FUUX3VM ;nvE| #]̤qCse f2\NUL[@̋0 H` w$Pap(ɬg.ƅv

? 3F `=FFUe0Y̋}}:-*ҝq  X6&+u!V6mIj'cvBpC@\HċoE  z48ƿ 'p7:aҪ!$?oIʥ"+(8o!Ƀ[lu0+g4P D$qq[b$Jއ6,-I# }ҩ(6*ix)qE%YQa2RcPA [D} Ch =gP ,Nυ QA 1ƥ@/$IEѬE+DȚgޫ zeFzeKEY̠N8j''ဟϔL8&-j" ,);9nRH11R#8as H\NUi|U LX4Uܘ4+ikYfu_n..1Vflx0>/ &Ƶ?uu!aVUYPݞD1%0yIH_U45P"BHE HC?N0A QCKcĐAs@1cy;/R ^]SFD舃O>ᖊ"0&8F|~yЉ5|ϞfaCBx$~6%8hWΞ>E橓y_vz1&IENDB`vor-0.5.5/data/rock32.png0000644000175100017510000000340211310013350015631 0ustar jasonwoofjasonwoofPNG  IHDŔngAMA7tRNSnIDATHWių٘fLB좨XQ@AD, JQc/ei)ma1qݜ9q͹sg]aWܚҼ|Ɋ;S6}I)׮^zL3+#ݿ:rǦgk^KNJC7m&콷u XO_KektZSOh~>vo؋M'?]s$KcdqQite)C]ubvԷFݩޣ9my {Èl_ tjeW}YZb FPP!Ģ ?ߙ0 "m7$xŎ1F *L!BbL;mt5*-5%yeB&W2Oy^)/ #ݟgt87veR6AM6'NnT)ɬ eɱQatQ|4Vą^|wwpn,QLV)\ղfy?caqpۤ9sRU ,0 YQgΰ|GZUP8!8~t\Kʜt$Ek( nUlm]ԙT4mVZdil$ u"fxg}Ө(HLǗdF4p{mIuI,+U|1ƮkI(G(&At7Mm =eb t֗Q:& *چ֪ zQGzT"|iz@>*AKMMq}Ap!f].ˤ׫QM+qrJrXSR/ܘH_QPC 񓳉é`8Ks )qqNz BuDT/&`m<#9-__3]G[ &5ɢegbLDavZ}0,2Hd˳S\W.]n0܍/99|Op%-IRco(&pOh-0`3 `29 n ReA9+IG{@jJ$¬{18kKŢ{8g|x@qc⼒q?/gLcjLB*~A #.*+d%OIENDB`vor-0.5.5/data/b_variations.png0000644000175100017510000001047211310013233017213 0ustar jasonwoofjasonwoofPNG  IHDR9^}PLTEUq8eD6viWQsmxAE5l?<zY}`KI>P[1o:^.dc;2G~|J9bB/f]kNh#(FC-'=_+p%d tRNS@fbKGDH pHYs  ~tIME "3vEIDATx\TUٌ̝6Co` .- KKi-PdZYiiG6vg_(]GnztqQVuӌ|`S_7 ]ǁ .vi_*e68] 3T0+V|pPٓRKƴټ~&ZY7fF*S۶?7SWT363볆 jqן<;_v7nGhݎ m:J&,OQ*kRA۶"`h|?: +YsĶp@\T[q:bFϻ^Qz0V0x`NJX0,a< DDx249$eGOBLW1wD3d$P_9Tp~.pH sx% ,_gd[1GHH:_H,Q*JY|#nk)αE۠_Lhq|.U_v\_MɨJ5wr_o8u9͓(r0CRlWƔwWc\l(kmdžx!aOQ_&dLh'UЩ~:PqpsbD!l]9rR@=Rm+\ȻBlPV9)I"OV`瞑 ;](4dfȕ}q)Vi_տˌ߷EG5JDT:Mש.H^C&lL[G +:r3+&hKKة/YŖ?Ϲ.S[i\ H@d*¦!UD*'y,%Q3^/a3wᆊаC33FRy X6s#hթ5âxoO=Pމlk}S]|*w%Z 8Ӏqk6djA#̖Fhti@GS]㏙uEQ]O ~(^Vt&iЪMG&ZG.x;\D+#,{`!(hZ5C>k>Ε $VᘍFEI1P# ygkA}Ux\de$Hmw1Aqg ʫH}|^*\8~"v1- Bl4lbGaT)MbLU\ .Pח֘yg'}OZH-T9X6ts(bR@EV#*Zhjܾs^=L>Z0`sXF6hlUE?h/3rh)q1-sҲ!N=5펃M7 >xnp;.` 焸B)mDfxsk3QZc ?peCv3;y0s]?>ϸӄ`EM܃󀋗O~!`2@_oW@l.T>g?LD_w^&bhHMZt:BZB̯+=u~G(D-$" e{föm)QpUݸ€ ,~+gAZ8Km.ТZpȹDF}X7JQw\SqW6*Js XfgEp]*jw눆6C@g,nAkтFA"in"r#V 6& wApLAC%z(v%XU]=bS.1D H~%dE '6>l?5e2LMRz;N&ǕЗ%0+Fh̑k/ݤŕ}iE:YP$a%M*nˊHh g3> oLG\JYlD;D2 Q,Pc~B74蟿,$&N,wv(~~1*K#h0=u$ll[8ҾaXB_?/ky_I3]64+oS]cyZN_ZMZL/l0F_֎tqG:A ~[aIC4WI!t"E\dD* OOO,[Ol"vQ&^CW*ajjy,ձrYn]T,_ <{NR= i[#&;rP?IZT>)zuj!勣D6=Ŵ[e[馫 @j:?TNjK "RE]rԵ9D6.Oz'{CPo!)F9.&>o|ȣ4`ov'Y bDlhr ӊ1.F 7C*o=0ԟs tgs]ZHxf7l^ jv/~KE"ރ>joz}φ*#NEB£6O$*]O>1 m+HXtxO;gܩvO?/V6Ϫ2R~B}S"Rلg61"ki k9̗UWWNȶ[שy,[i͚^\aI޺i=}.夭6ᘐ9Zd1ˍLcDdd߁ ij(. Xp$o VQ&7,^t͹1Zܻ~-TDCAC}T{' eՕOMf ~X(+Ω -./QiȃMT'鄭fjs 3~e0e>L駜C5UGp]_]AާVړ%Bi}zo3[{QBIENDB`vor-0.5.5/data/rock12.png0000644000175100017510000000175111310013346015641 0ustar jasonwoofjasonwoofPNG  IHDRW?gAMA7PLTEVH:lYI}f@5+UF9 yc{fT$OB6wbwa 8/&ydRoxdQbQBu_6-$wbP \M?kF:0q^ME:/o[/' ZK=oZiD8.o\KmYXI;~iVzd<2)r&QC7|gT%xb :0' t_mI=23*#^N@r]2*"kG;0p[q]LE9.kYI}f?5+UF:jWt)"TF9{e>3*iWG{d~hU' ou`aQBn  K>3s^4+#_O@t`No\LmY,%~g*#90'zeS#NA5va8.&cRC xcQnL?36,$kp\[L>ZJ=nZ.&C7-{ehWGRD8ryc ;1(fUEPB6{fS$wa 9/&n_OAs^t`Ol2)"]M?q\1)!G:0jlZJ~g|fjXH|eTE9iVs(!SE8=2)zc}gT&vaowcQaPB5,$`PAmJ=2uaOr]3*"-&n[KhB7-m[J,$WH;lXPCtRNS@fhIDATc`L9B\ (P0kVWd-شl}E+bs+'̔Xy,țԾ´*ez}Īb"J!1m.V5[b|6Ŵ%sOfiu &Ɔ7nNԛ!$kѩ?{~V&l@y[em쫈`tY9۞!`d+LI)Y#%-; w^0fG81M,Verf<5]ab gS0jY0YjeMa [ʘVqkJ)VQ9p)ka$UTB!_gmV l@kEl+BIENDB`vor-0.5.5/data/b_over.png0000644000175100017510000000343311310013233016006 0ustar jasonwoofjasonwoofPNG  IHDR"Nv!PLTEU8qtRNS@fbKGDHIDATxYKoFCk6Me} I:"7U57}o[ \1Bsogfv8+[V@qCQsRdJ&s44RGVTYTn$8_\`ihj[.Sm\"dS ?yt~TJg猐~{Eܠ0S}Sᕵߡ)M/ 34T DR_XKӠhuT1uwLȓm u,}&i:UZr~}T9!YdPHbIj&kQ^ouqMՃCC 991sQEN wWԃ>@>J[}Z$J|37Jd7PMrTlr55$2d3\֯pc@^R<\pDgi+p"TZP/' ZK=oZD8.o\KhC8-YI0( kYIjWtTF9jViWG rRD7pxdR6-%n K>3vbPms^4+#lt`N2)!C8.XIjE9/p]LnZ.&hn[JghWGsRD8}hUryc ;1(fUEq{fS9/&dSCs^3+#t`OlH<1s`N2)"]M?q\1)!jkXUG:?4+jXHtiVs(!SE8~iU=2)zc }gToL?4wcQnaPBt_ 5,$`PAm J=2uaOl^N?hm[JWH;lX5$tRNS@fIDATc`pB;;$Ŝ=w-LG5,a͖h`leRU ޳g֦ENZƝ9(h3gg%@Y)Efwg֕OdXlZY:KIMdАdWv[zsҾYJA&桕 ;U͈sb5-]GC_;E~RR2\M?kq^Mjo[/' ZK=oZD8.o\KhmYXI;t~iVs'!zd<2)gVF}gUr &QC7|gTq%PC6xb :0'eTDpOA5zeR#t_mI=23*#^N@r]2*"s_NkG;01(!p[q]LkYI}fjWt)"TF9{e>3*iWG{d ~hUr' pxdR!u`aQBu_n  K>3vbPm`OAs^4+#_O@lI<1t`N2)!o\LiC8.XIjp]LiZJ=nZ.&YJ<C7-g{e=3*hWGsRD8}hUrQD7gUFyc ;1(fUEq%PB6{fSp$eSD dSCn_OAs^t`OlH<1s`Nq]]M?q\r^MjF:/q^L[K=lZJ~gkX*#UG:|f?4+jXH|e >4*TE9iVs(!SE8~iUzdhVFzc &bRCoL?4wcQn t_5,$`PAt^mJ=2uaOI=1r]3*"nZ-&n[Khm[JWH;lX#tRNS@f IDAT(c`@'آ!c^\r )w]z܃:\~voqmwXU&;|Yr痎M9K栥|ԅ^gAژ .wXD&>b㣨8Gq.dد~(P 3qjKס J_kUD7{i sCHLBpuzYu#ef7`om=OƉzvgE}Y?U,?2-<ԱVgMgnkoBW|'O>Tap[w|D¼ 5ZW4sqPP1! ;Т_uu557UT͟(9SWhkY-t nSUTPb͕elP <07˱7j&yߞ+{C\}5-޷z +HEu6{s"]_&py)H!< mxo6oaxZ \|qڵkf+``Y͒aysA( V=hZN&< q4uo@3F&HChuIENDB`vor-0.5.5/data/rock30.png0000644000175100017510000000373411310013350015637 0ustar jasonwoofjasonwoofPNG  IHDR)>}gAMA7tRNSnIDATHWWƩʢ Ȏ"A[XC–@H aIBťK]"XAK-wr޼w{&~~gRrғd7ζ[Hs{툾yOmҵܳ޿ir90 ;4C-QTu5[o2o'݉ #]Z~09Xg/Dl&]/z4eA{W) c!ͻއSfH& y>rɹ1: Zޞ0"/8$M H[i( J`T:+8;`@k+.~tFӃFsmxrbJ6t#1`70X27HFՑ{8ygN:|*Aqj ýM݊2Wb¡?Xtdzy;J*!G*vn{xŢkk&6&NǤ40Bbq_/j fX  n@Ɂ@ī%'ؓv?^c(gm]π×\=X!b&s=_Dddw+R-^]&}kl{vzPW}IN:uv @%쭎1((<)[nDL)$I6!i ƶCH<SS(K:h_l@b:~>Fˢ kcGS-N/΄N @ŕ̔#BCqzH&Jhd.Ip6ǠhXE5Z8rKP d0(tʌB`M/ѥ(s+-R>DŽAf€OǨo۵ 0a^RA۟uCpKEanF-ϺN҄:4/ /ܧlP,MA4z ~I.%%ZhPY\rm8z>+L][+ i W3wjtI !X)K;X\gAꨎ  &Ԏ%R'$]s<+EQs=>Jc"DusGB_ -* ?+mA}8i&t~E^)>Aa>`1{M]S6"=XHtљy@, k1i"+q-^ZámȾ@5:5N2Jj',8bG-dήifVUm, hQjKY_DĆFj8',zX񀁞iIVmd<MCI<2oO%p(aSno/y\TlFtrغ(!R|+R.Ұn;#9Ι[0Q]p@T8Ǒ,+(ކ\ :~jB ݀(M[:+ʎ c&Q]0VB,\⩷4AJXˁ gR3?^+R`^frinzBt8h(HQ떎:.Fc#Bs=&D3*ỶoӀO.$D!lkW=: L*Ă8Dwꂛ,SH xy@RQ)Q /^% Љ Ę>1dB:% q靬pZD'O/ R Ku[i1xCXZzuinkKUי!$R] +I % HO!P<-V W` _IENDB`vor-0.5.5/data/rock38.png0000644000175100017510000000205011310013351015636 0ustar jasonwoofjasonwoofPNG  IHDRR݇gAMA7UPLTE+$@5+q$OB6dSDwa 8/&o"M@4xdQbQBu_6-$ kF:0q^Mjo[/' oZio\KhC8-YI0( i@5,}fjW)"jV{e(">3*iWG{d~hU' xdRu` n K>3vbPmJ>2s^I<1C8.-%XIjp]LiZJ=nZ.&n[JglX,${ehWGsRD8gUFyc |fT%{fS$was^3+#t`Ols`Nq]]M?q\G:0jF:/kXUG:kW|fjXH|eiV(!SE8zdzc }gTva7.&bRCL?4wcQt_m uaO3*"^N?nZhB7-lYWH;lX@:̗tRNS@fqIDATc`\kyoN=8PHhT,I(LcUoUkѷ`f[ؾ|繭9 g4P9A˸LIiZo;"#hQ PPz&iܹss{w!.HKJ(kUŭ*\.o*-LcܷK7=\ysjuܱ6{oa{]U;f ɪP;"#`6>]/Jvw_b/[??Zz{ndx?:N3C۽űiPW8/)Jl̴wGyåwaPnrfm'#ըCW5ސc]LMaXjbY$gEiUZ`{0FŽ9Eb4 ŞFMCJNJhu!nH,笆jfUan/isdd5hIQܟqij*ǁ#h_]yY R=E|(z%e(4OK1s3A8[k ^-֗IPJ:utױq)"A'=li >ESHƗ8W._ Fxʲ3(T@8Mh=7IENDB`vor-0.5.5/data/rock13.png0000644000175100017510000000276311310013346015646 0ustar jasonwoofjasonwoofPNG  IHDRxwgAMA7PLTE+$VH:A5,lYI@5+kYH)" yc{fTqzfSdSDwap N@5ydRo"M@4xdQ7-%bQB F:0q^M[K>o[/' ZK=oZiD8.o\KC8-t~iV'!hVG<2)gVF}gUr&QC7|gT%PC6fTExb :0'eTDOA5zeR#t_uaPI=2taO^N@r]2*"s_NkG;0r_Mp\1(!\L>p[0( q]LkYI}f?5+UF:jW)"TF9jV{e>3*iWG{d=3)~hUr' RD7ou`6-%aQBu_n K>3vbPm`OAs^4+#_O@I<1iC8.n\KXIp]LinZ.&YJ<hC7-n[J,$=3*hWGRD8}hU& gUFyc ;1(fUEqPB6{fS$wa 9/&_OAs^t`OlH<1s`Nq]2)"]M?q\1)!r^MF:/0' [K=~gkX*#UG:kW|fjXH|e TE9iV(!SE8hVF<2(vabRCowcQn K?3aPBt_5,$`PAvaPmJ=2uaOI=13*"^N?YJ=nZn[Khm[JWH;lX#tRNS@fIDAT(c`o}m/cvt1iknlҗ˴S3wiDN5~]+i~?fpUY?uSw:HoY[Dȅ>ǬM5G^GյRhfe@Tř!F^g};Y"ǧ7|r*ĩ1Mnݜk;q~^e%_xR7i^ G/)t;N<470?0.k%gH;WȨv4'<2!u‹=pKnӐ/W~^Q yį.ѣABԽ7}dVFGq7P~ĩ%:n8l?l{cfªa]E}ZO6\׍5mmhX+$qO!{S1>ִ%yokiN[e nH.9%`|V87z.P ᣩޑϦH}6Q%SQӷ6h1Wjjo);f[ޓ e91?Oa]eeO߭ܗc_~!Y%鼍ӭX}8a3J:Q (m#7_!v֨(˺6ll4P;3N:0J7/H6rr*@1~~)>0;;O"4)EE\CCZMMgKKe__gg&&3ssqq00@}}{{:2kq^Mo[/' ZK=oZiD8.o\KhC8-YIp[q]LVH;kYIt)"jV>3*iWG =3)~hUr'  o6-%n K>3vbPms^4+#_O@lI<12)!o\LiXItRNS@fIDAT(c`cN PA bHfkrodJÅ)ZntrU%heK\UI`u=bCHm1q._$osLM`$M܄[֞X꺑(x4͆ԄޡŽ{o և!h]Tkֹ΍@v,NrPrEDe20rQ>yd[9E]]S=T6h7m|(taeJRzja l**@ CIr;ŪO ԜԢoة:Oo7_s8HFS(: :SN^S(iBfɋQvDdF,E5R AhIbٳguQ#IENDB`vor-0.5.5/data/rock44.png0000644000175100017510000000334511310013352015644 0ustar jasonwoofjasonwoofPNG  IHDR  4XgAMA7tRNSnIDATHSZWӴ1}EAT@AT@DEPVw4QnbbbM-m'm9u4Nq{ι:+\ԯRޙXy4;\]7'?lB)_I.)z%}L_ @j-n;~{/q@T:jVG Tiו|6O'/zIo<[/mO, q[[k6~; 1E[S~7x8ykN;3[ؚ8>}K<^$zAe3(*qaW[CbTV}|%/Z^hXkO 8>ZVQHvǢs *Ts1DYעwfd q}k&h_&Hwĸ ;:E^iMl)l:)GWa/ocx0n[/Axw)QEy1a C;Pͅ#1M 9'RϠUa踧K9jY;m0HEm `*ZЊt8O>amRS<%067G|G؆sFEeiuYu5ȡ yG{R>RuӈkG~+ߎ3 I($/$J(3>_{k"*( aB~pXBT̪%E4D崤kbE$Li \dqn`2v&"œk{gK`'v0E i(D_ XHBx&H{k3} xD ^#hڏ."&RBOƐd(jI`P d8/pGE*"jDHKjqv r z*+j5>.43p, C0tJTX>pZE9r+ъzU%W9HRNcLȱIK\õqY>)&^SǦǀUZWY)зIqjJQ Az`KK" 6Q(r+$Zc.z-&1.*9ޠx^Cj]9`d@*H]K0Hb.< ֝zj*M]ܴ!oxDt0` VD'2H(/j,o\BKaȔ x߇8xL-F5rLe`N":D(҅ឰP>%14yyִ!Bn9ӠTիz@c ` a6X" bCwCVp[pQ&(P) QDEM1 ML|Ad( uΪ EYTKZ5r*3X3+Ү^FHp,&ݘNYJAm`B V֕i[l}-|#0u2?GwQ!@'hT}`1'*Zi,z+'16J q0Fzb/j 'vBm1l@J)jZb,~ea.?lxF-(5K.ʔfCڠ񹑝c+d+v#KRI  nvlzF (Zs$ #Î\RemJzpp`60ţ _QRNiD q^Lܴm|7XUL~{lXB`:hL&.r$|f.%G qП^7;3uJ4O޾ B7a:mlL-tG kF7NEm0.K#.zlbtӇ+8v}sHPe9 8SSEW;/Rsx(-!R8/Nf'1̸ψ7b˧mIENDB`vor-0.5.5/data/rock48.png0000644000175100017510000000172511310013352015650 0ustar jasonwoofjasonwoofPNG  IHDRW?gAMA7PLTE+$}f@5+UF9)" {fTqwb9/'dSDwa N@5ydR"M@4u`!7-%bQBwbPq]\M?q^Mj[K>o[/' ZK=oZiD8.o\KmYzd<2)&QC7q:0'pOA5zeRmI=2^N@2*"s_NkG;0p\1(!\L>ikYI}fjWTF9jV{eiWG{d=3)~hUr' RD7bQCu` 6-%n K>3vbPmJ>2s^_O@I<1o[i-%XI4*iVSE8=2)zcvabRCowcQ 5,$mJ=2_N@r]nZn[KhB7-m[J,$WH;lXk^AtRNS@f]IDATc`n (`C]pLYn +n.3X0U| Hh : ,MdzM_c6AjMYr LRT՘ҲyKGy sBB,_YX5@Z!BԈ%:lwj$E {̹ғ鷩gNp/mk^7DURӜA={}gLUUBEɊ@a(UՕ59. Q kYZ¿U7Vjs WE1(k/SU_l3&,Fjk.Gc SmIENDB`vor-0.5.5/data/rock07.png0000644000175100017510000000521411310013346015643 0ustar jasonwoofjasonwoofPNG  IHDR*(igAMA7tRNSn 1IDATX׉Wgp'₂ " "Ȣ}Wp$:LM2qO8}yV{i>?gт%;t5o.L.t)=VUC =r347Vhکw[g:xo"K[lޜYoMmW'F\=`%|{oLJctl>wnbwަ痻nw0p.'/AWw?p/u/>=wj_SS鮪FUn;BJvd_LK= P*7a~~4.D;$Wwi+Q oѶ*7bONKE䷰F߫{Ðzb4g9Ac]>59&1pZ_Wz<Κ[ק&QW?pr7#HT!)'玳ouɘgr/Q?2R9`Cڊfn|{F-  bۃn}~"AL,˧ E;29W%Ŀ O Wz'c->0EowUNq"Bӝ5?k]2nH3kӓE`ufF;hŨ*< Q V.t d_?B T,hܓyyN bCzyf%t{Dϛ}NDvT'KMfv7܉cп;kmH[xvQ?+uk0ˢ"9 c#DutHk%uVza'Q}=o9WJXlSio9(ر}=ATKn:,X[~qWЛ|Tq^vB|܌ӧ-^0qFH¼5 ˏ"$` <=BZ>lg6ϝ8 tfPKaAuHi7HaZ۝!0Tg]K7D}He -7|4-*+vQ/%1>ߗ*"Bi?̮b|~_U q\A&ϕAm2#l8~Hm.wmDQ"OJgOB,*<8? |mQＬצ&-MIZqJ}w 8/KYH֊p@U-{B $9SLyA@f<;u[ZY wd*+/Y߫"phz^B H&?GWzT6%]ѶJ5U^S+V5I)Ƃ:hzbB4Vޏ23Li w8"vwgoX]mJcÆt!'=gYPC~O ,uBE\L4v>q)ګHfXg#Ύ аe] &p-i+]B*0X.]2 ,xy9(6m"A.@VLAv*_(fLko۶Rg:)p^YяBPPFpnaM$V<"2tIu)Q ,B$b M4`c8Y?!BhUT,V4ȯ/bץ&x=۽J䴖l]&GY2#-D)Db!)4hGJ \{\Ea/}~۬b6GVo (EzsWj*zuL:2{o>z-/BXKG,6(EENyK mAbenT{s%,]ǖԺB+6)rev}2,݀' Er&?{?DfHq5{ǒ_\+!W&'JwZXڀ*݄aMI(7=uxΌ+[8IKKp/neplE"&%,00tbkhi+)t;bH.H`FxApea[g`edMރt%jeD73@)8yh !3ԃeS&C57Ew\mdtC+C\j]k++؊-S"l :̛Ed^%N5U2g.49.׬t R֦$*&_u{f10 Y:9Q9@A'',ٲ>՛Z:#BkYVF`ļWe;W)ޢZL\H~:Dpƶ°Xn_4sgό? &FxB-Σ-}(3͇VJ?HbIENDB`vor-0.5.5/data/ship.png0000644000175100017510000000314611310013342015477 0ustar jasonwoofjasonwoofPNG  IHDR gAMA7tRNSn IDATH[PeǝDPAlQ1.Ҳ yϜIΠrDH4̲;r.颛~.";ϼϻ+V,oFdd8kjެ-) [g5k*iEEm.wPM1YʗwDo\AArrOvtbom}ucp$ *[zrY Մ/FcmWzz9 46MSjJP^ĭ־sgyfhkd]z]*"(5!_NPl[3P%8@H-Hqv[H,()͊HU~OD{}}h`~uI2A)9ư5m\؎+V.VL(:CCd|˃`{A Gs (Ş.hhui"+1Z]i 9_vz>}}.uv44QNDTŖ];6h>>N>9ݹs?߸͛ܺ|7@v>5裲iED"2)zSBSB:ТWOzwov_hd3~V__Aw6U(H$ͱJ1M􀠈+SS_ss ~%} *O4@b$xQ+qy [I Pg(blgw̏HGǹHNĦh{j T!,TBAYN>Z{KK-fssn.LcnzH%3MzL)?L 1DKwII'h`67y z;A~aPO&,N?QɣbDzqq;> &S w*+P,ê *:;a-+D]%}#8x\"QKp:%hIl] zmESbP\(<,Z*nYY,K@ԐxVVux!÷y8j𦬬o~;!L99"!.ZP>V4IBt :Z[>\HP6F;d,4M T-E6S}wEE%rX#?#LWc]m@ 2"'\tU-ݼ@}l \.@E韈ع3BW7$'A8ymbxM}iݟZJgdoXC?&  YNqc8GfVzZ[NP'IENDB`vor-0.5.5/data/rock19.png0000644000175100017510000000166711310013347015657 0ustar jasonwoofjasonwoofPNG  IHDRR݇gAMA7PLTEVH:A5,}f@5+kYH UF9 {fTqOB69/'dSD ydRo"M@4u`bQBu_ kq^Mo[ZK=oZio\Kh-%~iVgVFzcQC7|gTPC6fTE $zeRuaPm3*#^N@r]H;1s_NkG;0\L>0( q]LVH;@5,jW)"jV{eiWG{d~hUgUExdRu`aQBnK>3vbP`OAs^2)!o\LiXI[a}pͬ>_&fe @8եf6Z,XR d_l%e,͛%X2!wF$HkZ_҂)}+sgF1E*X*=9ӱp .K. R휕۾"ѭh:]1vEa G4&%._PZLJ@ , Q]au!IENDB`vor-0.5.5/data/rock35.png0000644000175100017510000000435411310013351015644 0ustar jasonwoofjasonwoofPNG  IHDR#%GgAMA7tRNSnIDATHׇ[gp76 "EE&Ez&MTi j̮1M115Oo15gwyxfsΜ9=,Zx•˗;vlݷk[m) V^>|lݴxw7~kdX[E_CCuE^쯿=:YX˖,$ؘNֽwۣ??t͑[cgzjnR;__쬺{^|8ubfHk_R\̋;c/n7Of< 'NC6|Tg~;vx{TW:tTsiIne~f <٩׳SG^͢5Cک<)v 9Jmh*Q<~tst@!w~7.DUon t>9}U<@cIVj`dPcvLHgܧu4N+f 9{SUSg-u+_^r D ;\h>|\fO^oh;S;yɺE zRRt ާ`{4SM.c:Bp%|_xQo:zѫC>_I!*n^j:g#-+(ۍWqo_\yDTQ'J&ƾDP֢R@z+Zzo6 xtGZ_SU" 4{Ճn ܭVe ,'d^XQ`nyp3+V7,]%AP J}??l|HI=QH$3?pƒͥ5G(׮\deBÔ<&$U 3A7t1k Xΐ^cinqHt3vmm*NZ0 1 ieIJNR|~1͂m  /OVꂦ\{j ;$Ʀ'eBd.$&t+zij7cx$ErR-봰@ZD$nE#5cX"mIl$..aZ]hX `4#֊sV9zpmYq֍H.`E@'p#>>ֈ$lNZẶJ̠ {{M+^}3=_`,jPSJi)!I3%|]m;*E8 i#REm+؟B Yz8m1YbbU՛"5],a<"3,+ǀ(rAgwwGB*!7ykQvTu˜XP:6:V-;+5!wx,6!| ̛;פegL3 1`9"[|k)Vx1~sH9 yM%\l"QVzO9̟'H?`CFhk97l/ʖ k _m?˗.ڵ}OC;-z{ d'6k>1SػQʍ:_okvX@D{ѰW-_j}⿎^W7 IENDB`vor-0.5.5/args.h0000644000175100017510000000030311310013233014211 0ustar jasonwoofjasonwoof#ifndef VOR_ARGS_H #define VOR_ARGS_H // Look and Feel extern int opt_fullscreen; extern int opt_sound; extern int opt_autopilot; int parse_opts(int argc, char *argv[]); #endif // VOR_ARGS_H vor-0.5.5/vor.desktop.in0000644000175100017510000000030011310013233015707 0ustar jasonwoofjasonwoof[Desktop Entry] Version=1.0 Categories=Game;ArcadeGame; Comment=A quick action game Type=Application Terminal=false StartupNotify=false Exec=EXE_NAME Name=DISPLAY_NAME Icon=ICON_PATH/icon.png vor-0.5.5/sound.c0000644000175100017510000000410711310013233014406 0ustar jasonwoofjasonwoof#include #include #include #include #include #include "args.h" #include "common.h" #include "vorconfig.h" #include "sound.h" static Mix_Music *music[NUM_TUNES]; static int music_volume[NUM_TUNES] = {255}; static Mix_Chunk *wav[NUM_SOUNDS]; int audio_rate; Uint16 audio_format; int audio_channels; char *add_data_path(char *); char *wav_file[] = { "bang.wav" }; char *tune_file[] = { "mph.xm" }; // Return 1 if the sound is ready to roll, and 0 if not. int init_sound() { int i; char *s; // Initialise output with SDL_mixer if (Mix_OpenAudio(MIX_DEFAULT_FREQUENCY, AUDIO_S16, MIX_DEFAULT_CHANNELS, 4096) < 0) { fprintf(stderr, "Couldn't open SDL_mixer audio: %s\n", SDL_GetError()); return 0; } // Preload all the tunes into memory for (i=0; i/dev/null | pnmcrop | pnmtopng -transparent '#000000' -gamma .45 2>/dev/null vor-0.5.5/args.c0000644000175100017510000000405511310013233014214 0ustar jasonwoofjasonwoof#include #include #include #include "args.h" #include #include "vorconfig.h" // Look and Feel int opt_fullscreen; int opt_sound; int opt_autopilot; static void show_help(void) { puts("Dodge the rocks until you die."); putchar('\n'); puts(" -f, --full-screen"); puts(" -s, --silent No explosion sounds or music"); puts(" -V, --version Print program version"); puts(" -?, --help Give this help list"); putchar('\n'); puts("Report bugs at http://jasonwoof.com/contact.html"); } int short_opt(char c, char *arg) { switch(c) { case 'f': opt_fullscreen = 1; break; case 's': opt_sound = 0; break; case 'V': printf("Variations on Rockdodger %s\n", PACKAGE_VERSION); exit(0); case '?': case 'h': return 0; case 'a': opt_autopilot = 1; break; default: fprintf(stderr, "unknown option -%c\n\n", c); return 0; } return 1; } int parse_short_opts(const char *s, char *arg) { while(s[1]) if(!short_opt(*s++, NULL)) return 0; return short_opt(*s, arg); } static char *long_opts[] = { "full-screen", "silent", "version", "help", "autopilot" }; static char short_opts[] = { 'f', 's', 'V', 'h', 'a' }; int parse_long_opt(const char *s, char *arg) { int i; for(i=0; i